ELFp4=84 (44vvvv7}WD~@~@/usr/lib/ld.so.1'  "#'+,-./0345689;=>BEFGJKMOQRSVX[^`abdfghklmnqrtvwxyz{|}~ !#$&')+-/01458;<=>?@ACEHKLOPQRSVXYZ[\]^_`ahklmopqrsuw{|   !"#&'()*,-/01235:=?@ABDFHJKLOPQRSTUXZ\]_abcdfgijklmopqstuvwxz|}~   !"#$&(*,-.1368:<=@ABDEHIJLMNOQSVWYZ[\]^_`bdefijlmnoprstuwyz{}~    !"%')*+,-/01234679=>?ACEFGHIJLMOPQTUVWY\^_`bdegklmnoprsuvy{|~   !$%&()*127:<?@ACDHILNPTUWYZ\]_ceijopsu     "%(*,.23679:BDFGIJMNTUWbcdefgijntvxyz}~   $%+.46789;<>CEGIMNVWY[^`ehnry{   %')+/024579;>?CFGKPRTUXacghkqvx|  #$&(.58:;<@BDKNRSXZ[]acfhijqtwxz}    w $  .x0 >X L ( ]}b opv y}L 8 0 d ]{ P@ $X( $0@ }|&l( ! x{$z,%# 3 ` B0 OwV L f Xx y 8( # t   YDl x  `h    8 &; . \ 6  C( O8l  b@nz M (H $ Ut  |\{sL z0 s  L y,}4$x-9¬@ LD_`pw4w* : z4  A%0  p H  | ;@  8@  P ,~@5yB*t M4 Y gD k$rHD || X ,P  <  V @  0X  h  X |,- ɨp 4 < + k 8x D P OdwkXF& x8 Pd  TT  G,  ,  `$  LL   p la  '1Rt ? M4 Vt c'  m Z08 y~}L k zX& #x(  I8 @,  a( x $|=DEL O @@ _ tP t%4  N *T | C  4  T %\ T< mL< H xH\ &-X ;t FX<^6L jsu\ ~<T  . ,d0 ]38 Ƹ 0 L    pH $ < -%0 3X  @U H LD ]l k v  ~k l< &( 08 HH $ d T Z\  (L  T ! 1$$4 B b K tL Zh a lwX w z@ y8 h < `  -  dP QU@  Pp  , wp   #$ / ; XX I WS g( q t y y YDH g   xd T $ 1D  ψ t <8   #{ 3 L( C Q¨ X4 ayt fh o y L(( 0  8 | /& $ %t<  ( @ Ŵ l V&  $* -D :| Hx P{` Z2 j8 q <  <   4 @ L yP < 5T  .)< ; ` IaP2p [V~& h  }@ 6 n HL 4H  mD  Pl< ]` d  <  c (6 MŬT p h  uH ~[$ 9 6    /x |h P$  y 04 44 0),$ H $ _Hxr d( ~   ( 0xT  Ð( yD  8 z *  'DL   „ ̬8 # +{9ŁM -  \D h z}h    $( pw`  ɠ 8 )x$   ( lh 4Ftp K%0 XfkdH o\, {$$ T  ]dP  [| x {   dp cH@ '$ |   h (,1{8 \d D  QN\@c%40 q8`X tw ^x qX  4  w  XD h@  z   x@ [P !x(#t 4(@ 6| M T t hoE q|ń(w3ϔ l  Ǽ\ $T , T  h exlh   \ ! ,$ 2zpC $ PzV ] ` rx$y 9X T *l w (L -0 hx p     Q T l "h  , (8, ;|tKWb& Vŀh  s L ~XW& w(}( 0 4 x@`  d e ! 'T@ 7 +-|, 45| E g T VL a øL q0 ~'h #8x  }@O  Wl e   8 %4@  w)  5 d, @D K\[y  do \  e4 Y \t  h  h  ( L  x| p! &@ X % <P 5C O< Y$0 e FT p( } $  i  l0  ( 0 p  lhp 58T >8 , 09 7dn | BP, G d Xs4 j@(q`x }| lU& XhD Ÿ |4-( X & 1$ y ( x( t !z5,T >[4@ J][yhdzq*D )]D |  ||  P   T   $ | P 0, f8   , - W$H ;$L |D J  .`L Y(  j J( z dD -Lt  H$0 [ ,p H }\  0\ &H 5<+0 I;H U| ]  o D, (l@ 8#4 xh u X0   U ,5D V & ( W& "up< 5 HTL GX Ql a$ oŰw{R\ $ d     ^  0 V&  + BH 1 + p 5 t@ 9(A P Okd X D, h .y*P D L` Xl& l  M |D \8 T x " d0 -| 7N A L E| W 0 p cz x( P  Bd |P KT  T  @d 8@   P  ! `\ !0 'x`!,!=!LP !]U !d< !pż! [ H ! 7 ! ! ! *$ !$4 ! ` !!|!   " {"¸(":0 "- "6|">"Eh "Q/X "Y)$ "m 04 "" "{"t " p " "M"0 "|#k5 # @ # P #* #8 H #B{" #P Kl #_ #i  #vP  t y#8 # #` # ` x# # a@ #y,# Xd #4D #}` #Έ< $ L\ $ 8  $%ʬ( $+8 $;$4 $K{$VwL$^U|D $q% 0 $ SD $| $X& $ D $ <$ $ $  $H $[t $  $D % L %v %%(%,x  %9 %I,L %U%^0| %g  %s %4 %%{0% F\` %LD % << %P %+4 %-0 Y  # ˔ &0@ & T &z&<&';@ &3  &> \` &J &Z&`&D( &s=p & &P\ &x& &  & < & p &V2& &8&'h '[ 'v'8( 'G(  'W'_T'mL 'v C  'x0' @H '7t 'V@ ' 0( '@ 'x  ''0 'z|  (( P (   (& (/.$ (9 T,8 (FH + W$ (Tz(([l (e (L (sO(~ K Fl(, ( p (< ( $ ( mlL (<0@ q : (w(=H ((x)@ ) ̨ )< )&Lp )4 O(< )B  )R. )\4 )ex()l < )v¤)})Ԩ4 ) D ) ( )( )d( ) IpL 8))$ $W})z)P ) X )* P *( *!, *./p *9R *E~>|*W < *_P*mҬH *|9< *  *{*-<T *L * *t * ***\ *,+{+( +"   +5y+?W<& +J|+R8+e L +r +~ l +h  +°+W& +|++$0 ++\ +{,  ,w@ DUx &, ,2i,F,N+ ,Z2l G  ,ǹ ,x\8,xXD , ,  ,'@ ,,D(,X( ,U ,U ,  , Zh - , -+  -"v-8 -GT\ #T| -Z HD $, -eq< -s-z -T- D --{l- T -Uh  -( -@@ -B8 .d0 .0 H .h #w.)f .2&@ .@D.P .^<\ .k(.rY .<. <  .l .H. t .l.{T.`0 . @@ .t / .( /)P( (w|/- (< /: lh /I#P( /Sd /a   /r/s #x</0T8 //+<0 /  /z/}/0L /%d0 / /v0(0 ($ 0   0, 0=0Dx0P 0\ m ` 0k0wT` 0 G, 0 8 0d 0 Y 6H\ !\0&` 0|0@ 00Ő 1 I4, 1V& 1!1, $ 1C*< 1P4 1Z(/1c , 1l-d 1  \ 1 T 1}p#o 1q 1y1|1 1Y 1 1 , 2 ! 2  222{ 2?8  2LL$ 2VH 2h H 2x ( 2p2l$ 2{x2 D 22  218 2P 2@!2l 20 3 hP 3}3#l(3* E  31VX& 3>" 3JX 3Vy\3` 3o(3x m@ 3  3 ( 3 D 3  3 HL 3G3$8 3x3߈p 4|4 4&/X 4: ), 0{ 4G$4 4Y@ 4e  4m}4t4(4{`4 | 4 G` 48 4  4 X$4 4 C 4  4}4zd4% 5|5 X 5! X 52858BPH 5Ah 5O{H5^+ 5k 5{ x 5 505(5 5  5 dp  5$4xT5|5 D 55zL6\ 6 d<4 6#  65W& 4%$ 6A06I6O P 6_ 6n#( 6z l8 6 6<T 6x6 ( 60  6h 66+D 6Wx 7 7/l 7'|871t@ 7=w7DX& 7P7_ 7i | 7{7}7 FT 7d 7 7x6xx7 ` 7 7(P  7 h 8=h 8 *8 8H 8&x 81H8By< 8P 8n j 8{0$T 8Ќ\ 8~088 f 8,T 8z8W& 88 9/0 9# 9.q` 9=  9H 4` e t 9S9X4( 9gLH 9|9 <` 9wd9%( 9 9z9  9}9T 9 DD x9($ :~ : Lt :! :1:9'I DT :Ey:N3$ |x :b *4 :p :vT :y: D a,< : e "0x]y:t| :  EL ::%Pt :  :y: 8 ;o _y3E, ;L;! D ;+%` ;@`L ;N K\ ;^ ;i}X9 d, ;p( ;|zX;* ;@< ;p sUX ;q H ; 1$ ;~ ;  ;\( ;~$";&` <O@ < <*P <5 8 > ='=> =(>' Nq>0 (48DPT`lp|!!,j0 w0vŰt`8^vwwuwlw(w4Kw@wLwXwdwpw|wUwwwwwwwwwrxDx xx$x05x<xHxTlx`xlxxx~xxxXxxExx$xxxyyy y,Cy8yDWyP%y\9yh7yty.yyyKyyyyyyyzZzzz(Hz4Nz@zLpzXzdYzpz|>zzozzzz?zzz3z8{{  {{${0{<{Ha{T{`{l{x({{a{{={{{{{{{||| `|,i|8|D|P|\<|hH|t|[||||m|C|||F|a|}2}}n}(}4D}@}L }X}d}p}|}}}N}X}f}}}X}}~~ ~B~$~0 @"cD"c"c|, @'p $p+`-` `?-)#t- =--% # @,w@,t!h# #@,h@#@@,a@,b "      **`* @*  ""  "     + **      + **     **   㿘 "    //// 77㿘 "" "   ////    ////   7777 `" 2 2 *@2 *`2 *`*`2@2`""2 2 **2 **2`*2`*2`**222`22"㿘`" 6 6 6 6 .@.`.`.`'6@6`'㿘" &"6 6 6 6 ....6`6`6`....?6`6666?&`" 2 2 2 2 *@*`*`*`2@2`"""2 2 2 2 ****2`2`2`****2`2222"㿠N @N`H @+R* @+ON`?`* ? @ `N &㿠@+C@@ @&@+;.㿠@+/&@&@+#㿠@+#2 3p?`㿠@+@+@ '@@+2 3p?J` "@  J 2@  J` ` 2OJ  c @ # c`@" a @*ޞ㿠;c`@7㐟ƀ H N -@ +@ @* N @*ǐ@*ː @*㿠;c`@5@ @7H ( ΁㿠;c`@7㘁ƀ9!  㿠@ 5`@;c`@*`@ׁ㿠@5 `@9#@*r 㿠@@*RÐ @*b㿠@Ӑ ,,,,,,,,,,,,,,,,,,,,,,,,,,,4T,T,,,,,,,$,,,@ %@;a0O `@ a8#\!&` %`%@@@ .`O O  %@  @@`.`O n@`&`O /L`@ٲ   d@Ϟ `@l@L/`  L`@ /(sH8/ E3@*`@)ĒD `@@):@)4 `@@)*@)$`#`#d@)``@)``@($@)@O@+ L ` @@  K `O `\N`  "@ \@)I.O"@O \@@@ HH`( O@O `OD`%>..  .  *@ a4@);O "@` M`"@`M O` L`^@` L`/ L`O6 d.  .  .  .㿠;cc`@ $' ^$ @) '  2@ Ֆ  % @g ' .C'  @(  '   &O㿠;Nc;'c㿠'P'T'XP㿠'H'L'P'T'XH㿠'H'L'P'T'XH㿠'H'L'P'T'XH㿠'H'L'P'T'XHb"  #"  ` 9 `` > *" *`(` *` *@ *` (`  O"?  ?@( `* bu@ * 3 !@ O 1" @   q H㬀 @!b c 9(#@*` *)`#@*` * @)` 0 r@@ :O(" bb ?@( * @ " 0*@ p1`@ O2  㿠`@. ?` *  :`! c@ S@;`,`;@*< @O@^@= d`? 2=`- <@&.>/`? 㿠/5M; Nb.b@!"H&@'ː &% ,f+'&,%bH㿠- & * & ' & $ & ! &  &  &  &  㿠. @'% @'%^ @'% ݐ @'%א @'|%ѐ @'v%ː @'p%Ő @'j@]% &    @?&` %@@$#@ " " @% `$ '@#@" !@O۸@ %@$@$ #$O  㿠@K&  &@@  ` ```   @@@@@`  @`- M``-? ,LO,?@4@  -`M`@`-   ,L``,  $O  O`. `. N`. N`.  a`H @?a`L @? ?2H?@ ?2H?@ @@ @??  @@?2H?`㿠.`'ᰯ/`. 4=>  @  @@ @ K@@L@H+,@ L@@K@H,,/@+@&@&H.&'@4H.'( @#)a, @@@.`㿠@G.`;aa4````?@? @ MO @M @@ "H  - O --@-&H  2O  @`&@@`(&` `'@@`* '`( @ &H*@`, 4H-㿠. 9!! @4    @@: ` 0````@L@ L @M@ @  @M@@@@`@#\``  `. ---@"H`@$O @ `@#\ `㿐3a. `4O`#d#``@a `0````@@@  M/L/@ @L@/N@/@&O@@#@ O@ @d@x@ @  `Xd#dm `\d#da-O--@O,@`@1O @.@O"@Ld @@ @  `Xd #d `\d  #d #\``@ &@d@@ @ ` Xd #d ` \d  @#dd#d"H#`$Om d@@ @  `Xƀd ` \d㿠@@7ᰥ.`ᰴ  4 0N ``@@M    @M@2@,@M @@3@    \@@(` X  `,@@-@@  @\   X "H`@$O @?@8  X@  ` @M@ 2@,@M@ @@ @  \`,@@-@ @ `\  "H`@$O @ @\㿘#aN `@a & 'N  4 0@@L`L@LL`@  ` @   `@`@  P`@  %5w $@& P  T $ T 2@ X P& T  X@-wX& X  \@w& \  ` @`/w& ` @x '` N   ,`,,,@d  $  @(  `@ * *` -` O* 4@ * *` - `*$O*  `@OՀ     ,&  *`'@%    (( ,(@ `(+ ,-@ (* ,O*@@  (. ,* $O   )`& ) ' .  N `"@TL`L@L@L`@H@  *`@/K/ @/M/N @ #\ `  ;@N @@@ #\ `  )@@ N  @ X  @ \  @$@N \L``@  L`@@@  ` 8  @4HFN N  @ '` @ $  , @ *  ( , @4@&`N  @ N `@9  `() ,( N `@ `@$O (. & . ' N "H#L`L`@9L``@5 ` ` @*` 2@  P TL`#, P@L`,@$  P@ `L`,L`@ ` P `L` , P `  L`, L`, `, `,   !* ;`4J  2@*   &@? `$@ ?@? `%@@ `4+`!4*!`4)` ?㿠@/ $@@&@?9.!%@6@?> @?   ?㿠;a`4K @.`?;`@ 5 '  `$p 4 - 4 @  + ?㿠!!`4H@:!!` $&H @ N`@  @`J`2O @ ` 4 @.  ~` 4 ` @ ,` `4-`?㿠.K?`@ 2H㿠9@ 2H㿠;aa$N!@^?4H$@@?8` .``4``K@@ @  @?#`&&  `&`?`@ @2@+K@"H +`+@()&H $O `&@  &@ @ *& `'@ @ +' ( @&H,  , @$@ - ?㿠4 % M $ -`4- 4+`@=# $ᰮ  `@* `4`` ```@@, `,` ,?`O/@,,` , `/` `$O, ``(( ,/ Ò /` /`'/`& 㿠;a /  㿠;aa`%@`$ @` @  @(`& `@@6(`',` @ `0 @ "H& `(,`,+@&`0`@@ &/  O/?@/  $O/ ` `'@Oр D a`4K *  ! `$" ! %"` !`4 `" !4 "`!4H0` 30?&@? a `$@ ?@? `%@@*``4`@ * 4@K@ * ?㿠 ;Y a7`7` @ ?!`1`!(@! "  2@ 3    3` 2?@?`@"`"2"`2*3 * a  0 0p? 㿠. /.`᰹.N`?`? @ᰐ  ``@``@ ```O``@   ```@@ ` L@@ . `" - 65`"H6 㿠;a < $ % 2@ 4;7 $ @g $a' <Ɣ < 4X 㿠#a< $ %`@a $ @L $ "< <4= `@&'`&`  @(- ,-@` (- ,,`@O @@ (+ `,+` @$O(.'.& 㿠#a8$% @ ab $ @ $ !`8f `48&8&4@&'``&  @(- ,-@` (- ,,`@O @@ (+@  ,*` @$O(.'.& 㿠9!N `@ ?@`@$%@!@@   @@@(084<, @ "( @ "`, $ @ $ !`0  0 $ @ $  4 4z@`ѐ $ @v $ # <Ք <g`@ $ @c $ #8” `8T͐ːǐ 0 `&@ `-` 0 `6H-` 4`&@`(` 4`@(` @`u < @&@ )  < @`)  `@_ 8 `&@ `*` 8 `@*` &  .%&`.$`. @(- ,-@` (- ,,`@O @@ (, ,+@` @$O(.'.& ?㿠5@ @ % `"@%O` 2@ %`@`@ @/` /` %   㿠N `@  D`"@. @. .  0 0& 0 4 4& 4 < "@ 8  <& < 8 @ 8& 8 (& ( ,& , &  㿠 @z d.07 "7 7 ˑ200 "@p ' / $/ %Ð @h' ( @b' , $ @\ $' 0 $ @S $' 4@&&&`  `@& (/@  ,-  (- ,-@ (- ,O,@  (+@  ,+ $O (/ '  / / / / & 㿠@"@; N 7ᙐ` `@@. ah @. ?O` ~@ `ap@@# @ @ &`@ $`M O/@ M/`` *OM,M@@@@ɐ @@ 2@  M@[ 㿠N`~@ %tɖ 'x|@+a|)S!@ - N@ 5 ;9a" 㻠l$@ @w㿠@?@l?7` 3p? 㿠;a@`@; a@[㻠@Y$@3O@0O a @% @ @#/`  @`/` ` 2O/`    W"@ .@ @  O O߀ .`.@ .` 㿠;@a 㻠$@?@ 㷠$@?$@?@ 㷠Ӓ$@?$ ʔ2H?㻠$@?%@ߔ㻠$@?@Д  &H?㿠@?@ 7` 2 3p?㿠@?@7` 3p?㿠@?@7` 3p?㿠@?@ 㺐;a$@x@@~"@0?@? :  `֘ + " I@ 㿠 a  @. >&0 @ @Z" W㿠N @ \#     ^    @u \@\ ^M`@o`e@Q`s@I`b@B`n@;`r@4`t@-`a@&`\@`^@`x@`. N`E N`* . MN `*08;8 .  CM. ` >M. ` 9M. ` 4M. ` /M. ` *M. ` %M. `  M. ` M. ` M@M @ O \.  .  M.  M O. 㿠N@t'` a \ n e r s ^ b t x@f`@. .  [N` @`. .  SN@` . .  LN@`. .  EN@` . .  >N@` . .  7N@`\. .  0N@`^. .  )N@` . .  "N@`@. .  N`6@. .  N>`.   @ ; >`.   @ *`&@.  NO. 㿠N 9 ؞`K@?!T!`@!/  @Ò@T`@&O ?㿠N 9 ؞`K@?!T!`@!/  @’@T`@&O ?㿠N 9 ؞`K@?Sa @a/  @ @wH``T`@&O?㿠N 9 ؞`K@$S!`@!?/! ? t@ @l@`@@4@  T`@&O?㿠@-@+V@* a)U! ,<a@5!+ga/, %ڐ9 !&7O`؞`+ ?㿠$ ;@9$'a;$ @2$'a  +cMbK`t @㻘  ` O@*` J @K`! @/,@@h ,@  <@O/@`/@  d@  AO<@`@ @$L2@@ '``O$ O+* a@@@ @%M2@& '`@O%/- ސ @ 5@@$@ @' O 2@  '``O'  O㿘9 $ $ @/5'`O `@ 7'`KM2@ / KcM @3a'`/q/)#N+%M#LaX@#L/MO@ H`{ @ Q!H ~`O`@ O  `@L @   @u2@O  H@L z @ V$R`+!D 2tO `@6* =` @ `/ ' @O@  / OH  H / / / @ /  "@ / / /"OO L @-   '@  d@ 1 O O, 1;.#MO/cO/ O  9'`;!/#L#/cO,#M,cN㿠;Oa`@ @@ 9"NN@  uKc`@ 㿠;5`V(`@(  K@ `T &O2@ T , =`T4--> &* ;``@R`(@H  ԗ)` 㿠쮐( ;@R('`ԁ 㿠;9`W (`@  (  V`&O `Қ   8 g)' (`: 㿠;`'`* > 㿠. ?` @"!@!ސ*00'༛;03`ȣ+`-Ā @97#LĒ$.5L!㿠;` @.  =`@@@ *007;0+`@ * 3` "H 㿠.00ב:00*00200 * 3` @ `  *  㿠@ܡ.`@4  @մ)s    * @g@?@6@o) :    < @   @D%?'`@&`'@@;.` @8`0@ @ @+0030@6@(  5   H   4 *2h"H4  @`- 5`2@4 4 * ?56? 4@Oƀ`    @"H @ ,@&G4 .0`򀤨 @4  4  @  4 *`2 ("H @) &G 6G  4  . 7`( 4 (`0"H4  @`*`2 h2@4 4 .`  5 N@*N@ *N2O* /00 ?30?* 5 4 5 㿠,97 @ϒ `'"  @ǒ '@ '@ 'В @ 7` 㿠;9%`;7!`   k㿠;aВ ?' 7O`A @ȳ* 1>`!؀@ @ @ @ А* =MA`O   㻘`,5.N. 7`@`H&"Hx@C@@#  @1&."@k!L!@ 'L`@ b  @ bO` @@tgϔ$R'`@' 7` @ : @ &`J @  $OJM - n`&`-% '`-  Oߓ7` #b- -L x&@`@H&9/" j㻠'H'LH'P'T'Xꭒ$\ 㿠.0030 ( Q㻠'P. 'TP'X6 ꔒ$.`=㿠;Ob`@3&`,5, @9/"7&,㿠;`0'`0@5V`6㿠9 0`' 0@5(V&6   `? ? 㿠   ?     㽈 #\;b܀ @ 5܀@@N`N` @o $`+#`#dba$` @ `'`'ɔT`  @ W@ +@>8 @;@@` dM`` @%`&㿠 H ;b ? / > 9 '"Vꀢ`@ 'b1"5`@1"J^@,@@'#bL ^`@" @'%@n,\@i\ @ @R\O\-'  2H'4H`@  /`@/`'@M/`>P9"0 Nj ڔ 3bȷ* MA@#>;b<bȺbD@@j@o * 9 HAO +5 p  + bpY y5 4  3p?2? @4 2p?`㿠J  a9* "t?`  .`6 3p?㿠;bx; b| g E9"ux9)"Ȼ. %"̷?`N@5 "̸"̴ c6`5 "̧3p?, c5b"̠#Qb@  Sb/3b +( (O/+b ? O 0@w  Qb"1b4 *  :` @T/ @Q `@Qbꀠ@ ( ʐb 1" & 0*@1b Sb觐̒   Qbꀥ@ /1b S虐ؒ  O `@ 31b V"茐b  O @ @ H& \bJ@ 0 QbO  \Qbg>`K@ 30 > >`%1b U"bb Ȕ  \@b% O $@ "`$ ^ ^@ ( ^@ )# O@  /*;   +`@@/$@ 31c#! #$9Qb "O6Qb1bHF`@ Qbꀡ @  Rb@c@  c2ꀦ@ Ub耥 p@ m"H  s"H     g3"   g6  d4 3#` cHS@@"@ @.0D:00@ ^"@$N  P耠@@`*@   Y#$@ 1b @ؒ ^2ON $``#O3 c4) 㿠@ @  &    OZ  a@ O@  A"@&  E"@#  I@ "@  U@ o@  a"@  e"@  i@   "@  uH  |LtlT< 4$,D\d* :ؘ!`B 7@%+ @ @                 ?㿠;c8L@ c@D@ H<@! #P4@# cX,@% \$@' d@) #l@+ ct @- |@/ @3 c@5 @7 @9 #ܐ@; cԐ?"H dp|  "x@5*@ @ c # cc ``` (0  8 `@`H`8 @ `8 + L ! "@ `! `<`8@ @` *`cL"<"  `<`<`@#`# #?#?㿘;bW"耧`@` @` @` @`H7-%<Ґ@3Wb55'&8&<au +au @*` `"!Q`[@@!!8 8Z X@: .H 2O:``;`[8` @ 8*``Oݖ @ @   # @@   4H !@ @88㿠&&;`; @%@%`@` `@+ @ @6@ݰ  c8/` `2@԰ `@&O  ' @$@ɰ %8/` 2@ '`&@4O @, `@`6@ 1#8/  2@ &O &`$@ c8/ @ 2@ & &4O @ ?`@?@`@ c8* @ @ #8`@@ -8/ @@ @  #c8c8]@/- _@. @@&@P/ -`@ 2@I @@$@ &  2@; @&@@2O . ],`@@@$@@#, -` `2@ @@@@$@ $@ @ 2@ @$@@@ 2O ` bc8R`R`+  @  0p?`㿠. .`/4&. @ <@$@$@@)"@  `2@  @)2O   㿠ΐ 4ː  cO+@ . 6 㿠伐 乐  c5O+@ . 6 㿠䪐 d K@* 7 * 7`LLTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTLTLLLLTTLLLLLLLLJ\@  @  c >@+ @@  㿠+/MaUZ @  /+bXP2 30? .  . #4+ .`c8#@ )`)`R@ @  @!@?@ g: *  `=/ a@|@@# K/ b KL`@@-`;`+L`|-`=`2H&L`|/ 'K L``@@-`8@@PR`@.@: L`} 2HB / @-`; L`| @@"@ Jc\`@% -:/  - =`{/ "RR @ -`=`"Hp  (`;l/ 2@ L`}-`<`"Hc  ) 8_/ `@[-`:`"HW  -`=S/ @N'-Ț `L`~*  M @D@ Hb耣@ 06H;/ #Lb耠@5@0Ȁ@,-` "R R@ 9`"@#  *:`/ L`}@ "@  +`; / @-M\@% +=` /  (8`/ K/ /`@(8@L@ @ @(F2O @ c: *  <`8  "Ȯb `@ V / &@,@ 6`@)` 4K 5 ``") @L` `J@@ +?  `@(2O   4M 5 + `?` @V, #@+ @ I `@^@CQ 1"ȇ(Ls(``D @`N`E`L.@ N`E`@,`9 `C.``@ `Pⷐ ,` :` 7.@,``:1. @,`;``(.`@`@,`= !.@`.: *  =. @;bUހ@%N`q @!# DN E..bS" @&a `%#  @ bP@ @J!`"@ `$ `$ `3  : @  !`@  w㿠;bWb @B5 %%@@< "P @7. J!:`@`#a $#3  : @'`  +a $$@`  7  Nἀ @`@ ?      㿠;c8.  @6@&@ . @'2O.  @(.;c4( (` @ @bJ f`@ %"Jg@%8@ @ +@/8 `,㿘;bW" @I7%" @@CP@ @> Ia @!! $#`2 : @1`  )! $$@&` PO3O{Na @@  ? n    g 㿘5;)bb %W"M!%@ !! `$! 08` $"`@K&` Tb%S"@@< B @ `@@6`@O`2` `@%OOL`@@  ?       `@O؀`ƪ` $OcL@ *`;`!H`cL+` J 2@` @H`2O`  |`#`5#\!V  `$@!  B#p #lp #p B#lp4H@ !l%  4H@ 3|#c@# #t V  #xV #|K`#hK`~#d+`+`~//@   6H @ @  &'`  `@ # * O* 4@ * $O*ƮO     J + E + @ +; + 6 -1 - $O  ' |" |$Op @l  6H @Vlp  '`#&` <`l @ @ (*= " .  p @N3 `@ ˒O  @O`ؒN`@@` ͖?.  ǖ . `@OΓ= @ O |l\=@x' p[=`@ @N% @t `D/M`E/曒`@`%\@\& h7h/`d/`~㿘n;`l   9;)@ې`T!2 $%6`@%`> %{ TV\**  ::`!@0?* * " " 㿠9a&"@@".` `@   @` &O`@`~@ | ~ `H.``& )` # .`-@.`.!4H($!&H$(p ;#\/Ē  @/Ĭ!a ,"+) a/`@%a*`*@ * & , #*@+`@(@-@.    @6`$$@-  ޮ?`&. `*a@@ ~?`%a @@ t< @ k< @ b  O XO`@'ఒr`~@#%j ~37`<&T`)#%!P!!ؠ @s #t#l#d#pԪ#`#h#x`,\'#|T`,`,`,d ,,l, ,\`,h ,p #d0,#l.`,#h  4`* 4`+ "#p&##\!4`4`4`4` 4` 4``@f,@   @_ O [`. +`.` +  6@D` @?9   =@ @,"H9 3`@@.9 `  -!( @%`$`9   *!(@ % ` `+ ! (@$ `9  ` * ! ( $` &O``  `'  @x S@"@' |`,tx4  "  ,#|#t#x'  ` &– @. x`Q`@"@&4 `,|tx`!` ,#|#t#x&@pl' **`@@3  :@ h@!* `@dpl. -@@3;`@h +"H d`@d d\t+` &O\ "@c@@%DDԐ@?@ ?@@H#ѐ`4 㿠;b`@@'`3ax9 #8 @5  -@  $O 7&p!4U U ax, #\'8@% @@ 3 @ \ `#\` .@@$O+bQ"`$@ @@`` @  .@ @.@'6 #l4)#pԚ,#d# #` ?#hdp. h '  ' `l`@``@ `@`@e@ S@@@; `)`(`(@V- `* @@   .@3  J@ @4@  @4H& @@`4H'`c8. @ @`"@.@ .@3  &@ ` "@`$"`$@ "@ `*@@  `.@ @  .@3  @ &O$Oxd"RR @!@5& `@ `  @@ O.@@4@  @ ` @.@ $O  @& @ `P @ 1  .sxk[x$O\ @\'`  @.@@ 7 V `@$O 3&b @@- c@c<  @*@ ( (@ @ *@  (  `(@ @ *  ``O( ` ƀ`AO߄ "@;bO j@+b@UU@ 5&@/ # c@     @! .`$O ƀ AO / ! $ @-`@%-*@Შa#<  )@//  @, / !#<#@/` ` @1 U  W`) #@*" *`@74 `1@)@c<*( ( "H "H` ``$OT O㿠;1K bb̸ Wb D  &!Vb %< %Ka Tb #2H . @ A @  A@! ! `$$= @+ Wb `Œ @8` ř:`8!@ 82?# 20?@@J( ,`@(! (3c418c4a!Ą' @0@'@ `@@ .@U@ V* @+ &+`@ 0@  `*  `*  $OW @ $O``Ʈ@OΈ@% `$ 㿠;Wa @a7 ⴊⴠ $ Q @R`"2@ $*`P $`@&O`7ᲸaĢ  ƶ %4 0@9 W V@8(`-(`@ .`&`-4- `@/8 `*bN`f @ "Hg@8 @`)@$OT54@$O ` ƀ`@O #9b+%b$b#  ##  c8    ` )  @  ` (   `*  @ ``O* ``AO Rᾀ`@ ⴈⴐ $P@R"`2@ $*S  $`@ &O  "c@#c" "c  !c 㿠. 7?`8c4@1      `@ `@@(@` `, `%@ (Lf @` *  A$O `ƶ$Oؠ 1      @ ` @-@` . `@ (H`f`@` @ -@ A$O `Ơ!O״  a!Ĩ   @&`@  TV@ `@ +  -bI f@`@@.@  $OU @``A$O@` ƀ`OԢ )b###b# "#b  㿠. /@4'/  '@.@-8@. @  )%. %@  *L3`@W㿠@2@\ @$?'@' '@\@$?@' @@$?'@ @>c8`@`@m!].#@:`+`6 @  [+` -@ /`+`$@-.@)`,&*(- @@ V`@@@&  5  :   @&O+`6 @ &`+` - )`+`%- .`@* %,+` @  P`@ä7``@ $O+``6 @  ].+`-@@@`@@4 @&O[)`  `@@@&@ 4:   @@&O+``@6 @y  ]+``-@@'. [)`@@@h@ @b"@ @&@@&@ @ 0:  @@O〤1@6#[+`- . ,&* ) & )`(. @@@3@-` V@(@ & @  0: @@@O+`- .. #* ,) @@@@` Q@ @ @0@@Oꀤ @@`@`@t;[ ,`c@:`,6 @ڠ  [, -@*@*#@ + # ,)`,(. - @@ @R@@@@$@@ 0` : ` @@&O, 6 @ (,03002,0@ -00 2001p0&`) ,.0@2p0*-`$ 4`,. (@ @ V@5 @  -1  @$O,`6 @m  [ ,,`@@@_7` `&O[)` - @@L@@@$@ 7`:   `&O,`6 @4  [ ,`@(,` [)`-@@# @"@ @@&@$@@ 5`:   `@@O〤@7[,-) *&,# *` )`(. -@@@@`@V@@@@ $@  @  5`:   `@O,,. (!@*`@@  @`T@@ 5``@O뀤@V`@5`+  6 @ -c- + + @*`@ +`@ * * (% +@ @ @R`@ 4< @&O+  6 @n  -+ @@  `@a2 < @@&O+ `@ 6 @O  + `- @@@A@@ @; 5 <  @@O퀢+ 5-@ * +`") & *(*`@@ @`@R@@ 5 <  @O怢㻠#\ @*  1#8`6`@ @3 2`  2?1p?40  3p?3?`㿠A@`H;ՊՈՅՃ@(`@)wtG@% @ %@ROdO‧`& &``HQOKIb2Ԙh"b 2֘a" b 2ؘb" 㿠;bW"쀧`@;#7"'#W"܀`@# 7"܄'#W"ހ`@"7"J`@ K "@#@hqb#'#L q@ W '>W ̀ @  @ /##/ `'#'#O u@@   @``&O   㿠9! `@2!37⠦cc    `@ @   ` ` 2@ `< ` `@2@`<1`6`<   &O -4 ` &O㿠3;a c `@a %`  @2@` ``"H ` $O ` ` @L -  2@= <6`@8P@ 6@3 < @' \  @% # @2@` ``@ @" ` `-& "@3 6*`@  ( <` $O ` < ` @&O`7; 5/c1/Q& - ( 7 A B~ P| Kz F!D   /`/ d  @   "* `@ PO @3@0` @ @c` P/`ڔ @ O N2@`M`M@2@`M`O`@@`O`NG` &OM` 1O !*` @!-  < @@ @6 2@ <,8 `  <`@&Oa@a  !!   ` `J` *`*`&O  @  bb` `2  @bg [@`0/`&8`8K@2 8:!O> /``N @ `@ I x@ I x x/`I``@`/```I`2O/`N @  `@J`P @7NPP/`J`@`/``J`2O/`N `@2` @ ++@@+(@6O`6H    9`@ @"g Z@ `0/`!@;``; J 2p ;`> @`O9` /``XN "@N  @K`\`@L I`\`\/`N @D`/``N 2O/`  @g% 80) 8` K\2p & 8;`#O>  ,)  V @ -*   +* @ (@(@(@+`6O`6H)  > @g Z0) & 9` : J 30 <9`#`O> )  |`@=`/`/`@ -(   +( @  + @ +  @+   , 6O 6H)  >  @g [@ &`0) : ;H3 :?`"@O> )  ?`V @:`/`/`@ -,   +, @  *` , @*` @ .  6O 6H; ) ;  @; X@# `0g) J0  ;;`'@O; )  `@p ]/` [ /`@` * *`@* *`6O`6H  ,  8@bg Z0+ =`:J 3p =`8'@`O8 ,+V`@` --` `  +-`` @ /`/`@@/`@(@6O6H (  :`@ @bg+ :`0(; J ]@ 3 "@:: @O:`(B V@= ]/` [/``@` -/`   +/` @ (`@-`@(`@+ 6O6H (  ; @bg X 0(#:> H2 :=`"O;( @7@+AHB(/`@V`@Ha@@1N!@!@/`I  @`/` `I 2O/`?'2@ @?/`V/`` @  * . @* *  6O `6H+ +8 @bg ;``0/`;`JZ@ 1p ;`>&`O8Ka8@+Ma8a8/`I``@ `/```I`2O/`@ s/``/``?`@5 ] [/` /` @`  +  +` @+   *` 6O 6H'-` '8 @g : 0-`:`I@ [0 : ?`& O8-`` @ހ'@  @ JaL @%LLL/`J @ `/``J 2O/`V @ () @()`6O`6H < @g ;``0/`8`IZ@ 0p $ ;`>&`O<KaT@J!T!T/`I``@ `/```I`2O/` @? @ V/`/`@` -(` `  +(`` @ /`@(@/`.6O6H+ +9 @bg 80+<`H Z20 !:8"@O9 7@@+lah:H@al!p2H@!l|*H@#ala"H@ %alH@'alhH<1!@!7lHH+a@+H@ +H2O+N `@+N  `@ + N `2O++V@Ja @'Lᴔ/`J @ `/``J 2O/` @`@ ,p0ڬ:00d@,d j `@@ @a @`@%X @1V", $-`H`9@-H HU @$  +  ,  @+   *` 6O 6H<1< @> g`0/ HX@3p $ > >%O<1N!؀@-Mت/ M`` @  / ` M` 2O/ / $ @ } { @A } {/` /``K(@7  } { /``K@,/`J @ ,@# J 2O, @ 2HL ,@ ,, ,@L `@ ,@ L `2O,,\/`/\Dx@"ܺ`/A㿠;7a8;'al &3 K@&b܀@/+a-%%܁ @ a+ : I+`;` a @" a@( @cH* P`@(?:? a ?2H" a` @`?( cH@* P`@(?: "` @!+ @ @    cHQ#̀2@        ! " #?Xhx"  @5+ @ @ 1-a)" %!b(b8 b@ "LbT \ hbp@HbgbQcj c8H Q#430 :8 @"@ @x@ cH bg"P㎅:H Q#4c30 : :!@ @bXhx"  @5+ @ @ 1-b)"%!cc4 cL #dcx  c@HbgbQcj c8H Q#430 :8 @"@ @؀@ cH bg"P㎅:H Q#4c30 : :!@ @c㿠;Oa`@ R 2@  d@- `@1!@5 5`H  9!2 3p?㿠B@l@j.,&,`.S @_  b@2 @. @.U "@  "@`@@F&  `O.. ,R "@`@@1&   O.@. *@ `Q` "@& `@@ O.. `@.U` @ &   O. ; cH T@$```$OT @X& 5p   H//@/D@̐/ )/  7q ` P ݘ @` ` ```o MK`"@ $U @ gX:`K 2 :`<"* )`"@@ G?<  $`@O)! %@ !   > %O 7/p #` H//@/ڐ@'`b/ )/   ` P t @U` `    bJJ @"3` =?  A?ߖ 5M`K"@0 $T "@, $ M`J^`@ 4>JK"@  $T `"@ $ ^@> Gg $K 2 <>"@ * )`&@?̫ ``#O/' `% @ᰬ   ̭`%O 㶸; bȶ CO K@  LHT @$   $OT@ݺ%3 ap   P cH2@" P ؘ ' 8.`  - k P@ "JK2H` @ @  `P $O `L@ @ %  @%  OHL P8P ,/7`H= y@퐐hh` `bȳ.K K@ U g]:`K 2 :`= "* h)`"@@lh` G` @`P$O `@T`@R L$ P 8P-cH*`@,h @C h`Ҕ ``ĖN`K@`V  bgZ9 hH 0 9 >%* +! @! h`ذ G` @P$O `@ `@`(`س㶸 Ⱥ 9 #@* *! @`T֕ G P$O @ @1 `֘aXb̔"   ??`@ a@ @ #a@@@ "@`c ` c ` @ #a@a@` a@` `" `   $O 㾰@ .`)#H-`  3/ b@. P  ;`d ̖Z* > 㿠@ . #H+`  ` %- @,``@/p0 :00@꼒 !@9O`"Vb耥@*H `5l"@  `@ꦒ !2OO` 㿠@. +cH-  5/ @.* > 㿠.`7?`Hb̦H   @S`@& @"+0ő:00@n"@`$N`@@ U耥@@ `N`H`&  @Z2ON``$&  `$  #$O T @ @ T @ @ @ @ @ @ @ @ @ @ @ @ @ ( @ @ @ @ 4 @ @ @ @ @ @ @ @ @ 4 @ @  @ t @ @ @ @ @ 4㽀!'D"̤"#\UUڐ@4`5   3p? 2?20?D^`@7` 6 2? 1p?̻10?#``@  #d?, C @  @  :"O  #d / @ &@  &"O& #d  #d @  #h?,` @``#@  # "O` #h` #@ #&`@@  "O&` #h` #h`   " `@#l?`l`@֐ @`l@#ː "O,``@,```  2@ $`@ $ "O$` d "@h "@̺  T @ Q"@ @ 2" `@ 0 @ 2 bK @ 3   4@ 0#p- #|!X#ᙚ`a#ta #  #x###"I L @?  "Ȅ `@`"@ ``@2H```$O`P @2 30?22` 1p? 10? 2@  @ @ `"@ p 0p?#p#  @G&# Rb@4Qb @d@^x4@=:d@Pd Sb @@菐 @@艒`@i@胒e@4P @$ @) @4@`d@dϔ R" @ @Z`Ā`@@TЀ@4@N0Sb @`@@ d`@d V"@@-`@ @'!   @'@@!,d4 \d k 6*  :c"` 5@ (@ ^S`@)0bx0`@P @2" 2@   @T @ x5"R`G ϐa<@Ȑ\K` @*Ȁ@P`@ HB 2H '`@ ` D$`T "@Ҷ5"G ` '`@ JB`@t~`"@`H ` D$ l Gs  `@*` @d@ h@]a\@SRo`@ ` D&A!x@P`@ @16!5'``@ @@*) '`@  " | '`t@ bD/`@ a` D&`[t ` @  2?@ `* U"`@ :@('`bh`@ @'`t  HY? a @P@'`Ґ`( '`%@Đb@ )"`@ `@ `D" V@#3"b( aKL`@ p"@U#  @Eu&# 9 "ߔ )`'`΅b'`'~9+35"%a.aL L@+c @EQ&c b Ѽ @`6`@ D%5, &b* @+  Q "@'*!@ #*`@ Q`@I * (`S` @ *8)  ;`O*`@*`1`3`  +  0 3` #*` ( @+`*@ P@ @@ )  @(` R @ ) :)``9 O) `@*`3 2  *`0 2 㿠. 9"@/`U "@ { @l3Va%6a㿠 B@*`@(9. "+ #@ a*.`@W@@( -@ER T`.8$4`O(7@1 C㿠@P1"P @.`  ?  $R@S @2@ $3 R  $&O . ,R`"@ +;c @/ U`@.`5` @.` ` `,+`# + )` P@.`0.` @ .@ $@ށ㿠97!@'#\̸-;+U bU b &  % \T`@    _`@Ѭ @n @? $`S`@2+` !@ )  0@@*V "`@*` @ c+  f d Z&@$  E@ Z 2H dQ d&@$`$T&O``` d $Q@ @ )  &.`@ 0@@V`"@ Z. Z&@$ Z` `2H d$&@$Ԑ`$T&O`c`@; $`Q@.( ( `0@&U"@*1" #.` ` ` d Z&@$  ٖ&@ $ d Z&@$`$T&O`(`` dQ@( #- 0@R`"`@ǐ Z&@ $ Z&@$r`$T&O``\' @O*`&`T&` @* `(`U@@ ' $T'`4, <% &6O`㿠;Wa @Wa533bb  $9 $R @EL``@1"M"@!R " `@ `@- "b*$@.`H8 2@ R ".`)& -@-`+`*R "`@ .` "@#)`0` ' --`%- + @2 @㙔V `$&O 676㿠;Wa;a @@ S!Ra)`9 `3!2a`@ 3bV $ $`@ $&OT  /)U!+<`5!/M3@7| * @+ #@ **`P`@ +`"@ *  R @ + @ * 㿠9W!|`@!|3;cXad ad`@  ŀT2@ , ,V&O  㿠9#X@  @  .  8.H Qa|`@ua|/   @@`,O`@ T⠩,%,`@ "H ,@U &O `@QvU`@  @" &Of d <@8aU`@  @" &O. /    `@ @DU @  @" `&O `/ /`  &H/ V `d6H*   *  * * R  + #@ * ) 8R  + #@ * ) 9㿐;綖7` 3p?R ⠛+ #@ +`@ H8`"@  B@ 7@  ("@& - -@!! "@ F AH K@  B"@ Z FH  "@   P@     2 -HHHHHHHHHHHHHHHHHHHH<<<LLLLLLLLL㿐V #b.', @ ` `@*` & +@ + @2@` ` @.&//`Ђ$(`@ @ `#H'``@r-`ŀV` @ @f @ . ")`(@ . ",* @ . $.+` @ .  @--`@ . ")`(@!. ",* @". $.+` @$.  @--`@(. ")`(@. ",* @+. %,+ @ . !(.  @-'`c1@,@ V`>gK 2 ><$@Z rV``6@V` 6@V` @ @-`&-@/`VW V`W %,%@/`.V`V`&+`.`$@ , "@* @+ @)  ;V`V`@<@V`  `*` # *@ * @'` @" _@.`%,@,V`V`@-` ` @ ` @&Z*` &H 㿠  @")V #"-%-``$@ J`8`@ @ @  @@   @  @@   @ d@ z_@:K 2 >:&'@p   44444444444444444xxR  R`@"@  ""x`I@(`@ @+` @ +  `$ "@X J`8`2H ` `⠀`@(#@(` $ "@D J8`@ Q`Q @ @"+`"@ +` $ "@) J 8"@% `@?(#* $@"@ J8 2H4  ` @(""+` $"@ J8@   "   `@ +`b" +  `$@ "@  H`82 2p? ⠒  @(#@(`$ "@  H82 20?@  @ "@Q` Q  "@Q` Q @ "@Q` Q  "@Q` Q  "@ `  "@ `  "@  `2@ `2@ Q 2@ Q` 2@ Q`Q  "@ ` @"@ `  "@-  @+` @ *` $ "@x J8`2H ` `b@(#@(`  $ "@d K 8@  ` @ @@@V @ @S  `@JH @ @"@  "  `@ @ `d ` 9`"d2p?@ d&@JH `"@* ; ` ! 1p? ;`" d0p? 6@JH ` JI1`8 20? `d2p? `"H ;` ` "0? 9 !`d3p?@ 㿠 ` `d6H c. `@V`b, $@+  $@ @ J 8@`@   . ` "@`  . `2H6 ` &H. 㿠;a` @ 5& D<@2@ < H<,>`$O 9#V   $@( $@ 㿠.`9" '@ @ $/`6 `. ` . W` . 6 W`6 W` 6 W`6 W`6 W`6 `. `. `@  . `$@@ @. 㿠`4H ^ >>  -`>`&@> ` ~ >  ` < *& @ @ 4H+> P P o  `@3c0ْ @9#@В;cPʒ㿠 @   @ 'T.`< `@;a+ 2@T & ,` >>@`# `T 7T `@_3`-  + @( U *#@ + " *`@2@  @2@ @&@  @4@ -$O T &O- "@' T @  `` @" ``@&O `)`%W@ . +Ъ%-`%,` @ ? 㿠;bOa @5 P`@́    @1`*`@-``(R @" *2@$ 4`)2@ 4`+` * b%S- 0 @ # .v@H  4.   4``&O  㿠;bOa @5 P`2@  @  ! `@3!` `  #@@@"@ *2@`4   2@`4  @ (U@%--2@ `4( )H`4.  `4 ` @&O ,D\t4Ld| $<㿠 9!Ȁ@.@@  6   6   6 ސ  6 ؐ  6 Ґ  6 ̐  6 Ɛ  6   6   6   6   6   6   6   6   6   6   6   6 ~  6 x  6 r  6 l  6 f  6 `  6 Z  6 T  6 N  6 H  6 0H`x 8Ph(@X㿠 9´! @.@@  6   6    6   6   6   6   6   6   6   6 ݐ  6 א  6 ѐ  6 ː  6 Ő  6   6   6   6   6   6   6   6   6   6   6   6 }  6 w  6 q  6 k  6 xxx㿠\  ĒU    @V ` V (080-006 ;p0@ @76 --`/p0*00=;`;00:0@ 6  6 * @'V V (0`,00:08p0!@ 6 ('.9 >`@6 /p0*00;0;00% 6 -`% 6 ,== @ @.  7î% @S/ @@@   G6 @EV  A6 @>  X @(ݑ*@    .  `XO(   @# !. @  [@@+@- @   .  `[@O+`  ` @ . 㿠     @V `-0;0 @"6 -`*008:006  @V `,00;00" )`:`@6 *00;0! 6 ,< @ `@.  `&@ 7V$3bȴ 6$M@xxxxxxxxxxxxxxxx<<<<<,4xxxxxxt@@p @㿠  -@ ("H  -Ī &@- @@ { @6 -` 9` .  @. 6   f6  d 2@ V 6  d 2&OV @ ) V  .  `@. \6 U#$%Ȧ`5#$L``@So ; @J6 - 9` .  @. ?6   &56   .  ` @.   (6   .  ` @.     6   6   @ 6  (`: .  ``@. 6 ~  @@6  *< `.  ` @. 6 h  В@ @6  ,>  . @. 6 R  6 I  `@6  )`V < 6  . ``@. 6 -Ā D@-   @6 /  :` `.   @. 6   ~@6  *>` `.  @. 6   hw6  -` 6   X 6 Pc$ȸ0c$M` @_{ ;F 6 Wc$Ȗ 7c$J`@Nj %5 6  0 6  + 6 #T$bȲ4$L @3O  `6 /P$Ȃ0$O @: .  @.    6   @ 6 㿠 `7@ `@)`'"H  @!`AH@ V  @/f 6 @'V  @#Z 6 Z/V +b-&@- 0 @E .? 7@6 =  76 @㿠..`?`=/ =4H  `K@` K@ d@ d6@ 6`@ : `4H  d&@??@6`@8`4H  d@ 2@ @ 2@ \ @   @ @ a@O "HA !*  !@ #$) (`@W / *6 W 6  .  . W 6 W 6 W 6 W 6  @ `.  $ @+0 @. cPV 6 @ V` 6%!,!hO @1Ʋ$aH`@h.`<` !@ 10?0p?@7`5 2?2p?@-8:p82H`@PL <`  @ 3?3p?@7`5 1p?0?.p8:p82H`@2. `@2 d 2&H?   <` # "20?2?@ 7`5  0p?0?+p8:p8Ӑ  @- $-Ь'-@ (`@`@ . `H `H  .    .   .   @;.  `@@.  @3 $ $@ %V  ,00900 6  % $@ &V  -00:p0$6  & $@ 'V  -0:0&@ 6  ' @<;V  .0;p0% 6 2; $@ %V  (08p06  % $@ &V  *0:p06  & $@ 'V  ,0;00@ 6  ' @ ;{V  ;.p0;0@ 6  /Wc$ȅ(0807c$O @V @) #@⠕+ @ ` @%  . `$@@  @. |||||((((((lllllllll(((((((((((((((((((((((((((((((((((((((((((((((((*  b"ȉ*` `#`J@4*@Q`1 Q` `6@Q` 2   `  8`#@ 2? ` `1` 0? ` `@` @` @` 3 2?  㿠.`/.? >U @ 2@ @$ /-$%d#ad`#耐@@ 5ߐ`@ Œ5V k  @ @ "@    ' `8H  Q .  `@V b̙*# P*@ 0@@'@)%U#$-0;0Ȧ@ 5#$L` @ 㿠;WaL` I 6>@ Q!@ Rc`@R 4H A dh-+b&@-%" ` , @ 6  㿠. +c-&-.`T@(b. `,@U `@/  =`O.@ 7M@ @  * 8@.`+`  /  / 7 "cR@7 c0ƒ #\#`#p`@\ P  \ @ #d$# d`@ #d#1"3)\ P  \ @#d # d`@3#d#/pbȬ?p?#.4# #h-`#l$?#t, #x}#||pXx\` @R@@P@Npf@F @@A \@ \2  3p?(g>`O`2H`Ja`@4@!.4@.@@ 耦 &@4H &@#"2@# #h#l#tO|`Ƙ #|3 O?t`@Y\ `@d@b9"c-{K⹀@)o#7 #@ l  h@ , ې Bؐ Ʒ,  + & *@ @ 2G ,  @#l.`#h'@,` `2Gָ , )`"@) * U@ ɀ#hl\@#d`@"''"+!bN⹀ @;%\` ` .`#+`@/ @-*H `@!l h(#*`" )`(`U@#b)#\-J`@7px@.?`ܬ&? @%Ox B@6`@4. @(c4!( @ @). !,#$,`.`@R @..: :`NܐܒZ@ܐ@ 1 .'@/ .`-`*x B@&`@$/`@#4+$+` @ @/`/.&. .`@T@ ܀@ܐ㿠. -@4.&- @ b̐ @  SG T` O{ B@&`@$+` #4( (` `@+`@ (c!(*`R@ #R @  N 0H㿠!!,@ @!@u  !8p  (3㿠j#耢!,@ +!@ %bX@ 0 ؁* #H@+` `7@`A@ @Q "*  @+`@ $@ @H82HQ Q `@   "`P. 9#H@/` `@# @%R- %@, $@@K 8@ P /c @8 P W 41 Xu* H@+ @ @ @   &H @ @S + b̈Y  Ė!`  ` ā㿠. %H@/ V@>@ @:;b̀`@!H`Uȶ $&@ 5 @` $ $@`$O .` *  @ b   Uʮ&5 1"### #####`###### * "@+` `7@`A@ @Q "*  @+`@ $@ @H82HQ Q `@   "`lҞP. 9@"/` P ֡ 3`’* ⴘ@+ @  @ @  " &H " @( * "@+`R @@ ` @Ξ㿠;bWbȀ @7 HH  V`@ cH$ $``$O 㿠9cHcH"̲?  P@FH$ , V  _@bĬ#bı9   " c  !c $  $O` U"Ȁ`@5?`% T`@$$OT6@.` ` %T@h   `f@@ @_@"@V$@@W&@Q$V * )`H8@G-$- J8 @E  @@@4@:$ 2@ $"@2$  @`B$@@.`B@ `AV R  @& 4H $@`7@ `'@V R @&@$ V R  @ &@$@@`$&O`@@ .``-&`l`$@$$6O`.@`-].`@-@[`. >T ,,\@,4 4" "Ě#" RbȔ2b # !# c c  `% (@<. 'H- @ ` @4H%ܐ/ P F  @-  @/  @3` 5  א;`H/ ?`?(@8. )@#H/ %̺ ` T`T`@@ @ * /H.`@5Аܐ/ P  ΐܒ ǖ \㿠5 H5  #< $Q@`@7@  '` R@*ŒH%$ 8``TȘ#`4@    $`$@Δ $O  . @. x` `$ ' $$$O ' $'``6O @;a x515H3"̦b   !V@  R`@h``f @  @_ "@V`$@W&@Q`$V`*" - J8`@G)` )`K 8`@E` @@@4@:`$`2@ $"@2`$ @ B $@. B@ AV`R @@&@4H `$@ 7@ '@V`R @&H`$ V`R @&@`$@`$&O@ @ؐ&`Ғ" $@%$6O--ǒ `" ` $`$Oj@;a4* R`#@!0+` `@.H $@`  @*  !0;  ` :&@ @8 : !1p?* #@`+`@  * 0 @ ` ` Z Z(@*@@)` Z  ; 8 " 0? 0p? 㷠. 9#@//` )`@#(FD!t㾀. 9#@/``@ `  "H ` @  9 !x' @ / +a% @ / -  @ / !@ @ / a&  @ @/ 1!& @ / $ @- / ! %@@/ !@  @- , P @'  @'А @)ɐ"ĐbʐOꀥ!"` !@ "+"b ' @$-`-( `@(-`9"4!@`@7-`<`& @'-`D`#@#-`L`%@ -`"T`! @7@-`\`'@-`bh`" @-`t`$@ -`b|`$@@5-``"@ @1-`"`& @-`b`#@ --`` @5@/-`⬒`" @17-`ⴖ`" @)-`"`#@@- -`"Ć` @/9-`"̐`!@@7-`"Ԕ`& @)'-``& @#-`b @``@ ,`$ ,b@  R"`@%`  @Ґ @ː !Ɛ#̐ Oꀧ `$ @  7 ' @ .',& @ ./D%@ .X&@ .9#l!@ @.#"@ @ .'& @!./%@".&@$.9#!@(.#"@ @)'.& @5.%@@ .`( @ .@' @)@'.X& @5.l%@@ .` @.' @)'.ଚ& @5.%@@ .`؆ @ .' @)@'.& @5.%@@ .a0 @.D' @)'.\& @5.d%@@ .al @ .t' @!.!|& `( @ .-$@ .%@ .! @ .' @ .#@ @.-$@ .%@!.! @".' @$.#@(.-$@.(%@.b8! @1."H' @- +.bX#@@.h%@.bx! @1."' @-+.b#@.%@.bĊ! @ 1."Ԗ' @-@+.b#@.%@.c! @1.#' @-+.c(#@.8%@.cP! @1.#h' @- +.c#@.%@=`@   ,b@#}`@# @$&  @lc @d %_ e  O逧 `@``d@ d``6>@- <!3@`g d`5 < < K 2 <`< "@ )`) @ `3`,㿠. 9#@/` @ `   "H ` `@+` @+/+k`0` ` &H`@9 @ ``@ `D `PO` @ `\ ` "H` `  `l@!@ t @ "H!` @-t`x`@ ! ` `@ @ @%'`@ +'`@) +`$0<HTdt$4 0@P`p 0@P`pН㿐.  #\#)`#`@   "H  \0 "@ 2H`  $O*`#b#d-/#h!;#l ` ദ  %``"@ @ #` @+ @ I ղF ղC ղ@ ղ= `9 `5 1  - `) `%  !    ! 1! a$ 4 a8  ղa@  `8@z *`€ t aHpaPl!Xhddt`!\aXaTPaLHD !@ a<a8!40,"(b,$b@ Tbdx " bbl@  b4 `@-`(`"Hh# @# $`@ @`\@  c,|$O@!#4\9@@@78d d5bZX㾠. 9#@/` @  ` "H `5@@@ )#|' @ @;- c#@ @@-  %@@@--  $@@/5-  "@ @@- ܚ # @@ %-  '@@@ - `   @,/ - } @%   @s  @l` $fd Oꀤ \,``@ / )#"@Ɛ`0P`` @ / ;`DD``@@ /  b\8``@ / -b,`a@ / 5" `b@ / #b ``@@#;+`@@' !' @@ * @@ 3#/ b   f < @ H' , 1$@@  5 @H  , !! 5 @2@ @@7 , !"@   @./ b 0a @$   `@  @@$ '( ` @Oꀥ`#a0` @@@ - 4'@@!,/<& @@,aH'@@@,P$ @@ ,aX%@- /  Ґa`\@$ @1R!d  @K!p Fat L Oꀥ#;a|`@@  ' ' @ @+@, )! @ @@, ! %@ @1;, a "@@%, #   @- / @v @$   @ ! `@ a`a` `Oꀥ ߐa`@ @#;/aЀ@@' !!!@@ *- @ @ 3 /)/ @  1! < '@H%! -`!ؚ1# @@`  @H  --`$` @ 2@  `@@7 -`! @``@./   a`@ %`  @y!`@rb` l`r`O逥!a"`V ]@` `@ 2@U`V` 6HAO`@/;/ _@5,5/ K@;bL// -@1"h)/ @b|#/  @/ @/ @ "/ @ b / H"/ / c!"+ @@ .y `'0@ / /)@l#P5 @/ ;]ct㿠. 7@/  `@ ` `"H `"@7V` F@V`@. 5+8c)#o%;cj%@. -'$V``@7191##O%`@1`@cV``@  H3%V`@ ` cx'%. b u %V``@ a%V``@!͐!(W%#%QahN㿠. 9#@/`  @   "H @/`+W %b.`b@ -  ]"3 a 㿠V``@. `@, c@%9'9"`@`"̪[@=`R @@  @ % @ =`@"@@ " (=`@.H# \@%@('@..=@9 g `=`K 2 ==`@$@/, 1 #04b̂gQ :H2 :?`&@@70#:gK 20 =:%,,`"`@9"4`@/8 `@b01"<@ @@;b@353DbH{㿠9/#. rl@`/`@/tq `@@5j ` @9"c `@;b\ &@@1"T @@bL @@D @@< @ ."@`@"0 .5V``@-1`@# !!" "KG`@#@,%-`,zb   5/5p@ $1;#,`@ @ cL@4 ݐ#@ڐcT n@1Ԑdn@@#lԐ  x@cx̐ Ȑ `n@Z@!#  %d@#c % `' `+@3-c* #@ +`c2` *` *`  `10 `2@) `"H )   $O   @  @   @@  @ @    2? 30? *` *` @ *` @ *` *`*`"`"` "`$"` ("`$,"`(p. #%@bԧ- .`3. $c,?`.@I ,< ` @ 'Wڀ`@ )  `'  # '"L䀤@@ r&m@ /MM`@ bNM`@vԐ f耈@ː Ȑ 㿠. 9#@ /` @?NCBDNE   @+$ c%# , `0  4 ْKa @ @ В-8 㿠 ;  bDT ;'c9 㿠9!`%`@!   ? %O 7 _ D3&c 㿠. 7'@)/ #V@  --` G$`+Ga@ Qa"`1a"R΀@!@-ΐ "SԀ@@+ /`c- @-.`4@W  @7* @)`P ڥ0".: O*  @B RĔ# 2 B@`@* @+ #@ **`@Q @㿠@J. 7 @.c.`  - @,$+* 2 T `@=)`)".U` `@ 5`")`@* P 0"`O)`%R'R΀"H2RԀ@.`2Ԣ&  ,` @  @@Ӂ㿠;9a°@#c   =`$@ 5 2H5V@̑>   9 @4H @ =R`@ c @Z@-`U` + @ * ``@a `F `G@6@`a@3b `@U4@` `-``T` &O `6S#@ 7H!c# @$T,`/ @-@  @! F G@6@!@ @R 4@ ,T &O @Tk)U#`@  @" &O Z d <@:UP`@  @"  &O ,`/    @@` @7S @  @" `&O `/ /`` &H/ V tttttttt(<Pdxtttttttt,@T㿠V-.`-@@@N @ 5 2p?` @ `@  "H @H Ȁ '@/ @@7h  l `p t5x;` `7`}x! s#`n%i) d+`_-Z/U9 P`KaFA<`@\``c@ .!@#(O`@4!#8, a4"@/%<bWb %'%`@ I! @%  `$$ ;`@@ "R"@ @@55@` @ aց @!$ρ5,ʁ* ##@+`cQ((#@*+ @b" *@    QPbր@@c a c * ##@+`#R@ ) ) (`" (b @*  @4H) @) ` @ @ ! ` @  ! bPR"ր @b# !# 㿠. +c%9-U.`"̋?`" `, $@, #+`@  !, #,`4U U @@@ !@@ 4H @@8`@?`@ @    /  2?-`<,c(/ @@   4 2?,`< Ic^ 2@ ` `5 3p?-`= F 򀊠@@ ` @%5 3p?-`<7 @'> "gJ 1p = > !((&`"@   0?(`>` `%``@ %``@% 򀊠@ `%`@ `% c8*  ` @ ;T R@ 4S#x @   `` @  `   `@`@Kc_`@  @%  @@` %"@!O O `@2 / PԀ@!$#U@5L`T`@ ,  @ / VԀ@;c%cbMT@  "@  `@`/ HU`@  @  / 7O U`H  㿠7V€`@. ?`5ª  U@U &O`㿠. /&;.b@W`@. *@ U S@-;`O.ֵ* < @. , ,`,`,`4`"W`4` 7`㿠;).b#. + @-#@ *'.@R-.`@T-0:p04#*00 80@7@* c$@*,,:   @ 9 -(0( 0` ## @@%#@ %#%#%#  @-'!@,(( @- 5  ((2  ## $# $#$#$# * @+ #@ **`@P`@ "?3`"2@0?㿠. @+-c&-.`T@ * > `@,c. !-1@(@f /`/` W`.`-@ *x!@Sᄚ 3 G,G㿈 B@怦`@8/ @ 2@ݰ / !-.#&* .` W@2Hϰ / 4(` + @ @< @. @*@@@  ``@<)`F`G @ "̀a@`@T H6T @-M`ဥ @ P(@`@S` Qc$&.+00:0@ 1c$4bI`အ @-#x'"̀a"H `@`@T @@ T @"L`ဤ @ /)+ad"`@TSc$&(08p03c$ @ @ 7W` @ .X,. 7`"@`E` 7W'` 7W7`/``@ `abgH3p > @ 3 "  /, d/`d@' ,` /ג2 3p? P.#`#.8`#\5+`  b̠@ @T@@ '@   ` @@ ` & ` 4H @&H  @9 W#$/#d@U/ #h#l#8Ģah@9 l.`@@V U  -@ @ @"-@`(!(-`R @`\H h``**@#hhO׫.` l ``&OV lh #l4 @h@&Ohd'4$ b* c(@*)` I CJC "@ @ @ $@  0` 2p? 20?`㿀.8+;8c./ ?`Xs`-@  2@[` `!@@ ;,s``[`@@Y % c8 ' % s` )` [` @:-+ #@ *)  P`@, a`s` `@#`ֶ@"[`s`.*  [`2@`@"@ s`[`2O 㿠./Uጵ.?`>@ n2 3p?㿠.`9?`"/-+V5  BV4c ƙ-`* "*@ @#-` ( (`.`S`@R@`@H  2 3p?O͐!"K 〢@'Lဤ`H)! X d4L b؀`@   #`  X`@*`€* c*    10? * *@ I CW@   3p?(8 * c*  JCU2` 0? * c*  JCD2` 0? *  c*`I C L@ V@ W2 3p? * *9  * @)`Hc2I C @   ` 20?*8` * c(`  @    0?*:  * @+  ` @   ` 10?`)`:` * * @  @   3p? (8 *  #@)`I C`A@   ` 20?+`8` * c(@I C M@    2p?`*;  * #+` I CC@Z@ (`   10?(`:  * @+ I C`S@   ` 0p?)`:` * * @  @   3p? (`9     㿀9/)"""#48#  ==`K@20 @ :=`' ` `-@-@ (!(/ @U @ -`+ % *  @ @ ``OѬ @ "b `%!!`P`7`@ < `$`2@   2 2?㿘. 7'@-/ +8c `   `; `.`@@.` + #@ *. @ QH T` Q * = $O ` P. 9'@#'/`V P -``- @@aV * #* *`8@O`C9 @Ȁ@7 _@a K@ 2@!! #@3b @7ْ @#b0ђ%H˒'\@O`C@7 _@)"` K@+b| 2@- #@/ @ 9"@;b1"b@O`C@7 _@  K@$y 2@ #<q #@ cTi @cla @cYS@L K@#D 2@c< #@4 @! , @3`0$7H8p Hp8`㿠9"Nn@. !&#,`P+` + @ ``@`@m d 2@1/&`"̬Ȁ`@.`@@ L` @$& U0`@(& ND @@@& Pr"@  & J@`@ & L#E@%& U t"@ & N#A@;@& HF`@@& Rv`"@  & KB`@9@& LG@-@& V x"@ `& HcC`@ & J#H`@ & S`z @s & LI`@i+& MJ@_9& OcK`@U & IcL @K@@ & K#M@A!& LN`@7+& MO@-9& OcP`@#& IcQ @@ & K#R@!& LS`@+ & @ "d@ `@`h@`t@ @ "` 6@   O * `@ `@#` @ "   @   4H"   O * : 㿠9 |  㿀;b̷. @W 6W B@@ . cD  ̐@R# Ӗ 1). #,#1є b̞S  "̬U6`v@7 bKb @` b@ S`2@ 9 g`J@ 20 9` `9  (` @     㿀;b79W`@ VV@  -~   p /s   e 㿀;b79`$@В  $@  -Y   K /N   @ 㿀; `;@ b̐7 @  , 㿠;Oa`@- ;cHbcH#` T@) #*`@6@ (-&- L  `4H5 `+ >`@$    $ #$O 㿀; `; b̐3W#nW#l@^`   㿀; `; b̐753W *-/@F  ˖  Д b̐V ,@8U`,U`*@ )"Țg `\@:K 2 < :"  4H   㿀;``f @;5   '#!T0@a   !  b Q`2@! P2P0@@ 7Țg !`X@:K 2 >`:%@@4H  d 㿀;bW`@$@ʐ9%L`G @ *'% -- @,919@!4!<7%&`T F"aRa@  `%@  ! &c@  `%!H  "g@  `%aP  #` #@ @  `%aX   "@@  `% a`"   `% ah"abS R@  `%!p  !`ޞ `%ax" ߞabS V@  `%!  !`ƞ `%a" ǞabS X@  `%!  !` `%a" abS \@  `%!  !` `%a" p9"VT`@V܀`@ @̀c@0?`z !bgJ 2p  0/?`/> %> I0 ?`>%+  ,&`0@/ ; gI@ 20 <; !/ (`#0@/ 0/}1`d@?`"gJ2 ?`<"@>H3p >.? @&@* 0,'@`0/-&`0//]1` @?`bgH3p ?`>&@-  0-'@`0//I1`@`0/C1@  */////91@5 &//////1V쀧`@c@z ?`K 2 < ?`"@ @ea1%@_1@)@S! 1+@Na1@Ha 1! %%̖ &㿀97"̰㸲 WcO.@" `2H` `n@  @'#`n;@  ; `n!@"; b )R! %$ 1abS"@  `%"( @!` `%b0" @bS ^c@ 8   r`@ H   h`d@ "X   ^`2@ bh   T`@ "x   J` @ b   @`@    6 ⨔ 9bS ``d@ "   #`2@ bȂ   `@  ؔ    㿠;bVԀ`@   +`# + M@ ;b    VZ @ c    UU*`$@ , @ * 8.H @  @  <@   d&H @  @   @U `@  @ 9Z@  8gK 2 >`8%9 #(  5 8  㿠; b;1c(3    `@    O~1C `㿠4,r㿠51aXaX"Ⱥ  @a@ "@  `ܐ ``$O 㿠51aXaX"Ⱥ  @a@ "@  ` ``$O 㿠51aXaX"Ⱥ  @a@ "@  `@ j ``$O 㿠51aXaX"Ⱥ  @a@ "@  |`@p Hv ``$O 㿐; aX;bȠ @4@@@/Z`@   U   ?& %ߒ-=  O1`` $O㿠51aXaX"Ⱥ  @a@ "@  `   ``$O 㿠97!X3`ᰤbȺ  @@!@"@`1"Uր @``` $O`㿠97!X3`ᰤbȺ  @@!@"@`1"U؀ @@S``` $O`㿠9 bfZ@ c<cD@H၀@#Ta@5'h 9 j#TT! @  h/   (Pc4@ ]@3: @ ``?$O #4 ?*`> ` `Ā`c@#.` T @ @*@ (  `f@ut3cDMT-`4;`` Oڊ ?@* ĊĀc@! H!`*  ``-` @uL f& T+ 4:`Oݒ !`  @6c( R Q`@ @6( T`SB @ 2( Q PD @6c( R "Q`F @6( V"W F 3c 2@p@ .Z@ )c[ @ .c\`@ (c]@ (^ @ *_@@ +c` @9 +a@@; ,#f@  .b@ *#c@ @  (cd@ )#e @ +cB@!  ,c@@7 /cC@@ ,A@@ .cD@@  (E@ *F @# +#G@; /#H@% .I@3  )cJ@@ *cK@@ (L @ *M@ @9 +N@@7 ,#O@@  ,P@ *#Q@ @  (cR@ )#S@ *T`@ +#U@ ,cV @ ,#W`@ .X @  .Y3#`9! 7 5cHQ@ @۲@Ӑ `"@R#(V`2#(  "@R#*V` 2#*  "@R#,V`@ 2#, `"@R#.V`2#. "@R#0V`@ 2#0  "@R#2V`@2#2 "@R#V` 2# @V`R#*`@ )p0:0 2# b"@ V`R#(*0;00 2# d"@R#xV`2#x h@ V`R#(*)00;0 2# @ @R#V`@ 2# @@V`@V`@  @V` "@*#Z `"@*#[ `"@*#] `"@*#^  "@*#_  @"@*#` @*#a  @*#f  "@*#b @*#c @ @ *#d @"@*#e @*#B  @ *#@ @ @*#C @@*#A @ @*#D @@*#E  @*#F  @*#G @ *#H @*#I @@ *#J @@*#K  "@*#L @@*#M @ *#N @*#O @@ *#P "@*#Q "@*#R "@*#S `"@*#T  "@*#U "@*#V `"@*#W "@*#X ` "@R#v*#Y R#vV` 2#v V`Scn3cn V`Pt 0t``@ PclV`⠟+ # +` `$"@ H`8 @ PclV` 0cl耠`@= V`S#p3#p V`Pr 0r` @ PchV`*#@ (@$@"@$`$H8 @ PchV`@ 0ch`@V`⠙+`# *@ $"@`$H8@  Pcj PcjV`@ 0cj`$``#O3   5@Tc(O! @ T`6(ࠚS`R,@ @0 Q Bܒ @@1c"  @  %" g:9`K3p <`:$ 2c4 Oɢ@P```2@`Pcp$ 0cp Pch 0ch Vr$6r W#j 7#j P`d"@P`dPcp 0cp Q#h' 1#h Sr"`3r Scj$`3cj P`d`"@ P`lPctd0ct Vl`d6l P`l"@P`jPct 0ct Rcl`2cl Tcp` 4cp T#h 4#h P`j"@ P`fPct20ct Vcl`26cl P`f`"@ P`hPcp 0cp Ph 0h P`h "@P`NPcp0cp Ph0h Rct" 2ct Tcl!` 4cl P`N"@P`PPc 0c P`P`"@P`nPc$` 0c P`n"@P`p(c_ P`p`@`Pcx 0cx @ H(cI obĥ2  >`@@g: $@9 I@ < 0p : ;#@ @W# *080'@ 7# W &@ W#$ 7#  "@W#W#$ 7# W# @ 7# W# W#:$@W#: 7# W#:W#;W#t c<cb "㈣*<`@7#t P4Pr#+`9 c0r  Wcp".`:`@7cp Rp# .82p Qcl@1cl Wcj@7cj S#h@b3#h cPh0h Vc6c Wcz@7cz ʞgV6Vz  6z%  Qc|@ 31c| Tc8Tc~@ 4c~ Rc2c; `Q P`HQ#zY@8I@0p ;`8$@ (0:0 1#z` RJZ; K3p P|:`; !@+0:p0@0|` T`LQ#~\:`J2 >:`" *p080@1#~` SNR〄[@8I@0p ; 8$@,0;0 2` R`PQ#Y@; K3p 8`; #@+00;00 1#` TRSㄔ^:J2p ::"@ )p0:0@ 3` S TQ#X8I@0p <`8$*09p01#` Q`VV㈚X@;`K30 ;;`# (08p0@6` V`VS#Z;`I0 ;`8! *p09p03# Tc6@Tc4c Tc@ 4c Tc @ 4c Tc , $c# cgcH;)bPc 9 J@ 3p ;`9 $ @@c$@Ppg+ ,0:p00pP : :`J 0 Sch>`:` @$@()008p03ch . P "@t;0 `@ `@` H ` "@ 5P@`"H" /P (  ( P(  )c P(  * P (  , P(  +c P`@0H`@, P`"@.;H2@*;P-p0 :p030 *`  \`@ @`@ `(P0 @P`0 P @;0; gcH<(Q#j#` 8I 30 >8" @6@W`$@U#pg-+p09005#pW` > >`T#hJ 2 = >`'$@ ,`)p0804#h +b K-"@G3`F+`db_@;`@.H  @7 ,`" l ,@ 4H  5# `P``@-00 P:0 0 P㔀@g0 ? W` P㌅=H0p >=!+p0;00@ 0 -"3`  \`"@ O#f2@ `"`8@ W#p 7#p Scr#3cr T#h# 4#h Rj$`2j *   ЊQc`"@ `#'# c  %c  `Qc "@  # '#   "   Qc4@#@#`'# @ +`h2@#``'# @ `h2@#`'# ` `OO#^h@ #@'# O#_@ #'# d@;#'# `W#n@\W#l@H # '# c  $c @lPႀ`@L tJb@@@ސ #HT#@Ԑ` ϐ  pHb@@@Ő 9#HU``@;a@ 5l lMb@ @#a'HU#` @%Ё/㿠;bc`@`@ӕ'c5c`@'c㿠'c@o@̨ 'c c@ 'c c@ k'c c @ 'c c@@3 'c Na @HPa@D@c@ @(r'c c@( 'c c @( 'c c@%#('c c@ /- ('c('c焐  c@ 3 1('cz  c@9 (@ 'c㿠c@9O!@ Qa @@*  'c c @5*'c c?&c # %# c $c c 5#c c@ 'c;(b  :    `@1  c@ v'c c@ 'c c@ 'c c@ 'c"        c @  'c c@@ 'c c@ N'c c@ 'c c@ 'c c@ {'c c@3@ 'c c@!/-@#*'c;  -$ c,#c c* "c )@  (@L& c@53*+'c c@*r'c c@ *c'c c @@@* 'c c @* 'c c @ #!*'c c@)'*'c c@/-*'c c@53*'c c@9*'c㿠5# @M!"Ȓ!X !X a@@` `` $O` @8&# @ &# # @ &# # @ &# # @ 5&# # @@ P&# # @ &# # @ &# # @ &# 㿠;bbc "@``#"@`}` @㿠7 9"̲@  P`R&H `"H P`RP`R2@-0`Rhb0 b 1 R`@"_@1 RK`W @; 5 -)@##!#!#!## `!#  0`R 㿠3 9c"̀@@" c S V&H `"H S VS V@!%"T`@%h5V+bM W@; e t& 3 V 㿠3 9c"̀@@" c S \&H `"H S \S \@!"`@%5\+bM W@; 0 ?& 3 \ 㿠3 9c"̀@@" c S X&H `"H S XS X@!"`@%5X+bM W@;   & 3 X 㿠3 9c"̀@@" c S T&H `"H S TS T@!"`@%5T+bM W@; ƒ & 3 T 㿠7 9"̲@ c R Z&H `"H R ZR Z@$Rc" 2Z@#Ic!"2Z)"LW@; 5  ""  2 Z 㿠3 9c"̀@@"  S`N&H `"H S`NS`N @#c8@'\5N-M`W @ W `f& 3`N 㿠3 9c"̀@@"  S`P&H `"H S`PS`P @#c|@'ې5P-M`W @ # `2& 3`P 㿠3 9c"̀@@"  S`j&H `"H S`jS`j @#c@'5j-M`W @  `& 3`j 㿠3 9c"̀@@"  S`l&H `"H S`lS`l @#z`@'s5l-M`W @  `& 3`l 㿠3 9c"̀@@"  S`f&H `"H S`fS`f @#F`4@'?L5f-M`W @  `& 3`f 㿠3 9c"̀@@"  S`h&H `"H S`hS`h @#`d@' 5h-M`W @ S `b& 3`h 㿠7 9"̲@! # Sb&H `"H SbSb`@%ߐ5@)ؐ 55b;bMW`@  1 3b 㿠3 9c"̀@@"  S`d&H `"H S`dS`d @#`@'5d-M`W @  `& 3`d 㿠7 9"̲@  R`n&H `"H R`nR`n@$yb 3 n @%p8#b3 n+bM W@1 5 #`#### 2`n 㿠7 9"̲@  R`p&H `"H R`pR`p@$X>b 3 p @%5t#b3 p+bM W@1 5z #`#### 2`p 㿠7 9"̲@! # Sr&H `"H SrSr`@%5@)!55r;bMW`@ D V 3r 㿠7 9"̲@! # St&H `"H StSt`@%Ӑ5@)̐!55t;bMW`@  % 3t 㿠7 9"̲@! # Sv&H `"H SvSv`@%5@)"855v;bMW`@   3v 㿠7 9"̲@! # Sx&H `"H SxSx`@%q\5@)j"x55x;bMW`@   3x 㿠7 9"̲@! # Sz&H `"H SzSz`@%@5@)9"55z;bMW`@   3z 㿠; c@9 #7&H 7U``d@̺  d`2@?`  d  d3?@   2@ ? 0?@@ H "H  bbc6H%@ ېc4"JW@ % #4`bL W@-  c &c@%$ 6`  㿠7 @3 c'&H 'T^c@̨ c耧`@ c耧`d@ c耧`2@ c耧`@  c耧` @ c?`c 2?@ @`@ @`d@ @`2@ @`@  @` @ @>` 3p?@@- %`!@ @7. @-QP0/Lp+7G&9B#!;=c8c3 6H%`@ *DbJ W`@ t 3^bK W@' i #%##t$# 5^ 㿠;b @3b %&H %T`a@̰ ac@ ag@ a' @@  a9 "@&H a@ c@ g@ 7 @@   b@&H @+@ @H"H H`@"HB``=`t9` 5` `0``,`6H?`@ @H"H`@"H`|``x`t `o!4`kaL`4#bL W@  ` %`+& 6 㿠;b`$@b#`$ ` @;#`  1}x bT ;z@  #`$4H #` @&Hc#` #c V $@7.a=`X9 J 1p < 9 $@ @(2& q&6 &r&  V@ .a$<]:J 1p 9 : @ @&O&2.$`6@?V`a=X8K@30 =8&@@0 1`!hV* :`6 @@6  q&&` .&  V2@. a@9 $Y@8H3 > 8$ OؐV 2@2,  `a=` ]:K@30 = :$@"`  `q&&` 6&  V 2@,  a=  ]@:K@30 <:" O b$ @ $@ : gJ@ 1p 8: #@ b̚$ @ # "$ 㿠N C`$@V3c# a@8@) !@0@+ a@(@- @ @/ @@1 !@@5 @@7 @@9 !@@; a@H  㿘@  xO;9a( ;9b1 @@&&x. 3c'@'/  VO`-` - @@`4 0?, ,]W`? ```@-`3bܔ*@ R` 2`"]ڐ.`=`?]`O-`7`+ `@( " 2 oIܐܒ?/   ܒ? "A ! 26ܐܒ?/  ܘ ܒ?/` @   o d`  <6H  @ @oܐ d` Z&H@@  `@3  `@  `@/  +5b  `@S  5  =@1a/$ 2?HJ? 3p?`@ܲ? F@˖O]   10? 3? ox d 2@ $"@  «"@  ?à O#33 7`܉6 20? 0?  |ˆ@`}@O3b뀧 P0a@3c"@`뀧 S`3!@ 2@ x``@-""   @ `@@`*2H  $O`@9"̰ '6" $r o"$l<P. ")) "+P"̢@Tc,b,#@+ -"*@@.p0$T`:p04`$- :  @4` PΖ @ T`bp P) L`@ T`"xE   `0@ @+b@=L C@ /T`⨖0   T`-(  @ Q X>`@@` @ `@@ >`@ # @ @ $  *`>`@.H [&@ *`>@ - `(+@@@ $  5 ( 2(Y "@ L`, FL` @ 2@W` HW`+c@@3`7`cW`@7`T`.  `@`@On( ` @ ,`  ,`. ` @=9 @9 T` @2`@0T`T`+`%@ +@+ : .H' m  @@  T`@@m d P@ .T`@@@    .`m ,` !P2@1%%!    @`@   &H Ha "@$$#`2 9`  B@@`  `B@ @` `B*`6@+P⾒ (P⾖#` B4H @  Ia "@$$ 3`@;  ƀ@ @ ` " `ƀ@@` `ƀ`&H P⾀2@0P 2@0⾁  0 `  㿠a `%TbTb" @@#;  .H @ %@@O@ @ @O@$@;  .H @ ,`$$O$@$&O$K!"@6 `$ `$% 3`@=`@3`@> @6O@G3`@8`%@?8.H `@ -&&O&@2&&O&,&@ @6O@%@=.H) @ -`&&O$@&&O&* > 㿠;%b; !. aLRS"`.`%-%@@! !S"R^ ʒ * > 㿠75;3N UOaaUUU@^ Uހ`"@`%N @ `%!`08@ $` @ $ `%%`$@`$ t]>?H0 `>`>%*# +`# @ N `@D` "@`$`$"2= 7`@<@@`7`&@J 52%2;@ H`2 @ ?`J&&H; !,@ @ $ `%  `@`$ t]<K 2 `= <$@)`$*"@ `$@ &28@& H @ !`H  !@ !   22 ! ! :&<.H% \@ -KV`@3bM H  㿠./&.`#Uc,,@ @3@@0O C@db@/T T H( #T,#@+  *9`@.H9 <H h/H #c1H'%36 "@5O CT T @@\h)T (`#*@ *`9`@.H7 <@ huT @<hmT  @TheT ph_T  @+bhk @/̐hc `@5ؐh[ @9"hQ㿠@A9aT!P @ $ "O$ @@ @` ŀ"O`@@ ``$ ÖOǢ"  @ @ @  @   @ @   @@ @    @@ @      a @* 8`#`0% "Ȋa(H`@3` 2?* `2@K` @    @`@`! 0K` O "H 㿠@.  )%#-`T@@ N`@5 `V V `@; bW`Z7 3p?㿠;bTb̀ 2@Tb΁ `@ @ǐ@7/`/&@. @ 6 6ҁ  㿠$@;7̀@/`3c' .44Ψ 4 4ҁb4444ҁḃ: "`3` A2?# ċ2? 0p? @ 1"1"1"Ё1"1"1"1"Ё1" bS`S` @ #9`@#@ @;  @@@@ @ @ #8`@"!@:  "@ @ 88@ 8!@ 20?` * * @ @ *@ *@ 㿠;bĀ@Ϊ?)/!8$< @u@$ c &> @$@?`@ #@  @@    @` @@6H  $O -`@)c !@X @8  " $@<  #@ @@ @ @` @6@$O x-` "@Y@ @9` @ $< @@ @  @ @`@ 6@  $O S-`@)c "@Y@ @9` @ $8`@$@@ @@ @  @ @`@ 6@$O *-` !\`$@  "@Y@@< 9`@$$@@@@ @`@ 6@   $O -`> 㿠. /@.&. .`@T`@ bT`Z @ @ /`+c%-L@ ْ@   2@M 2O 8/ @@?/ *c4# *@ @ @ @ @ @ @ @ @@  @/@1 @6 @7 4 3p?` 㿠;'b;bW"9!%%@@@b#!a @`?.` .` $@(SO !(& @8` @ .H7 @`@ @O   @8` @.H ON+bȪ`@)H`d@1#8@ @ "@ .@S $@@  a8)@ !<( `& O  @  `Pb `$# 8`@ .H  OÀ` %R⾐"`@`@!&OO o3 `.`? $R"O "` `@8 .H @S@ @ O  @8  .H+  O AȬ`@`Nd`@8@  "@@  a8*  <*  `& O   @  `Rb $!`8.H7 Oπ` `%V⾚%  `@&OO 3 ' !;#-a8)"Ĥb <$!P'aTy㼨. '̻. @#*  %.`#)`#)`#@#p-) ##xc#t"#x/#|###+5!#b###c####'pP @|SZtxSZ @4K⹀`@!#`%#d)##\(##hf+#`9#\c@#f { v/̀ GŴ O'R@@  %-c$( L @  T 9 P#) #,`-` P@ݖ T #@Q"@ z]T cPfK?mF v{z`r@> ꀤ`S ǒ`J@#\#d#h`c\#`#!#lf#d`|#`!f  zz vB` r@ )`< @ @ @x@u``@'T `@cT  @  @Db* / R `J⹀`@#\#`#dcc!#he #`К!e z u` @ @ @"/  9 OÙ* A * +` R [`Jb @#\#`  #dc#!#hew 5#`А!ek y۔ bu` @ @/  8`OŹ*  bJ `@!  ̀ @K⹀@#\#`5#d#he. +#`` e# y u[` r@yM y uLyR`r"OK⹀ @  @& '`Dc@ W @L`@(!+ " *@T` @ޣ+ @ * P O+  򀦠 @]@Z %'DW @¦L+ b -  R @+ @ - P O+  c@T@`@S;,`#b*``W` `@@d P +g bN@#`#ddP#\!#hd)#`d h#\c!du x lt/̀ @ @ @`  @ /  :O,Q ,`@ⴥ+ `W` @>d P  "Ib @#`d+#\5`P#d!#hd0#`dh#\c!d# x t['̀ @ @` @ ,  = O, c8 `@E`c4@+ @ @ @r,)!  L@., L @ @`|JL`@%) c!)|>L`@5$$䀠@))@< |*L`@ #))"L @#\#`;#d`!#hc -#`Ԓ!c x s+b̀ @ @ @ O'򀦠 O/8#h̸̲ 71P`! #dP`#`  [h#\3aȴbĶ`@ @#8/a< ,`@- @. , S@ $@ '@ @`@`;h* : 5@ -@ *@ @u "H&_" * (H Y@& .@? 0H>Q p@  5@5 mG o"H/ E@ q@S t@*= G`K`e @G `@$``Le@;$``O` "@d9d ``@V$@ /"H/&sl`r@-sސc`#t!<82 *Q@Q@ @#p#lR`I @&`6GJ SbSbYtGBhp;l@+@h-`ݤ)`G&$`1@D!<}\* ; 5@ -@ *@ @ G Y" *GSG .@J 0"@IK p@  5@@ m"H oG>@ q@ t"@46`L `"@dd`ۀ`@  Հ`+a<a8a< #`@|@&O`"O  `e]&@ s&!P`* `RJ R `@@ @ $ `A$H `A@`$`$H`G<h`- M @   Qb!$ > .H+ @@ $  &H  /U %" @ @@$`_`G\`Z`&# atv! `L "@ ~ W"̟4 3p?㿘{"@&  2@t 2@o {& !b"K DS@ "@ C-@?;3aaxa}"HxB"@G O 5@  *@ .@ 0@@ t@ ڐ H -WH   -@-r\-5"TV@ =`a * /xVV@@9u" &  z㿘{"@&  -Ub @97 "@w"@ O@ ;rwՒ2OO ;b7bz&  㿠; bW`V @ @aW d K6@ aR * -xV@ 3 tĐb`&㿠.  #@/ `@#. > a0 a-  >@ @3 a# `a   ;`%@@@ @!    @S` 2`@ : `@.``-`2@  @@H. $O . > 㿠. 7'@/ V@V6`% + #c4@c88`@  ȴ@``͐&!@zGG& @@%&`@" . @.@(!(.@T@.+`# +  @ H`q] ΁`aOƐ5`.`@=`ȁ㿠6 ;b+-!W c4=W c#8 @  Ƞ `u`r@'@#zUGG$ @@.'``@+, *`" * @!, `( (`/` S`@ @ R`@`,  H p lO4. < ȝ㿠;7b/-4W  W    ^+@ ``%GAG@&GG- *`" * `@-) !@(.@ S`@` R`H `p ȁ`@Oʐ  㿠;bOa @7tsObW` @b bsY   P(`0@# R@ #_ d 2@ - s>  T,%`47 s2  V`.b6`# bs&   S +"$ 3 DTdlt4,$<|L\| "  @=+ @ @                              㿠;Oa`@9-M\`@5@ @   @ @  @@ @  @&&@@@ @  @&@@ @  @  @@  -1] ]N@@ .<"/`@2@ P 0@&  @&@@& ` 0"H pk `]  #]H/``.6 㿠;bOb @M b W`*bg+ !`W`,X:K@30 : b̭>%Rd @c(@3R,.00;0 % 2,@+ ` "" :@5 r% r?1"̒3 h[ Pb-b-b5b@ @;7o&c, r  r$XXX```P`````````@@@`@@@``````@@@@@@@@@````````````````H``````````````H `"` E@ + @ @      `-"@ `A@   #@@@ "@6 @-1 "@/ @&* "@( " @" F@'@"#`@ "@ 7H "@ "Z`H     `"@  `K"@ `M@  㿐@ `;@6 3p?㿐@ K;6 3p?㿐@ 6;6 3p?㿐@ !;6 3p?H5H` H#d` #\   #``ܨ dQ@`@G@ 2@D`$"@?`$ @:  ]6@ O@+ P   `@ @ $@ \d @`LLp =`$$O\p@\ 7" @  8@% / @@ U`3cHU`#H\U`;cH$U`Hd U` #HU`/H8U``2@U` U` `@  P  k@ @hp, 1#p&U`%5`+b##  $#$#  㿠; b@  Oc@@7 @5  OcD <@Oc@ @,OcD @ W`r UU8J 1p 89  @`@  UU= K 2 = =`$r@ 6=9#d㿠; b@  HcA@/ @-  P`t <@HcA @$P`t@ HcE UU<`J 1p <`@<! @  UU>K 2 >=%@9#\㿠; b@  HcB@/ @-  HcF <@HcB @$HcF@ P`v UU<`J 1p <`@<! @  UU>K 2 >=%@9 #㿠; b@  HcC@/ @-  HcG <@HcC @$HcG@ P`x UU<`J 1p <`@<! @  UU>K 2 >=%@9 `P㿠-̹. @V`B v@? @ [ d  K@@ $6`B t@ `v4<`3;` &H [6 : `u$@ u6`B 6`B@V`6@@(`>6`6c 'c  㿠;b̸b̻. Q`BQ`65 3p?@` I@`Z@ `2@ `4H$`$`4$$`$`$`.$5`@;` 2 :``&H [-z  aX; H3p 6`=@; =`$  @ $ Q`B@` $H &H @6 20?@G @E @ `Z@`2& @`& @/& & -& 2  9` 08`&H Zz `!]9`J 2p 6`<@9`8$@&H& @ `$H @6HQ`6Q`64 2?"@ .1`B 6`6.  $> b̛*  R`6R`B @  2`B  b  dp|PZ 7" 㰴  8@ / @@ . . . .  .  . !. ". #. #H@)`P@@ W @ W @W  @  P   `"@W ZL d <6@W  @! #` |%m @$-`= @ 7 Z- d @W & 7 W `@&`(`8@ 7 Z d @W ! 7 W `@!`*:`@ 7 Z  d @W #`7  @! $#`,81#mx/  $$  TTT``p㿠Y 5"  @H.@@ G  Y͐ d-S~@/mBY d3bV~@cm5bm1 Y  Y"O `* .U6UBU`65`6`U`B4B`@4 6`2`B`` @@8@@@@@@@@@@@@@@8@@@@@@@@@H@㿠)'`#耥`"@(-`ŀ./4+ @.`@ `@ .c*# *.Q@ @'T@`@ .c4*$@ * @ @`0@-+c8.  @9#4@`@D`@` @> &`!%4@ `@ < `@` @  3 `@`@` @ &`!`@# c8.  @5llP 8.@  @  !1l[ ,#8  +` .+c4.`#- '`@`@`@` @ ` @`/ @. .8@ ` @ -1l$ Xc4@  @  /@#bc 'c-8@  , R c8.@ `@. @) 4!@(  <@  8@b̀`@  `1k | 8@@` `,   | 4@`@ `-)kː+ kǐ`#8 ``,  <] 2@`@  `9k`#8  @@`, ~ D 1@,`@  `! k c8@ ` , ~ϔ X d @''8 @ @1ky!   @  `-3kia48 @ ` , ~   &'#.!@#4*# /`@ `@. +.`c%-.S@ @ P@ @ 1~r #8. # 4`!# 2?/`< /8.@`.@8 ` @  7@ /!8..@ ,&,` `, `#4 `@8@`.@c8 @ @  !" "XT@@ld@@DD.#\-`$(`.@R `@P#p`#l57#hl#d9! `#` P'#t.`%!@#5-`@U` '` Ȁ@(@  `   ` ? " 2?30?ɐ@~ @ 0 0` 0p?(; `8 @2 0?)`9  ` ` ` ;   # 3p?2?@Zt @`@ 5 1p?(`8 ` `   ` ? # 10?0?@@d @` 2 2p?*`:  ` ` `  0?; @3p?ߐ@' @ `x 0 2?*= `` 2 3p?*`:  ` `   ` ? ! 3p?3?u@ @`/ @1 0p?(:S2H  `L@-  @ ` 2 0?*`:  `` 0` 1p?(;~ ` `   ` ? " 0?2?6@l @h 2` 2p?* 9`m2H ` `f@-  @ `3 2?+`; N ` @1 3p?-8C ` `   ` 2p?>" 20?A@ @  0 ` a+ ` `   ` 8# 3? @0p?  `/   ` `@@f  ` ` ? # 10? @1p?a0  a@ ``@3  P#\  @2@ ` ``@(@&api2bs6-  ``@1 @pXi!*-  3!TaXi"- @@- BsȒ-  `@- U` @ 5`\ ``@hP #\-  =O`.`\T( %D$ |pP %D %D`(%D%D%D%D%D%D%D%D0X%Dp , h 'T#8. "@#` .#\,%6,*@#dU@ @#p #h#*c!$ #,"5U @L`(@) T(2 @+`#@ *1p?8`@@ #l'T P  `0@+@ 1!@}xLC@+a|#t+ +a#t+ '``x 8@* @@,$5 @ > ;bQH T ⨴ ( #@ T =    >@?'T 'T  @ T  " + @ T =   >@'T 'T/     /,!$>` @ T "̲ -  Tb =   >@'T 'T/     /,9 $> @ T  bز (` !T? ?` @ @  'T/     / @    'T     /@     %    L#t`8    /,; $> @ T)  , +  S =   >@'T 'T/     / @ @b@|}LC@ ,>       l/ @ @  %  @@  %  )'T"     N/`@ T" &H S @ @@ , > /   'T   -/T`, ` 4`@>  ,` hd`@ƟP@  3 c 'T   /4`, WV= T`T`4`/ 9 @4H4`hdV!"RbԀ@ "% $'T   / ` , >``@ ` ,` c8 'T   / @ T% `&H S- @ @ , ` :``<@7'` ,` ` 5 P 'T    /@   @T#` &H S @ @ ,c= !   @@  @  %  1#x  'T   ~/T 2`@?`j @ @T"  &H R @ @, ;    @  @ @%  9#  'T   G/ 1@    'T     8/@   ;  % c#tc    "/@ $3@@  @3      /$  "H T  Re -  =   >@'T 'T/@@       / 3% T` #tc )` 'T   /R7  `9 ,? @$5 @ T " - R =   >@'T 'T/    /@' R    ?`@@ 5  @ T 8b9=  I@0  9  =  @'T/    /Q   < @ 5 ;@ T8b9:K 3p  8 : 'T  % _/    Y/ @ 9@  @@ T8b9!8 K1p  : 8 % 'T>/     7/  @ T89a;@J 20  8` ; 'T   % /     /@!  ! @ T8b9a=  K 10  9` =  #'T/     / 3 @ T8ᨘb98 J 2p ;  8 "'T  @ % /     / @  3 @@ T89;  J@0p  ;` ;  'T/     /9 @@ T a8:`b9H2 = :` !'T  @% /     / @ 7  @ T8/9ȋ:` I@3  :  :` %'Tq/     j/  @ T8"9;`aȖI2  ; ;` "'T  % O/     H/@!  ! @ T8؄b9;` K0  8` ;` #'T-/     &/ ; @@ T89aؓ8 J@ 30 ;  8 "'T  @ %  /     /@   @@  T/  ('T  /     /   @@ T a (`'T   @% /     /,= Ġ #t      /, > aMb @7$H T b ( # P  =    >@'T 'T/     /@+  @   'Tb     /$9@.@@ T  "$ 2` @ 9`'Tp/     i/ ` @ 'T  b     %  X/$9@H`@T)" )` " O =    >@@'T 'T=/@ T 2 $; 'T   @% +/     $/LC, E@ ;`      /8L@   'Tb<   /     /Oa  `>,?`@$3 @ T H (#OI =   @  'T/    /,9@$>  @ T  bT (` ! O& =   >@'T 'T/     /O  ` > ,?`@$5 /@@ T b` ( N =   >@'T 'T/    /N  ` ? ,> @$3 !@@ T l NӐ - =  >@f'T 'Tc/ ;@ T bx 2 ; 'TR/    L/,$! @ >`9"KH T/ ┴ )` "@ N =   >@+'T 'T(/     !/, ?`T  'T   /, =        /, >       /, =       /, 9       / ` @/@       %  T  'T / `@@@     @%  T 'T   / @@ T  %  T5`@;`e T  &H N @ @   `X   'T   / @@Ԁ@ T  `@% T6 >e T'`  &H M @ @   h   'T   _/T5 ; e @ @T! `&H M @ @`,<    `x   'T   3/ ` @y@      ` %  #t`    / `@@`@     @%  #t    /T``@ p`@ T4H'TT@@ t`@2`MJ Z @ @@+`T`T`@``'T,`hd9 ``3V \ `Ř hd c@P*# /```@h .`> dW# `#`7` `* *`4#\" +`#d)`D`@$@ @` ` ,  @ 86`>  ' Ƞ @$@',` ,` $``@  @@@$ @` ` . @ ?`6`@ :  Ƞa04H,` `@  `4H,`p@HhdR"W@ @h 4`WVT`#@+ 8@4`hd AU@hd`P@b @V7lD` Qh @ @%lL` T @hd@Q T@84`6hhd /R@ Twt@( @ @9l!T_ٔ OT@hd@PTO`@`@ L`@T`!\l_א 2H4`hdSƒ `jl\T`Pbր @c %c  \`% % %  $tHH L x<dH H   0 , , , , , t t t t`''TTR`@"̣./@*" )`.P6@ @ T&@@`&@=@ ) 'T". .@(`$*`. W@ @ T f@ @`&@: .H . 'T#$c. P '` `` P ) @Ȼ. @@ @3_atT  @^!T^  @^aT  @!^!T  @^ HcH`@ T UU`>=`H0 @==`&'T Rz@ TUU`~>K@30 ? >'@'TTt LH@o Tz@kK.T V\Ӡ c  @+^aTZY  @-^ T1`@ =ML  @^(TCB  @^"HT9 OcN @4T`($@T  #.` @<` @:`J  T`?   @^]d M#Q@T)`"J֐ - >>@;'T 'T8T K#a@#;JĐ d K@1^="*T Kca`@%^4  $? H0p >`? $@*`ٿT;^!b z! $=J 1p ==&) ٭ TΒ͐  @^ b JcN2@  J (  P`ِ@ NM`2@ TJy   T V@ҵ T뫒  @)]# IcR @TJb .  '@->.H  'TJM2@  NM@JJ  R`V҇`  HR`@GJ>   V`ZO LcQ@; M#R@7 Ica @"+J* d K@]4+T K#a@]X a`$> K3p ?`> %.&aT+#]c| zc $<I@ 10 = <'.T32  @7]o MO@T(` *`I ?` @ >@ 'T1 'TT TQ ^֦T  @ ]Lc NN`@T- IŐ ?  >@'T 'TTT Z$@T  #UU=~K 3p => &`I  T `Tܒې  @ ]# LcM`@T* I >` @.H9  'TJM2H TI   UV@ѿ` T굒  @\c MS@T) !@(Ii ?` @>@'T1 'TTȐ Tꕒ  @#\ѐ` JP@T+ $ *II >` @>@'T9 'TT[Tut  @\`@ KN`2@ TI,   V`Հ T_^  @/\\I  P`P@қ TNM  @\ I#J@TI /  <` @>@'T 'TT`@ LL`@ H   T R  T#"  @\_` MK@THڐ /` >>@'T 'TT`@ HL`@ HƐ   Q`R@пT  @5\4H +)" bX  @}--\% z $= K 2 =`= &@/ ױdiTH  )" b@  @- @  -/ -1 !-; a - a - --$ [0 .V`B- %@;` @; 6`B @VB@ 6B c "c"T# [ːaX   R`B+`# >` @ :2`B Q B`@`1 B ``O  Tji  @-[[痐 H!  P`P@ѡ  NN@TZ$@T  #UU>K 2 >:!@  H  W `Z@T98  @)[u!T/.  @+[kaT%$  @-[aT NO@ _  W`^ԣ HN`@ Gΐ   Q``"  r   X#`5\)#hȀ`#t"#d#l#p a"#UR6 1p?@ #l  #lld@UUl@ dd/ '/`  ll  `@ @@ @l?#l//////////////l/#x /@ìl /#\ /nG>4@t#[#|/`@l 2p? 2?@4 @ &` 1`` ( `@)  6   ( O)?1`( `) @@ "@ 5`, `,` @ &O  #X#|y/ #Z #| `7  ,, %S⾊#`'@@U  Jἀ@  $%`;  @` S'@A8/` @ @:`* 5`8*08 :08ddZp K`w@K H|epHw`@K`* 5:`*08 :08da #  @H[| `@O/$ /t1@J#8l@$  `  @ @ *4`-@  &O #[#|/#^#|/ `  ` @ +3``)`@  `&O #Z #|/#]#|/l`@   ` `@ ,0`,@ &O #]#|/#Z#|/1 #!X#| ` @ @n2`,, %Qb %@T  J @  `$#9`@@` R& @@`- ` @:`* 2`9 *08 :08ccjp Jw@J0G|dp`K w`@J"`* 38*08 `:08cq #  `@Gk| `@&O /$  /@l #\l͂$H)/t @u! l! # 5` 2p? 2?@ Y#| 7 @V `T%'@!`@GJ  @  `$& <`@@` Qb$@28-`@  @+.`* 4`9`*08 :08cbӒp Hw@IF|czp`Lw`@ I #  `@F| O/l 4` 0? 2?@@/ 8  ?  `@ 2 &O #\#|v/#[@ #|/-7#8ᰞ]#|   `  @ @q3` %S""$ @E Kἀ`@  $ : @` S"& @1`, @  @+`* 5:`*08 :08bkb<pK`w @IFa|bp L w@ H #  @FL| &O //t @ 񀦠@#@l@  / / t/@  #\#|'@#@@0'@(B @ `@@"`@O` `@^5@ ^H"@`..`@O뀤`ƬOրt. Oɬ'@@#@l@ #x @ @@@% 8`V" %% !` @*L`  @  $!`: @` Q"& @- @` @ `* 1 :*08 :08a $O abp`M w"@H( @ "H E|t#2@ $O @U@F-) 7#8 ἠ&``V % " @@L  `@`  $!`9 @` R"@ @  ( "@aː$O apK w`"@lGl@8  `p Kw"@;`G7`l`"H;`@/&   @ `  d`h``2 @ 10?@ *:#$O `#`"@l7l` @:  ` @?)<lc"@l!l "H=l@.&  @ `d h`2  3p?,;#$Ol @@#$`!+$   %`l`@@;35'`&`& @@v)% "@o न&   @ ` d h``2  1p?*`<`#$O d @,/଀`@(l`@%1 #.+  / %/`S@@+!c.@L@  mZTL`@mKU@  @@ ` dh`2  30?@ . <#$O` 㿠;bW`,W`* @+.00;0 7`,,`< @ 7`,7`.cc @'c` @'c 3U͐b  @5UƐ8  #@7UL 9U"d  b4RR+` * "@)`@ @+` * "@)`+ R@   hݞ"xU@`㿠93!耦 @<.@@;bO#T2H+.2HU`2H#.*"IcV 2H."JW`2H.KcX 2H .%LcY @ .-'UO  f @  .7/@ U>4㿠@  . ;b5 U.H㿠@.>`"@ 7. bUp . -' U\㿠; cHcH T@ gY #$$O`5`&c &c# %#    `* d@ *  mH m* * 㿐;cH;b̢@'   #`/ V`@``@@n􀈀2@ $А   ` ` $#$O   #`70V@ ``@@nА2@  $   " "  $``#$O 㿠 * > 㿠 * > 㿠;b` `$@  35Teb %$ 㽐   #`HP@@  @n`$ #ObR R`@ #c' "RV`@+,`%#@`bU X@,`;cж%`V^`@3,`# `bR``@',`" `T\ @,`7 %`bW`Z @,`  &`bJ#c`@!,` 8"`"Kd`@1,`+`P$`"Vl@ ,`5t'@`bQ f@,`" `bS h`@-,`'#`U`b @,``&`Vj@3,``؊!`bRd@),`!!# `" @,`1!$%@```@,` aH&`Rb @%,`ap"`T |@;,`-$`bV#x@,`5 @`"IcZ @,`!ܔ"@ `Kc[`@7,`)!$`M\`@ ,`&`"N]@3,`$!@`bK#^@+,`%<#@`bM#_@,`;bL%`H``@,`"p&`Ja`@',`∲#`L@ @ 7,`⴪`%!)bOcD @ "Pr@,`b؊`&)"Rr@ ),`!"#@)`"LA@ 1,`#`%@!+HcE`@ bQ t@,`@`&+bS t@ +,`%l#+`bM#B@ ;,`c`%!-HF`@"Q`v @,`㰒`& -S`v @ -,`'Բ$-`McC @ ,`c`&!7 "HG@5R x`@,` `"@ 7!"Sx`@ 7,`) 8$7`MH`@bW`z @ ,``T` %bVz @ %,``|" %`L#I@1,`+`$`"NJ@,`༂'@`"IcK @,`& `KcL @-,`)!$`McM`@ ,`a(&`"HN@,`5H!@`"JO@3,`%l#@`bM#P@,`1!%@`HcQ`@,`! `NR`@',`ܘ" `LS @;,`-%`bN#T@,` "  @`bJ#U`@!,`"<& `"KV`@7,`3b\$`MX`@ ,`x&`bI#W@,`☒" `bK#Y@ ,`'#`@ ,`-%`@ ,`c&`@ ,` c8 `@ ,`d" `@ ,`& `@!,`)#$`@",`7%@`@$,`$&`@(,` \ `@5,``"@ @'%,``#@@73,```%@ ,` `&@5,`aT`!HR`@ @%,`!!#@`@-,`+a$`@; ,`1!&@`@ ,` @`@@,`b!@` @,`b("`@),`'\$`@7,`3b%@`@,`b&`@,` b `@,`"@` @% ,`!#P#@`@-@,`+c$`@;,`1#&@`@ ,` @`@,``!@` @,``0"`@',`\$`PDk+` P `@$ ; `$`   P @@ P LDK1  P۔  O;`Pє LP㿠7 HH R `@  ` 2@ $ d@ `,  , $``#$O 5`&c &c# bp%#  㿠;b;bO!"@ R|Ⲁ @`PR|2@2|R @R@ %R쀐@+bT41-<| "̲ 5|O5,O㿠5! %Wb%@@@ .`!̦@̥, $!Rb$!- J!?.`" @= .H9 @t`@Z`A@=  c4#8@` `@``@  `8@   *ZcO`  @`  U`$#= .H  OԀ `%W"# 5 O``@5 9 @) O % Ɛ @ O  O`@   @  O  ƃ5 ; @ O  Ʋ`@&O}O` @3OIaT㿠75 %Wb%@@@ .`.`̚@+``$# O`̩+ Rᰪ$? @=` @ .H9 @v`@\`A@?c4@0@@ & @&`8@ 1#8 @  *YO`  @`  Q"$ =`@ .H OЀ `%W"# 5 O``@5`@ 9 @) O % Ɛ @ O  O`@   @  O  ƅ5` @8`@ O  Ʋ`@&O{O` @3Nax㿠b`%V' @ .`$'LἫ+ V.%@ *b̄%? `@8 .H; @g@NA@24c8@` "`@  ( Y``$L V `@8  .H O݀`%V'`3`ƀ`@0 : @(O$`Ƙ @ O`ƀ`@  @ O`Ƒ09`@O`ƶ!O  @3Na㿠95! %Wb%@@ @ .`! ̔%* $!.`4!% O ̩*`Qb4%`? @8` @ .H+ @t`@Z`A@=8@ # 4`@@ (@`# 6`8@   `-Xs`O ` @`  Pb$#8` @ .H  @ OҀ ` %V⾘#` 5 O @0`@`8@@)`@O`% Ɗ`@@`@O` O @ `@ @`@ O` Ɵ0``@;` @@`@O` Ʋ`@ &O}O @3MXa㿠;Wa`@B 97"-+᰺"̸ᰦa  $ R @+P"2@($U`%&#@ @M  @`$ # : @U "@:@$`d2@ $( Wِ `Sᾤ$ &O @3M a㿠;Wa`@B 97"-+᰺"̸ᰦa  $ R @+P"2@($U`%&#@ @M  @`$ # : @U "@:@$`d"@ $( W `Sᾤ$ &O @3Lb㿠;Wa`@b -9"7/ᰠ"̺`ἢ  $# P`@IP"2@F$Pb%&%@@=M  @$ #`: @Pb "@ @:@-$ @  @&A @ )@@7@-@(@ P @PP $H $( W` Sa$`@&O` @3LQb4㿠;Wa€`@I 75/)̠!  Q@@3@ Ub %" " @+N  @ $ !`8 @Ub' #@(#+` ` @1- .!~%-  `- !   Tº``@&O @9K"`㿠;Wa€`@] 5)7'#̠+̴c  T`@E U %" " @=N   @ $ " 9  @U+ #@,(`+` `@$(`" *`"")` `%  TUր@@  !% 1/.!~-ူ  ,   Saº``@&O @9K"㿠;Wa€`@] 5)7'#̠+̴c  T`@E U %" " @=N   @ $ " 9  @U+ #@,(`+`  `@@$(`" *`"")` `@%  TUր@@  !% 1/.!~-ူ  ,R   Saº``@&O @9K-"㿠:"̶#ͮ6 6` 3p? .082?;086 -p8 0?9p86,8 3p?8p87  ,p8 2p?:87`.08 0p?9085@.8 ;830?2  /08 2p?:8@-> 㿠;bW`W`Rl@+bJہ/z*U @ ^bn@9"V@  7F d 2@ ^ ^ ^HHHHHHHH >@"` @+ @ @   LLLLLLLLL >ᘘ"` @+ @ @   `@R ⠓)`"@) @$ "@  J83` 2?   ` 2?`㿀  3p?d  / &$-``,@ `>gK 2 ? >$@@&`#ئ ) d@6 d6@@3 V @ @-#6# @@! "@V 6 d 2@ V   6 @@ @@(:`@ 6 d @J & @3`V `@` @.`#6{# @@! "@V 6s d 2@`V  6 @@ @@+`8@ `6_ d @ Iؐ#`"@3V @ @-#@6H# @@! "@V 6@ d 26@V   6 @@ @@*;`&@ 6, d @-I0O^d`@ c"c# !# %  H;>a`;'a@7>/%Hc`t @  @ !X(H@+ @  #,b, P d< `@  `@` //`IOޔ @ؔ Ӕ H͔ Ȕ @ 5N`t @7DI$㘁 H;>5b;'a7Ȓ㰐t' 2@ @.cH(  *b *{l{^+b̒ P ccc  #c #c#c c̘  @ /mlH@ 3l1#Hؒ`HӒ H;>7bd;'a5$<sі 2@ @. 7@H/  @  *`" )`{{`'` /`  ""`"  P cr  @ /mPlG\H@ 3l<1 lH~`Hy@p  `7@`A @`B 3` 2?㿘;@7bt;5'asb @  @ bH+` + @ W +b .@-W *`  "" )`B`0@-&dg<`K 2 <<`'@ @-4@ Lx ^W $@_7 (p0900%7 Z-1 H W #@P d.7 MW  ݦ..` d:K 2 < :!@ @!4k@`>  .H   $@  4]W  ,00 ;p0 7  /  /  Gʐa &@ X<} <  c &c# %#  㿠;Wa€@* 97#a¨8   ?P@@@   *@ @ #\O2 3p?W`-=``&O㿠;bW`̐ 6* > 㿠;bW` 7* > 㿠;bW` 9* > 㿠 ** > 㿠;bW` ,* > 㿠 /* > 㿠 0* > 㿠 1* > 㿠+ Ua€@D )#ca¦cc8  Q@0@@. ``(@(@+   U` @ ( 5`+   (@ . ` `(@` "@   ` ` ` 6@ -`   V`@&O @9!(F`@;aLF߁㿘;9ax IW!€`@( 57 R@*  , `@OK C@2@ 3:  3qa/ U¸ `@&O`㿠;Wa€`@) 57a  T@*`@ - @ @ 4@ `ߐ3   3AaW  ` &OP;Wa€`@1 9a##  R@" - 8-` @ "@ O @ @3FYa P5 FTW W`  `@&O @7FA㿐#\&@#`/ @@-%&@#l-#d+#h/ l@l @ A`@@`@O`a@ `@@`@O`ac8c@Idh @=Ln@6   `*  @ -@P@ #\%@@!Mo@ u12^ Ȁ @ 8 F@d 3&H 2Y`@ O Fah @;L'@4  @ *@ @ @ -@@U@ #\#JM*@ t2 Ȁ @ 8 F@d 3&H 2X͔`@ O ĺa` a $OQl\/@Ep$HL`@IcJ 2@ 1  S R @ 7! +#'#%## `$ #d3 b̺b̀ #`#\R`R`#p#l#@ #h  *O* O hdh#| #x #t @t`t(xd#| / @/ `@h,# @ `#t @t @I@ @  dh@hO`8@)d` @KLh@`@  ) `@.1O U@@@ - 6 30?*:`#h OҀF`@ @  dh@<hO7`c8@&d`@Kh@   `*  `.1  U@@ ,5` 0?  (8`#h OՀ ah # # $Oeh``@ !)%#8PaĬ#aĤ  T `- @@ @@"- (!* / @S@ @|*x@ M`2@`  $@#p02@`#p#l`$OT`0  @"@  D"H Dbd DbD  @7DĤ!,:'0   @ H - "@ 2C-C HM 0l 2\ U `Cc H= 0\ 2\ `U`pl@ 'Hцhpylht@t`) t(x #h@##d.`@. `-#"@-1- $@,!#####t@t#`#@H`@!#@R@*#& c- R .`) @ @@  @J d+/c814# U`V`,  @`@,, @ (!(/`S@ @!, @`* #+` `@x*|@ @ H2@`$@#p/2@`#p#l`  `$OU`d@ P XC@ Gn V*00;p06% .`<`@6plV6`)0080 @* ; @ 6;cpB h##$O[`h2 #` ##$OAh\x |R`R`h@t. )`@Zt`.t.d+` x|@h  ` * t@;t`M@@.d@"@) J$@" 1#8@ @ q/  d @ F 8q֒ Ȁ F@ d 3&H 2U h`@ $OO h !$Oh\)% !c@$c\ &@% h   # P9;a8";a< @"- 8`@`/   *` `*  &O;!b#@!#@F `/  @Lؒ ,+",,` R `@, *`#$ +`R  )`@) @  @  @U d"@`.t d6@`M5@  Py )#A`@&O`&㿠3;a8b;a< @+b/-84 @`/`@ /`@)` ",)  `@ `, @`@ `@ ( &O#!b### @   @LW  &O' c8*  @ H@Āf@Ċ @+@ !<(a8*  㿠9"Ā`@4";75a8a8<8  @  /` @``'`Œ& @&O㿠9"Ā`@4";75a8a8<8  @  /` @``'`&~{xur @&O!㿠;bW`RW`W`@ P-@#\?媚 q 㿠;bW`RW`W`@ P-@ԐȒ#\?呚  㿠;b;ኡ.`aT`T T`-T`*-  *`%@" @@ x#\@ x#\  p"PP#\?]* > 㿠;b;!.aT T T-`T*`,  )`%"@@ ”@SbSbҀ @&  x#\?+2  & 0p?-`<`2O#\㿠;9b̻.`!)W@T !`T W@@@ @b@%S"S"Ҙ?#\ * > 㿠ז H* > 㿠͖ B* > 㿠, d@ * ? ޔ* ?`㿠 Di   R* > 㿠 D\   R* > 㿠 : H* > 㿠,h   ! r* > 㿠 "  2* > 㿠 # u 2* > 㿠 D%  5h H* > 㿠;b̐ 6W`\ H* > 㿠;b̐ 7W`P H* > 㿠;b̐ 9W`D H* > 㿠 8: H* > 㿠;b̐ 4W`. H* > 㿠 3 $ H* > 㿠 . H* > 㿠 + d B* > 㿠; b̐?  W`W`#\ %* > 㿠; b̐?  W`W`#\  &* > 㿠; b̐?  W`W`#\ "* > 㿠;?b̺  W W #\W  9* > P;cHP8`@8  P Y ` @9+ d 2@   cal!? (9  5?/` /` +{ +x `` 7` 7`%7` @/` 7`/`/`/` !" ""  P;cHVc``@c`  P Y  @9+H d 2@ ;97`<!>19 ~ p>. . +3 +0 `  %6+) +&   6 6$@6@. `. ..cc ``! c c c  PV @A` @>5` @:5`@5` P YR `y@ `J@`K@`L"@- 7@`z@`{@ +7 /)  /+`/-/>S/` *͐  ߔ 5N`t @;9`>:㿠; KcH* dc` &H J #` @  㿘;J7cl;'a5i* 2@ `@+`# cH,  -.`-* d !@ y z C&H {q 㿘; /a;7a,@h 2@ @+%H,  /.`ⴰ. @M z ``,,,@@@@㿠*F 7K"   @A/ @@-+=\  2Ӕ   2ϔ   2˔   2ǔ   2Ô   2ο b $ <  <$; ! $  :"@ ! </#=L !,   J㿠^.g.%=`K 2 ==`$@@` @ d) d@  @@` @"` $@!   @2H )А @ `- )ʐ &O `-@`! @` @   㿠;b̻.`'@VvVt@@Q * > (4@dpLX|t\D,lT<P $ `H$P|` <Xt0 ,Ll ,Ll㽀. 9#'@.1V@#-`(#``@@3-`-&-` "@b̉. #\TcvTct@@ P  ` P \  `@ ##d0@ #h #p)/b#x#l "#t"#|### @)"K"@ KO`c 3` % 0?#8@^ -@ X  <U  R  O  L  I  F  C  @  =  :  7  4  1  .  +  (  %  "            <          "@&  # @ L%!` @+`@O``@ S) #;ؒ"@<` 4H36#  S Sb@!`` `@@ "T @@L(5 dbU`2@LO`@%\ @%; L%@*  t  (   * c, (  * c  {   u c o  cܢ i c̢ c+ c ]1 # W-  Q/ ㌢ K  #| E! #p ? c` 9# cP 3 D - 8 ' #, !'    c      |  x  @! ,;/L?Wd @Γ- @ ɀh!Ӕ\:J2p `=`:"$ț`ȖKcH@bU z@ 'N bV \  `zJS`@̢  b̰#H` e '&*  (S@@1 `7@`A2@,U  H(^ W`W`] @:`4W`-0;00 7``RbԀ@2@5 c("c5 `# %#`c "c J OŐD`!S`T @&ސ d lU:U@@@):P T&А 2  1p?@) =#!&Đ   g8`I@2p 88`# @ @&+  g8`H3p ; 8`"@ 4H @`@%:`|  ``@ : `  :   ::  # # ` &# #р`)ǭ"UT@ &k dlQ#: @ Q @ @9ݐ # 1#H &T*  (S@ @. ` H* P T  ` `@ ! a]t 9pd /"}8?}_ #{ OȐu`)Q #H &* `+S `@$  PH! P T[  @a+a]0 !<9p|?}#A OҐ;`-HV$`@1$ `@-$%ѐ U (080#@+ :&@p5 5 "P`R @-+98aX# `%# 9/al`& /9$ሒ`P 9`~ 9Ȓ`ɬ 〤`KcL @ %}+ bQ R` u ̀`Ʃ bN#M @ %f RV ג `ƒKcI @ 8͐ǒ %H d "Pc~@ +8a %9 bUX`ސ RT@ &H `]Kc` @ 8 p% d "Pc~@ +8b( a% bUT`ސu S`0 L`) E`"ܐ >`Ր 7`ΐ 0` ǐ )` ⾐ ⼐ ⺐ ⸐ ⶐ h`aӆ\ 8H3p ; 8" $ @``ݔ `)ݐ"Mca @  $ d _@18"@  =%@΀7bǀ`ŤbHa@  $a d Z@-7ڐ <5 z̘a $I#a=J 2 > ="@)`@7=`bgI@0 ==`R 7K`/iM#a @  ($' d K@17#{ (; z"̔$Ka9 J@ 1p `=9  @(@7<=`bgH3p > =`%Z 7z#`S`0Jca`@  P# d 2@-7fA P;   zb̆! $K#a= H0p > = #+`@7Nc=`gK@ 2 ==`ސ"@  7@א`1"M#R@ 6 #: R`Z`# @G`@ # d 2@A` L @0* @ #  `2H),`#  `2H!$`#  `2H`#w 2 3`2H`#o d e`2H  `!,!P`^.`@>)L^ @0* @Ā#P   2H)%,#H  2H!%$#@   2H%#8   2H%#0 ( ) 2@ %  d%% T`z"@@.d #d`&O1 @+6  -bK⸀`"@ \V76@ \7   㿠 `@6`@>" d: >`#@30?㿠. /'@'/ S@ -`- @@۪ )"Lo`@" L n@` @`  N n`@ ` ` H`" d &H%` `Lo`2H   `"̦"H`@$R 0`@(J@`@ KcA @LB`@)O#C`@ Pr@ Q`t @ R`v @ Rx@ S`z @ LcD@%@McE @9HF`@IcG @JH`@ KcI @LJ`@)O#K`@ HL@ @J#M`@ JN@ KO`@#M#P@+HcQ @I#R@ JcS @  @  @  d@ > d@  d@6@- 4' @@ @ P@ > P@  P@@-'#@@'ؒ @ >Ғ @ ̒ @%@-'@’ d@ = d@  d@6)-4 @+@ P@ = P@  P@9-@ @ = @  @-@y d@ ;s d@ m d@6 -4 @ @_ P@ ;Y P@ S P@-  @ F @ ;@ @ : @-  @0 d@ 7* d@ $ d@-  d@D- B  @ @! P@ 7  P@  P@#- P@#%-! '@ @ 7 @  @)-ܒ @+- @9@В P@,ɒ P@   @  @, 2H @ d@ -@ 2@,  @ 2@ ,  22H @ @ d@- @~ d@#-w 2@%@,'@m 2@),+@c 2@9@,@Y 2@,R 22H{@I 2@ ,B 2@ < 2@ -@2 2@,  @( d@, $@ d@ -  d@- (@ d2H &`&&㿠&  @P.`.-`&`/ %#\- - @;B @  @5 O 11/#48\ @!9 @`@ @ @ @ @S@ 9H  O܀ Ƥƶa!O 㻠 #\ F@*  1#8`6`@ @3 2`  2?10?40`  3p?3?`㿠; Hb̐W`W`#\ת 㿠. /'#.c;U@b̩,W`W`,`@  @ p #\׋@;bO` @v. +$@c, S)`) ``2@h @;>b`5 0 4 2? 2p?@3?6 a 40? 10? 05 20? 2?@{ "@T T T 8 `= @&@'  @"4 20?:T  :@ @Z4 0p?@*9" UU8  @ #c@@3 30? @ΐ d K&H T #a@3 30? T +# ca@0 3?T T + % :  :`@+? d <@)? 2?v    Dz@5 2?k    @@7 3p?T T 8 8`&@ `@7 20?H=1? 1"UU8X  H$ ?##@ @ 1` 0? @? 10?0 V d K@/?5 3p?%    v@#/c@@3 0? 2? -#@ 5 @ 1`30? 0? @ & d 2@   '?L@@ d U@##ca ?@@,  d 2@,   2@>  =` @` d ` `@!0  @`@   @ d U@    @ > "@  &0@@"@7      ,@ @``*`` ``O, ,@+   O, ,@.`` O, @   333$D8\<`$@3333L@0d  !"|##$$$%D%3&d&'H'(())*t+0+,3-03.X.33../3/0 0X3 0h 1812 2 H p 4㻀 b̑. #"SR)``@b̢   L 4 0?`"@  @ |/T.`@/ `` 2`@ 9`@) "N@"ȋ.`  !@"*S%@S.`@ d&@:  .`- %.R&R(  d- @ ې d&@  4@ 9  G "@ 1 `@ @ @`$ '+`(`'`,'''``$@   F@  `@ @@`$'`('`,'``@"TgT=K 3 8=# @ @ d 2@>+?b5' ' @ '@  @@ 2@  M`@H`@D1 H@=``@9 H`@2`@. 2@ /@  @  # '*'=@?('@  Mb@  P' T PT! " P 2@  I`@ ``@ `:` @ :   ` `&@, d@,5/g ;  ?  W%``Ѐ`_@ *`€ !F  `@/LO`C` @ aa$/<O`C +#2kO`@ Ӏ @ 3/"cD ΀ Fn  `@ch/  x/F``O`@ @ ).#  FI `@.  ,. " O`@ @ 1.ِ L  F%  `@ `p.ђ  `.ʒ``O`@ e @ c7. ` F  `@.  .ؖO`@ @ @ >.  ; Eے  `@a. (. O`@  @ 3.jaH  E  `@;al.b a|.\ O`@ @ ).E! 񀤠 E  `@c(.=  8.6i``O`@ р @ 3. c` ̀ El  `@c. . DO`@ @ )-#  EG   `@-   -O O`@ { @ y#-ʐ`4 v E   `@ ``-  `p-O ``O`@ J @ H7- ED D-\ :Dے `@ h-`-1ڒ   "DÒ `@-p -j 1’ o  D `@;`-X `-R 1 W 򀤠D `@3`-@ --: 1 ? ڀD{ `@0-(T !@-"TUU<>J 2p <<`!@@ @&@+  DV `@aT-Td,T UU>`~I 0 >`@='@@@&@  D1 `@a|,ޒTa,ؒTUU<~H3p <`<#@@&@  lD  `@,T !,TUU>`>J 2p >`@='@@ @&@  GC `@a,T,T UU<~I 0 <<` @ @#  s "CÒ `@a,pTa,jTUU>`~H3p @=>`'@ &@"&t O C `@,LT " ,FTUU<>J 2p <<`!@ᐔ @!O * ـCz `@b4,'TD,!T UU>`~I 0 >`@='@ᐔ@!*  CU `@b\,Tbl+TUU<~H3p <`<#@!  C1 `@+ޒT "+ؒTUU>`>J 2p >`@='@ @!  kC  `@b+T+T UU<~I 0 <<` @@!  FB `@b+Tb+TUU>`~H3p @=>`'@ @! s "BÒ `@+pT # +jTUU<>J 2p <<`!@ᐔ @!s N B `@c +KT0+ET UU>`~I 0 >`@='@@ N ۀB| `@cD+)TcT+#TUU<~H3p <`<#@ - B[ `@l+T #|+TUU>`>J 2p >`@='@Ȕ @   B9 `@c*T*T UU<~I 0 <<` @@! Ē sB `@c*Tc*TUU>`~H3p @=>`'@ @ Œ RA `@*T #*TUU<>J 2p <<`!@Ȕ @  0Aђ `@`*~`@0*x`@ m>`|I 0 @>`='@`.ƒ s A `@7L*\.`.``\*UА$ i D 󀤠A `@t*A.`#`*;.`#3  =  K & ՀAv `@`*#.`*.` 7`@>` -  AX `@  *.`).`%6 v9`   A: `@') ) .9  ϒ ~A `@#a)̒ )!,)ƒ .  2ؒ  bA `@aH)--X))p.`@08` 3 D@ `@) !) - .`@ *@˒ `@7)x a)r .`-ɒ  ^   T`2@C@ )")YԐ  0S`28` @-003`2  7`4 900#3`2 c $c   & TT@- %) .p0804+8`@4H4 U"Ԁ@@ h"@$) €@c @7) <#bh)  d U~@("(b KM`@  s  V`V -I @4 @ (ݐ"-(ܒW d U#~@(ΐz(ɐc, -&  IcL 2@  ?  T`R9 MM2@  3  SV@p  H``@ '  Q T@   U P@E? `@T(1#d( d Rc~@(+ ,ڒ 5$?Œ `@7(r#c(l d U~@(^#  , ? `@c(Q(KƐ d P~@(=(逤 , ․? `@3`@(0  \(* d Wc~@)( Ȁ ,w Ғ ,r  V ^^?[ `@ `( `( ,Z UU>`~K@30 @<>`&   ?7 `@' 'ޒ ,6 UU>`I@ 2 @?`>`!ڒ Ò r? `@ ' a' ,  UU>`>H0p @<>`&  N> `@'  a,' + UU>`K 2 @?`>`"@ { *>˒ `@aD'x T'r +ʒ .`%1 8q Z  > `@p'W a'Q + V 񀤠> `@a'?.`'9.`#6`@ ;  3; ր>w `@-'$ ;a' +v  " >^ `@a'  ' +]    >C `@7& #b$& +B UU>`>J@ 1p @:>`! >" `@3b@&ϒ bh&ɒ MI@;&b; d Pc~@& 0  PX@א R= `@ "& '& IcL@&c  d S#~ @/&  w &=ǒ `@3c,&t cX&n MM@;&bc| d Pc~@&W Ր  PV@H = &G L` @ &;c d R~ @&0#   UP@.`! Ѐ=q `@& -$& M#``@& `D d V~@#&`X   TT[ =B `@p% `% `` @ `%ߒ ` , `@~-%Ӓ , w= `@;`%Œ.`) %.`"T*`T)p0:04.<`@@4!% a$% @3a@% aX% WbԀ@ #%# `@31!p,%-7<͒ %}  !<’ %q -< !%e   < %YH d< `@ a%L b%F MP@%:" d Vc~@%/b0% Ԁ $bP;;ܒ `@bt$1"$ `@#@!7$r; `@$l$f `@@$U#@)`@ %``/ @& @. `@`%`$/&$@. @ %`(/@&(`@`. L⸀ "@  V;c@6@ `6  * #*  $@ @  @6Pc `"̕(*`@R @)` 2 *`0` @  4@R* +`R,1`PZ*020(`*`3  PP@Y+0020* P2`1 @20? 㿠;bO j@. !@+ S -(@` @ 2@o /̈@@@P P ((@@.,&$@*,@@  @@ @ "Jk @- -< @ $@` @9 #8(@ @ 2@4 7ĺ  .H ,H @ h @#d%`h %`l%  #l @: 8a!Ă`.SS'@ ' @@ - H -''  @@@ -+ #@ *.@ R `@ @  &O؂ @' $'@ @; ; !@ ,@  - ; ; &%@ 4H`- @,`g4H`g`b0@-` @ &`  &`  &`&` &` &` &`  &` &`  @ &`  &`  &`&` &` &` &`  &` &` @ &`  &`  &`&` x&` &` &`  &` o&` @ &`  &`  &`&` b&` &` &`  &` Y&`  @ &`  &`  &`&` L&` &` &`  &` C&` @ &`  &`  &`&` 6&` &` &`  &` -&` @ &`  &`  &`&`  &` &` &`  &` &` @ &`  &`  &`&`  &` &` &`  &` &` R R`c+ (@ @**  `  @1 ?2"2p?П6 ;#\+cc$#`,@U @U "c*`*`& /  . # +` ] %Lc@UU /1#.$,.&-`,`  $RV@ @ @:  2@ U  d@.H U @+0M :p0 5  @$ @ , U M 5 `@` PvҖ 1 @` \WbԀ@ c$c  @ ,U @ `@. # @ X@4H @'-  M - `@ Pv  \RbԀ@1"ch&c `@ @.# @bg8? K20 >? % l`  @ #-  M - @ Pvk ْ\RԀ@@7c(&c @4bg @9`? H0p >? % <  @ @ #@ - ! M - @p Pv;   P;v5 "a$p \"RԀ@-c&c  !@ASᄀ`d@=%@+ (9, #/`$ &@. @?@ W `@ $OV!O@@ -@}\@ M  @A!$\@7 `@ #E @8 @  d @1 M `@7@$ #- @  d 2@ M `@  $#   d K@ M `@ +$#   \@ # #h #ax##pធ#t  #x #|;'';@/ #l#d#''܀"@ _ س* V@܉. 8QQ.@ @ #.@4. "*@ @`<@䀋@ ##l@ # #d+`0 x8  ` 0p?@) 8#x{` @w`/@ `0@s #h2H  # @#h` H`( #tF|@bgU 8`8K@30 9 8#@ &` ` @0 (t@ @"U bg; 48J @2p :8& ` ڐ" @Sa@ bH`X @ 4  #|#t`@|H |`H   d 2@0z 0u x8@ ` 10?*8#x @y.@+`c4& #((@ / R @)@( "& @ @ #]h#8@ @`@ @!\8 `(03  #S@6@@@ M `@ $#1h\ #h #)h @ M  @5$ #h@N@F(`#+`` @ #h #pqM c@Q@)@@!(#*`ܐ@  c8)` `@  #h#/   #h #h #  #h #hwM  @HT@   @ /NU`@; 3 ;c@U@`@ b #.`/@+075- U d@, @ 6k P 7  \ Ps @@ @ @  @  @  @ @  @  @@ @@ @ @ @  @ 2@- @2@)@8 ` @ \ߔ8RK 8vM\#, #8  @ \aʔJ, @, M `@  c8  @ a\,  ;Ok.`!x xh @``&O-L`@   x\@~  xx  @ b c@!cb&M @7t @'@$|`@`!$@`@$@+ $O @@$p @ @$l@@$d@/$h@.`@+ @'M - @" PrÖ )!1M 5 @ Pr  " \PԀ@@ #($#bK`j @2 * c@c  (`"̊ `Q Q *` ` (* @ (`+`"(  @< @ @Q`8#* *`8`#@30? 㿠9W!´&@E ;3b1 c#L⻀@:. %-U `"@.%  &H*%  -` (" d- `@`@U U @ @'  8,@  @"H&&6O &6OU 㿠; `` ?`,?  @"``)`"`,`##@%#&@/ ?) ޞ㿠. 7`ِ ? Ձ* 2 㿠͐ 6 ʐ`6 ǐ`6  Á㿠N `@`հ N `O``΁㿠V     V   V   V V V V V        V "    @/00w:00;a㿠V   V V V } { y w u  r㿠. )&@9"-# %-`rToT mT kT \ Z X V T R P . M @/` `F`  $O`R P N L J $H (4 `F2  / -* "#@ +` I 8`@I 9 @  `㿠) "V   V V  `@    9@ $&O 㿠 ; b;b   >$O    O !b;1 !a"Ƞ  a`֐ '#'''''''''''b''ؘ@''#@<  K >.$ - @@$$ `  $O`   $O  ``$O 'Țt @@$   " `@` .@"  $O`` ` $O  |`$O` s`  $O`㿠;}a  S``;O 㿠;pb;b̲bk!h`h`?`< ` 8 6 ` 2 `/ ` `9U `6T `3T̮ ,P`6O  "̴@ Q BO    O 9"̲"` ` $`(`U`U`*`U ,`.`T0`T`2` 4`S`S`    `S ߐ ݐ `RR`RT`R`V`R ϐ ͐ `Q`~`Q N`PP`PX`P`^`W``` W \`VZ`Vb`V d`Uf`Uh`U`j`U l`Tn`T|`Tcx`T p`Sv`S`x`S r`Rt`Rz`v `t r p `m`k i g  v`` O q >#!mbk i g e#;`bN"JbF" bI"=:DZa|cW㿠;aa2`  @4 3 ` ` !  *U (U &U$U"U  U0 $ ( ) ,.04 &O 㿠;7b1+ W`/00 200 ̶ V .p0c8200"U-0ޑ200ܐ Bڐ ؐ ֐  ` @ @ @ `      $O`AO @  c4    @ @   `  ``$O ƀAO @Fː k Raa*00200U`@'ⴲⴰ  $U $ &O`S¸‘+p0l200W @)##  ԐW `&O 㿠@+ 5;091'!/-'b+)60'. %#@ -!< -9 -`6 %#$DBa2#*0.: 8 )=Bț* 3`Jz`@(@ ( ( @/`9`5.Z*00200$ `(< O !`@ $` Oa`  @ %  `@O    Ԑ  ѐ ϐ Oa ː`@&`     @` *  4  @$Oc 2-  ̤@U!1O- @ b̰ ?O ̄`Ā`?ObIa @ Q  #HR@|,  3`$ #O?)o#m   !<`K`O)/M`@;dec79a# ` @  @*ഄ?0 3?㿠;@{'`Ē!@i@,$@o3a/ @\%-`@7@@ @W@H ;/aD @M`@< 㷠;a;$@*a@;N@*@  -`9!ה$7@*z@$751/? ;!+@ -`-]> 㿠@*i@*j@;b"㿠;@*^c @;b4*`; " @4 J   ' @. :@# /@! '@ \K`\@`H``@H`'@`+``"H``K` O倡 :)`" `+`: +``"``@ `&OJ )`"`*: `N @   @ `@ # @ O` :@ R @-`  @ @)  @)  @) &@ a6@ .!#`,`@ +D"@԰ +E K@-`x  @ @)ɔ  @)Ĕ  @) `&@ a @6@ .` "@"`)`@ (4"@ (5 F@+`J  @ @)  @)  @) &@ ! 6@ `. @ ,"@z , L@-`  @m @)o  @)j  @)e &@^ '`6@X / /  (`@ -`"@L -`  S@!`  @? @)A  @)<  @)7 @  `]#].. E@ `Β  @ @) :   *" @) ` @ "@  9!p/@ A@a` $ P@ ` $1 C@-`  "@  @(  @ Đ q$O "@ְ O`2@Ұ O)/` a@-@!@$ V@/`j  @ @( ! @ Ē @(  ."G/@ @( H/@  @(  bI/@@( J/@ X@ `cc "@ H#bȞ @+ $Ox  Y@ -` "@ ߒH  5 Ȯ`@- $O \  W@>`  @R @(T  @(O  @(J '` @   @/   #t`"@6 @ !"ȓ/` +@@@  !@  3 bȥ/`-!@=@ $@ M@`Ē  @ @( ĴO @.0 200 㿘  -/'M ` @@!!'N ` @ 'N `@ 2O`[@qW@#b!@'@ 'L ` WO*`L*`=``@/+'N`$@;b'@9"O@O "@ (`@zO!"@ )' lOb@-ȶ` aO/@)"dWObSO 'iJ @'d3lΐ@$+M @%bpO]@(tbxKJ @"HI` @ O`]O) |@$J @"O`]@ ∦""J @2HK` @O`]O) 7|@$K @ӶO]@ "bJ @d"HM @O]O)  bS@/J @bO]@ԒJ @O ]@bƒJ @0"HM @O`]O) +b@/bH` @uO]@yH @kO]@oJ @@&!6HI` @SO ]OV) b@/J @BO`]@ElL @7O ]@;⼐^J `@@%$HM` @O]O") M @bdO]@<N @O]O ) OI ]@b) : `@/*'O.`& 㷘;c U@?$ {$@S 7?ᙦ  `O@BO ` @ @=O#@:=O?@O :@')T#2 3p?%@" @O%@@"H/1#,  (O` 㻠;$a @ ;$a    ,,,,,@@@@ @  @ *<:  @x  @-* @ @  *#H *cL *T * c\ *cd *#p *c| *ㄊ *㾰; a;c ?9Z "1?/-V )'# # J 㠐  D %!U` # # 8 㬐  2 T`ؐ# # (  㸒 ! bS Ő #   Ē  bJ!`@ &` &  ; cВ / N@` &`  &    #ܒ  TT@@ c  Ֆ  ''yc  ɖ   Ö 9" $ @@ d    -)-X        b1 E`    `  "R`2@9-` "X@z7Š!\@ 8I0 8<%#$  s  ',`  g ˜4  `  b#%;7 <  P ̔g``bě< K@ 30 > < %* / $@#`D`P  6 Xݒ  - b̐UnUl@#`’  l   tƒ    bQ#hQ#j@#{|   `   cH#|S#hS#j`@#`U %-*`$ ,`$@`N8 @ `U U U U ` @#D  1ϖ +`t`  Ė #Hb U#h@W 7 ⠥/`$-$@ `H8`@  `W W W W  ``;@# ”`  9 `1:   "̐/-+V'%@" Иؔ  z !   p b̐U#@"ؒ  e     \ Vcx+ @ *@"a  K a  A  5b’ HW#pV#pW#V#1„W#~(W# W#@W#zW#|-`W#%+W#)" 1__'u a( _  ?’ !,9  1b 4 _  ?² a8   1O D _  ?’ aH!  1<  aT _ і ? ’ !X Ք 1* wd _  ?’ h Ô 1 eax _  ?!|   1 Ua_   ?!   1 Eᘒ_   ? H'"#b ˒ "̒  $""""`" (`4" (` 8@ "`(<@" \`@ P``@ `"`㿠7 H7 ⠸#`Q@ @) `#@+   6`@ *`-& -L  4J 5,8 +:8```# $$O p#t5º`L#l1;#\tc"#p9 #` H #h #dh` l 2 `#xd `t@ . p, `  #``@9   )@cH&А6) @V  @ @ –@" ۔@ @b єⴴ ɔ $`#OЮ , cH&6 * @U @ @ @-’ ´"  $`#Oڬ  b@ `@ --@ +’b    @1’"  w ```Op,T\.  p,   d  #` H&:4+ @U @ @ @’ E " =$`#Oڴ  b@ -@   b #` `O,\ x `xtlp#t3`#l` #p$OtP;’ b9    "  7’ 5  ,  1-`/%  "   (  !#` ܖ       `  Ж ’  Ԕ Ob`@ ’b b @W``2@"`->`gK 2 %>`>`&-   9  ’ c   bQ ,Q *@     ’ $  bW`2W`0@#(   ~ P; c0  u /; c8  o 69 #<  i :7 @  c >5 D  ] B31cD#,%  ̠@T#T#@@  T *+`+ M *b̦T6 v@ cL C -1"̬U6/)l ' , /(!ªU@@#P   6ࠐ,T@@#X   :˜@S#(@`   >̐@R#l’   B b̆PP@ l   I `O%㿈; ch  ߖ #  #`cH  $$, @,@ W @ @  *@ 0- <@ @ * @ @   *@ @` ` @ 0-=`@. "H  s `@ . `  s```OĠ `$#O#     ./@@  slO ; cx  m   㿠  _ @;c  c 95"V   O i㺨;7a<$  &@W`cْ  g`"@?55@#?%"7`l$ @|  _^dO^  N.``O_L` @ $  @ H "O$  ’#Д,@W``Oܠ ’c@O"M⸀@#°0ºc@A`4H   @/`>`)@2&`*>O’@(#bTʀ@$)’# @ #`#H  P $) -Ô @  cH,ߐ@`$ #O  Ò`@7;  @cH V @  P $ ,Ô< @cH,$cH&OVÒD@ؐ @) +Ò`H``  @̐  P @   #Әa@ , $&O  Ò`h@#!`l @#cb"#@+bȖL@@`-Ò|@```$O/ð @9㿠N @  @/``O` O |#\@s`@o`@k ///// /@/`///&$@C@ `O#@  &OK ``/ @ $ Ðϒ @ ,$Ð`_ a'$ల@ $#Ð`J %3r$`IJH !æ $ @Fʔ2@r   ܺa @+O[@O ` @$O]@!O @O #0- @ O<@@*@O̐5@. ܬa@O[@O `@O ]@O` @ O ! 0(? \Oݐ#` !#d  6H @ '&䲐"@}  @8@  U`耐GO"`@[ `@@Q<@F}@ @}@`@ `@ }@@B"H,` ?` O` @}@@-@@}@%  @O`% @O``@5Q`v /+ b(0   @#Ð, #@ ÐaP# Ðah#} H* =?@ɀ!@7 2?  &@Ð!#`g ` P @ -` /@)Ð!#U  P@ #`@`B P #@/+Ðᤒ 9 }H@@a}H@r P@f}H@@t` %@$ Ð!!` Â|@@k|@S P@G| @ \@>  ; =@_@5  2 @ "6  :`@)  & -@ #` @   @ @+@  5`@;@   @!   @ d `@-J @    \"H O6` 2? (R 㿠b;Ða̒  v k9"Ȼ. "ȵ?`J `@ 1J /ú!ؗ*` ` ` @:- `@ _+ J`O*`, K `@#Ð @b@75+bȐ)'  !$㿀;b;H b @9"=  㿠l;bbb @ !L"<2H`%DT@!+Ðbt ! S)æ"  ,8;8`@@` .-`."`-⻲`h@]㿠 7В y;Ðb  M;b̐!h@H@=@ -Ð 1Ð" @145/ðah@-bR  *#@ +  *`㿘@ 2 )%ù?`# "4#` b0%#\@;9ôaԖ#c$7(@$@  $Ob @ bQ 2@ )>`g K 2 !>` > %-`@@ 33#,b$ R 1Ð#8-$ H $ @ /%!`97Ô~$ 0 ̺``T`@#<p$ " `$@#Ha$  @ycTR$   "̐Q`@j#\C$  ̔cph 3$  @ @Lx%$ ה 㿠;a<cH cH `R @  6Đ6 . # $$O` @ ` T @ `66  -` $@&O`9"c&cx;5a<)   r @s)"Sʀ`@ /++-c  ] @_PbȀ`"@   *)aÒ | G @I @E@C3/cp   @ @( /` -`@_@#W ` P  ``  - ` @` $@&O Ӓ 9  @ @O㿘;53ĸ b̺`46. @5H-`-  @* . 2O+ bɞb מb  ;b䀧 @? @?  @@@ ``cO c㾠;b䀧 @?ѐ@?$ @  O, `d%  O$$`d@A2@9?@$2@/?2@*?$@  O, &O$$dOؐp@?vH?㽠)"䀧`@}#h#l@` &H Q @q`d@  d#ppL@``d&Oph@l2H`@4H@S #!##|%+#/"8#`TX#a #tᙬ #x#  @ %Ēt@j  ( @ h #@%l`"@# l'@`@   `O/@ ?#h #l$$```O'@ #l?#h'`  $ א@p@@ #@Ͷ@к@ظ@Ԡ@O ` `@`L` @ L`` 2O`O @`@N @@ N` 2OO `  @`N` `  @ N`` 2O`O ` @@ N `  @ N   `  2O N@@.@ @ Ĕ`@."* ) b Ę #`*  "@#d#\Ж@ ĐՒ@L @  Ęb@@  @@9Ė  @ 7Đ@, @ Đ@#\a  헚@  @  #2&Oht|xt .p88p8@`#O㻠;a;9a7$5 >'"/eP - ?)a ? %! 'ĐԒ  #  ;b䀧`@! "b@ "Q?'$ @ -F?+%` 5"ȶ N! ! @&OM`"@%` Đah꟒b@@ 3bP%?" `b @`Ē|ꋐ!h@ '?%$  @  bbX9ݒ { 7@"`/5/1-@/c@"/@`̐@ Ȑ@"@` f ` @Ȕ m5@w`/+' #@n` @ib`U @d`T@_b`ĒT @Y`S`@S"`Ĕah@MB @ *971'  @  P? ` 㿠4;b䀧 @3`@  ? X` @   P  7J  &D1##R ;b䀧`@/H c4"`9 7@8̲ `@ؒc@ #@Ғ#H@˒P@ȒcX"@Ē`` f @Ȕ m9@#d`5/+'#@h`! @l`U@cp`U @t`T@cx`V`@#|Ē@F @  ˔  ?Ŗ '`` 㿠;7b9/&%'Đah7`%@k##!;V 6&$@t&㠒  "  c  "#  Ē  Ē c۔ Ē #֔ Œ є Œ ,̔ Ő`H ǔ Œ ``”  Œ `x  Œ   Œ  ,`X`  9!%&`2P;bb @@&!(U ?@E ź`ؘzX f@# M@ @? F@E IGBN@n V@t XG4?>ט v@ f@% iHP mG̘@"+Ę@S xG!_!<G)%"ȔT#Ŗ  Pa\ PGO`GO G @1!h3a^y@"q4i㻠r&@>9W!75Ė13`7!$3 !&b"M⸀@!+Œ ͔ ( @+&+b#)Ta?%"$@4a㿠;Oa`@!L!DH-#-a+- a)  r "T,@ ,3/@4b̐!h@@97!@A㿠;a8;3`-  ,  @2  & *5`$%8㿠9; 3a8ƀ Na@-MD`H;罐 ;5Wat̸`7atNb@" Őah@" @A礐b2-Rt`@%!Őah@"$ +"+"++"玐4-`@ Ғ    'Ő @ ? c-`@ 뾒 -+`1&!8㿠;`9@ O!@#LaD H X    /Ő X ?-ʖ  - ?Ė -+b̨ %Őh4@%@@  -1Œ "? 3Œ b? 5Ű# `@ ``$ 㿠; ``91/@  $+ƀ   @ लb@ŀ   Ā @   @   € @  @㿠Z d @: "2?@6 = @ .`'@>F`: >#@30? 㿠;bW#pW 5#@ .-@*!  a@.c@b. .#c$㿠;bW#pW #@ .- %@@@6" a@7p .b@3gc4. c@ ^H. @`e@ Tc`.!ŐxK.#@2 :`㿐V-b/`$/`,$@+- b "  @.   ^@+@@@%  @  N@) % @@ @@ N@ `@%&H @@ @ N @ ` %&H @ @ @ N@| `%&H @@7 "@ 7N @s %&H 7@@ @N Hk  %&H @@  @ NHa   %&H  @@@ @m;N`HX  `%&H @@ @^; @Z;N`@S  %M @@ @@@ &H @@ @+ &H +@@@- &H -@@@ &H @@@ &H @@@ &H  @H @@; @ @ @2H  ;@@@; &H ;@@- @ -N@ `%&H -@@  ` @ N@  %&H  @@@ @ N@ @ %&H @@; @ N@ +%-&H -@@  @@ N@ % &H  @@ @ N@  %&H @@; @ N`@ 7^@%&H ^@㿠9"̪"V RV#V V @>`"H `>``"gJ 2p >`= %TV@`T ZH $`>`bgH3p >$`>`'@`@r#\.)+ś+ -Ť#4c ' #@ *b4 d9@V@L@ @ <D   0@ 9=8  +"@- `@#V @ @  @V ) !@(`$@K`8 @  c,l Z +2O O\`ƀO㿠>a2@  `@/p0 `:00@  =@  O` g"@  `@ =2OO` P. 9@"-/`%>X* H@- P  ~(㾨+cVV.@-&@-,T`@̠b"ȶ   P@  .`  (mU  ے `d@U`U  a   (?- {"@`6- K`@=А@ `HC 2@%- "- - =@Ɛ@N- `J C @  Ɩ`\J ؐ@- b- :` O.``K` @@@@,` -Ɛ`ഁ#9;`!А 'a  a$  @m9 !( %` $2O .`  *`@ŘU  3  d@ U ޔU`c c ` c c(- Ӑ"@`- K @ Ƣ- - `4>` Oĕ.``N @@@,`@ + @ Ɛl/Ɛx㿠;bWcvWct * > `\L8㿠.  + -c4#&b- # @/ @@';[aL[`@)S!( `  ƒ`U `5`-b97=T"H[@ ư!l5   ưa*!J[`@!"!ưa { 䚐 d 2@);'b . 䐐̢ T^qY@!Á-/ Mc[@b<5ưh T s d 2@$. 9j bQ`^q2"HH@Pz@ #. Wb̠ V`\lɐ@%̐"%ƲƺÐc8.   -   7  @ζ$` Q V  $O` ư dc   ưc@#L  ưhv }@#cx 1ݒ 8! 3bT P`my%ưnې }@ )g# 'Ò  ׁ+ưcZǐ }@ /S -   Á5ǰF }@ 9?  7  ;ǰ`82 / XHL`@F㩐 2RR@`k! |KcM @4㗐 %T`V` kҁ+- bM#H@"7Vz@【 P`\@ k` bI#`@ n bS TlHH. /7)`%% ) .`bP@+`# + V. "@. * @%@ ,`- @ 4 PNJ L@%9 TL@ @ VbQ`X @7Uc @ HbSp`RpR ." 9"S`X @V@ 7+HbV#p#`UpU(&@@T ̴ 3L@uTǖ!0 V@  # Hcb`@ : 2# 20?/ ;V VV Qcr@  Jb @ǐ2[`sh^s`@[` Ob/b怣@( @/b倥 @#7bOb瀤@[hOb怦`@ @/b倥 @7b 7@`@`Z1"㿀5V#\`` @`'+#l-`Z#`m #p\ ]T Ta #h/ #dឬ[\l +`#tPP #x2(`@) "*. @R `@ *`! *@K "Hx x$"@ `@ % 2O  x#8( @@6x)`4 (@)` @)  @&  >@. @ N Q H K`P H @`H倠`@/l@`)"*l@'`)b%l`J倠`@` @t#`l 2@  `2@ t @h t#p ldt `#`#pl #l1`$Ohl`@f``@Ԁ @``7"`5"`;bLS@ b J`R`@``2`2"``មa`,`RR @p@ LR @`4b`4```6"`7b` MS "@ `"@ "H ``5b`5q``Hb倢@u`T`T` `\@0c8\  !ឆ`(SS *`   @*` %*`4" )` 0@`K瀣`H  `K"怢2@C   O܆`@2 \ @ថ@ `*`TT-` @-`+#4 +`  0@`Mb急H '` `M瀡 2@ '``Oې@``VbY2 1p? 㿠@5#Ubꀥ2H5bc`%c UbN@ ;bUb޸'` dUb5bڲ 5b/   M㿠;/b4Q Q / @.`&. @ @ǰbJ!`@ǰށ5Ǣ d1"ڔ  ! "R**⻚#2㿠;/b4VV/ @.`&. @ @ǰc8!Ǣ d6ڔ#X ǒ  R**`2bQbꀣ @  dc# 1b1b@ !c1bb`@ (  @   (   *  @c*# **`P`@+`" * `@Q `O+`  x.-?`/ -W @M  +( W < 8` *`@$&)  @E5a<ܚ#3p?@!'ݺ d K@ 1f2@ & 0 "@&?&1O 3' 0ڔ @&?1ЖO 35 . W ;`@$ 3!3#bV +# 4a7 #W㿠./?`ⴷ/ .@T  @u#c4 `@  = ~cQ `@ Ӑ# 0 ~D `@ǐbOcH@'Tz @ : 5 U\ e`@  H``@ ` &  "RT f@ ` @ ȶ `(@ &` TOƖ  $O``@3`P1)| p 4  ג ~1㿠./?`ⴷ/`. @V @) 7"TRTz@ =5̀V "H TV=TVbgH3 =>%@@=TZ H =gK 2 =:!@ ܼ d%`&H @ %/k 7Ŕ3 bM t@9 ̐ + 㿠7-̻.?`TR/ Tz-@)"̀"H TV=bgTVK@30 ==%@@=TZ"H ="gJ@ 1p =?`&"@VV- %%@, $@@ K 8@ ̐`V@ Ðc4 @ ︐ % &H 1 d@ Ȑ<充 k+VV 6@  %  @  %|3 bN t`@9:!\" 3`# 2?" 3`# 2?" 3`# 2?㿠.7?`/-8̢4 @2 9aĺ! Q`U`% @@W`R@ '  @- @ @-`) !@(@ƀ"@`&  &``  `$O; aĺa`@$T S ' @@W`R %`@/ `@/ `-#+` ƀ "@ &  &` ```O؀`㿠.9?`/"̦ @B 57Įa4!S US U@ k@&* `(`S`"@ ` @S`/`#*@ $"@H8`"@ &@ "@& &```$OĠaQ`U Q`T  .@ * `+ R"@ & &` `` $Ob̖ S`S`p"㿠;c8. @a . '4-`%- @  @/@3ȁ 3Ȑ a  㿠ڒ@ . /4( (`@ (@ 9P!ȁ !@b̐   9@%뀐  R RR#z`@ =74 "H  = gK 2 =<$@U`V @ W`ZH =bgI0 =8&ڕ d& +`%  &H  @ 'Ȑ % G  @#i} -M`t @;b   㿐;b;bO @-4h є @@:5x@i +aP aRP@ 'P@9'* > `@%@O d4bxǐ@-!T (`VV'T '* <T"ꀠ@ ##  4"4"$#c-`,%,+`R @ /w$ `@ * >` * > @  㿠;c8. @R"D . '4-`%- @ #`@ 3Ȱ ?b\㿠ޒ@. '-`4%- @ @3(b| ;j b;&]  㿐;bO` @b  @u9"3w@W#̉,aQS aQ 'P@'@C7̬ d)5bx"̀@Tኵ(VV 'T@'Tꀡ @ +! 44@ $c.`-&-,T @ 7캐  w*08;8`@  㿠;c8. @-자 @ 5Ȱ 앐ԁ㿠;c8. @@ Ȑ /8%#  `, `   "" 㿠Œ@ . 9#4*'@ *` `<@Y" `8@`2Ӑ&@ (Pc@@ @ 3Bc1Ⱥ <#<@F'`2@ص# # bT#@ @?` 3 # 30?7Ⱥ 㜁؛!+ bU#@@?` 3 " 2p?@ ./`5|9Ⱥ #`1@-`0;p bR@@V@ a d @Q . 8.  @ @Eΐ ɺ Ȑ @"%C$̠ Tc@@ (@ '볐4)ɺ 뭐 T- d @$$5 U㌀@@ @ 7듐x9ɺ 덐 㿘vx@Q'+̵-a!VR!RV @@ ͒@=` d6bv`@U aaU* US@S@`@ .5"`5 %-.`&-.T`@ ;E`a  ϒ*08;8`@  㿠;c8. @)`ԁ . '4-`%- @ @@3Ɂ 3` 㿠ܒ@ . !#47, $a,`VR *`@Vz@m"H   ?`gJ 30 ?`=%@VV@ PZ`H ?`"gJ 2p ?`9` T d'` &H  @-ɐ ˒fH 9#8.  @ ,@  `@  70 @  7ɐL꫒05N`t @;Na, Ꚓ㿐;bO` @+bH ~  @ @ @/5u`@k̉, Q ;S aQ 'P'* >``@"@O d4ul@/aT`ኵ(VV@'T`'* = Tbꀠ@ %c 4b4b@ $c-- %@,+S @ 1!`8 `@ * >`* >`@ V 㿠;c8. @a . '4-`%- @  @/@3Ɂ 3a 㿠ܒ@  9Ӑa. #4%!( F Tc4(`@ @% - @,"  &H ; d@ 6 d 2@ ɒ ɔԐ 鹒 bc "c d/-̪T:T @@ 97鋐"  VT`^;a 㿘tg@O)-"̵-#V"SaSV c@;` d6bt|`@V" !V *V P P@@ @ .#!6"# 6"&#@/.`'. .@T@ ;4bPN@ y 㿘t@t7̅.P 1W !W  P#8@ .@ @ @ ./4.`'. @  d3"t@Wb-'W`-W`T@T@ @ .c7b& 7b@'c@+#$+`. Q@ @$ 0@^* < @]* > H ;ɐ* >H  谐b<   cHR "@ $ `H$"  $OR 㿠;c8. @茐bP . '4-`%- @  @/@3Ɂ 3wbh 㿘ɐ@1m"sY7@a`.!Q !PQP@ @@O` d3bsn@ 3)`a!. TW W T@c.*`" * .P@`@ 0"L@"/ɭ.% ⼫- 4%@,@ `(@ `+`74@@`/@`+`+?+b+㿠;c8. @ @$. !#4,$,`@ 1@+b܁ 0@ 1"M@3Ɂ ېc 5֐   㿘r@ ) )&’?&Ԑ #HT@' % WUbbĬ%b@5bʺ @ʺ  @ ʺ! ʐaܒ P + ʖaH` @@c:`d@ .` g2H` g.`` .`ccc ##c#c #c#c#c 㿘;ʐb;ʔb0 % @"@ *@ H,    )-"-`  @@3b\9 2"6'v 㿘;9ʒb|"  @+`@ *` #H+`   %- @,  @@ 7 @@1Đ"7 26'㾨97ʒ"̔ – @`@ (` @#H.  +`ⴘ + @   @m  P/  %o / L`\ @  )ʖ#͑  @U+ db5 @5b1ʐ#x  @EW 3⠓)`"@) @`$@ O`8@6 @ @ e/   l/  n/ c%c  $ d#1ʐ#0E &@ $Β $$%y %d % 㿘;ʐc@;ʔcX 3 @`@,`)#H-`  1.".@ 㿘;ʐcx;ʔc  @'`@ )`H*  ` !,",`@` @+c79#7`cc &c&c ;ʐc;˔`  @A@ ( cH*`  , b@+  P )  0ฒ'ː\@@`@ -ˑ,0+:00`D\̮ PH\є P@ \7`9"cc &c &c  M@' @  `@S` 30? 㿘;7˸b;5˒X'a| | @Ỳ@ *@ H,    2 '-`ⴊ 2- 2b 1#H5ˮ"VWdd7dGW @@7 >` @ &@ #ɒ?##'c c$q?)$[ $ "c  c6%cc c`"c"c  `"c"c  `'@  30? 㿈;7˸c;'a5˒ܐ  @S"̀@ *!#H ,`@  2 +-b 2-29R ;˴#HPdd*p09p00dΐ`V@@ !#6Őa #߿a0 &@ %#L?##q #?'# $  `"" cH `'@ːaPߕ `@ @ː!p߆㿠h @;˰a};˰ay㿠h  @;˰apx15"̺9Vb"Vba`#h#d @@ /N@@d@h4H˔Ȗ PCN !@< t]˘K@= Ё30 <;` @ )I` @0N`@   ! !@ @ = "@@ @" #\= .H [@% #\= -#`"*`"$@ ˒@O`@)"Lᾒ2OO^^S3'UUt^`* *`@(b( @"**`# @) *@ @ Q`Q @ @@  @ ( `H`((!@+  @*!*#) @@ R`S`@@@ @  #(H`c((@** @ @ @`@ @  @ ( &H8(c(@*`*@@ `8`:: 8!@2p? 3p?!`20? @ 8 30?* * 2 2 ;7`|%@O; ` @`  H@  2OH@ @"@ n H ͐| @` l H ͐| @പ b HJ. |)@ܒ ̐| ށ !!0,``)`@Ӓ `! @_     H ,H`䀦`@@  "R`@- @ @4`%@ ,0`H ,&O `@  3͘``|ƒ    15 | ɻ  | * 51"ב, `,@z #``@   `@1 ,` HH䀠`@#@ "R @#"@M C `@M CO@ 4``#`)  0`H ,&O`D@`M䀥@P`H 4```! -  6` ,&O`(` HH䀤@'@ R @3c`"@ 4``` * 1 `H ,&O`@!͐! ݆ (d* |<` ݑ k@ 7  p@ 7  y@k  H? ! P aT?^{ &aȸ ,` &QF0@0 ͔!0* :r@ 쀤* :`r@ * ;`ဤ@-@ `@2O  N`eOŭ,` |G$`M`e`O,`|  㿠;-ha< ;ʾ b' s @&&&&&& [& PҸ !X!X @ `mУ9g  $O`PܛR ;͐ aD ?Ϲ ؗ* ?` @I c@ fq1@%)%"Ȕ#͖ @ Pac P@ O`@O @B @/1!  h@4 3p?7;=   ?r P* ?  O cQ㿠 ;ٳ  a  `9@!`7@ٖ \|X 5 X#`@A @>,> ىՐ @@X'`% ?&O``@`@@`@pX'@` `& @@`O`X` @@*`9`OȐ͚"#`-ǡ  X(" * : @ 4@ \ 5<`&G% 6@\7`@> =@ X͐` ߔ `! P /@E p@< @9 @7 +@ @@c ` 8@% @# @! n@ @ -@  &@O$ L 2@H &@E$B &@=$:@63@/ ,X ͐"h!`ێ ϒ PG0`ā P*`: @@/`>`ط@ݒ@ ` @*:OG  7P;@ﲒbp;͒bt  P@P;͒b|;H b D 95"Ȕ ǒ P} P@6@-͐ڱ/͐ګ. #`t,   ` `@` ``$O `y$%9 ##⨪  `1͔"Ԓ PƉ`  @"  @  bȖJ@`@)`c`l P`Ζ  O ٍ 2֞*088p8\s` @ @[`@H 50(888 5@ -@ @  @Z "@Y@) "@S@2 2@L 4"@.̀ n@ 8@  5@Z 6"Hf.@ ?"H.@} t@L y"HX.9  "Ȳ@N`@@.`O9@& $@ 9 "@"Gj%@f`9  .H [! \`@$@ =`@%"GO&K`=`@.H X@%@A`.Ȋ I`@3 2?`)`@3` "Ȃ(`@@$@ >"@"G "@`> .H Z& `. "Ȓ *`@@$ @ : %@ "G%`: .H1 ^"`@`-s P`   Lސ`ֈ$ڐ`x  9!"Ȭ( @ @6! ` @``%`O%`@%%``$O%%% % %%%% % )#`7ʹ!#t#\aǨ|1ͦ ##H م   # "H @62 +`%& ?`] O  @& @  ?J   +  #  .@  "Ȅ@@@ X!`O "@  ?&   .@  # .bȔ@@@ X  O .  $OC* 9` @C q@A 5@& t@% ZF@* \R`R`; @ >.` `# , (@&#`i1-ՙd1̀ @Ւ]17 ȱ, +@@a@ @; "a@O1͸ "a@K1; aXaX  @ "@@ Ha*B` ` $O 㻠;a9d$З#в@5́?9@#;@c!# @/`-@אȨ@M @@1Β @͐Β` @ǐΒ@Ð`$O aXa  t !D @(  @+Β`@즔) "ț+ @ -Δ4@왖1/Δ@1@쑖 L@쎐$O`` $O`8 P;a˙;ΐ`P)" '% \ ! %Β x# !ΐ`  `      Β `5   Β ` Β ! Β , Β L  Β ad  Β !| Ӱ* 8@1@ +Βa ׇ2@ Β }3@ -Β s4@ /Β i5@ 1Β! _6@ 3Βa Uv7@ 9Β!z KlW@πw@̀L@ŀl@ÀA@a@D@Sd@QH@ h@;.cd0QΒ "y Ƞ `)`@)  k Β e 0* 8` @ `@' 0` -a`,/H` `,@. H  D * >  O  5Β P;3 b'#Πlb !abȔZ@  &  " * ;` @V `@# 0 -a3Ӽb!aZ@ ¢    * ?  O ֫ Β b  Β "0 Ȕb8 s P) PG0@Y@ֈRHց {u֖㻠;at$7Φㄺ$@΁?@Βc@ Qa @-a51/-#Ȥ+Ψ  c@ߔ ^Δc@Ԑ`S@ʐ@ǐT O+9Β#@꿐u 㻠ѡ ; 6/cNcN* ?``@-3cL. (-* =``2O-ш.$ ?㻠{. $. ?ђ m㻈;5bȐ3O @6 3p?$cԲ@!΁?#)@hθ #@c. ጺ  w` ? //@`/ג$@N/Β$-ϖ@C+ϒ` @?  O)1ϒ @7 ;5bȰO`@7 գ3p?. @F7ϐ ֔ 5ϒ ,1Д !Ϝ$ Ȕ 3ϒ `T/” p վ -ϒ +ո ` մ )ϒ  'ծ Ȓ ժ %ϒ #դ ` ՠ ϒ !!՚ !$ Ֆ ϒ <Ց \* :`@o`1@`29 4@"ϒ H9{ ϒ lv "ϐat  Pֱ PG !|`3@1`4ϐa X ϒ aS ϙ@ɐl'* !!@;$! $ 5 ԱT@./ϒ -'  # O +ϒ a) !$W P@5R$1!3ԃbԲ&`5@ϐb  7ϒ , ݒk8Ԛ`6@" ϐ"L  ϒ pܔ Ȕx` ` P` PG` Hbw`7@.#ϐb Ծ ϒ "Թ oO *@ `@%-\+)a'$!p$ Ԝ H`8@61ϐ"ܒ ԏ 3ϒ b/ԉ ?յ  ԁ -L$վ P@W a͹$O95φ (h@S!O +`'@`9@'ϐ  X %ϒ <S  O `+ I@Oϔ *'@ ĐHg`0@+ϐc\ :  )_ !$t P@ -o$J/͐xC@)5Ъ -/КX#\8#`̬x r!ϐ#  #ϒ c%Ȓ 1ϒ # В  В  ` \ ݔ ٔ Ք є Ϝ @k 1@ 2z u@a3В `7Ӽ  Ӹ 5;Ȕa < P PG!`$ А˒a GВ@В@``@$%8@  @@ȐN E D @ `H&O !#В!X@結ka`\ 3@a3Аa| [ 7В 5U ;А`a ڒ P`Ԑ PGB!`$ А0aG6В@焐В@瀐` @$#7дbbb  @@fN 5 4 @_  `<&O ;!Вa@S ҃"Ҳ 4@a%А  5В @3 b9А"H x P. PG!ʜ$ АΒbPGВT@"ВX@``@$  к!!1b|"!  @`@N   @` @ &O`!В"@ʨ%!P 5@_3Аb җ 5В 7ґ ;Аb  P̒ PG~#a:$1l"GrВ@Вb@漐 a @"a;!c$#`#   @棐N   @朔 &O`9;В#<@摐GcD8 6@ 3В c` 5  ,71#1*` *  NCNEB `D c  ? В ? В#Đ (? ,8 +:8ٔN!`@`@ ϖ?В ɖ В ?Җ А (c?˖ .8 +:8ıJa@`@ Ħ?В Ġ А  ?ĭ ͋ @Vn@##a ! @`#  @ 8 @ ##@ $aBC8 .H Z #!7CN@#a``@" !`@@ > "@@@ #C>  .H% \&3&aCa@`.D CA@&`.DCc@.ECG.&.E,7 7@ #`  5R   ,*$ )  "`0N`3N`5@`2`4 Ғ   ?" ђPǔ ? ђ p (? .08 +:81N!`@@ ?ђ  ѐ`x ? ђ  (? .p8 +:8͔ Ia @@ –?ђ ü ѐ ` ?ɖ ̧ @r`n@% @ $ @>& @!@$`*! + U`C> .H Z@&$`* +H`C`N@% a  @"&  @;  @!$`*# ./`C; .H Z#$`*# *"`C`a@ * # *@* 4`C`A@ * &+,4 `C*`c!@ @)  `* 5`CG &`.5 8@ #` %W   ,+  aN` N`` ` ْ   ?) ђΔ ? ѐ (? .08 +:81N!`@@ ?ђ  ђa$% ? D (? .p8 +:8ԔH @@ ɖ?ђ Ö ѐ L ?Ж ˮ @yn@!!  @`& @ 8&@ $`+ IC8 .H [ $`+ >CN@"a5 `@# "`@@ :"@@"$`+ &C: .H Z "$`+ C@+  ,CA@+  &.  Cc@+  `* CG, &`+( 9@ %d 7l ᔤᔸ  ,(#@.` @@N`N` !``   ?<  ђa ?1 ѐ (Ȓ?* .08 +;8sh1  +[hN!@@ ?7ђ  7ђ ? ѐ (? .p8 +:8Ka@@ Ֆ?1ђ ϖ 1ѐ ! ?ܖ ʺ @ n!@%a`@ !`@@9  @!$(#+`U C9  .H Z!$("*H C N@%` @ "@;#@#$(#@(/ C; .H Y@ #$("*`" C a@ (`!@) . C A@ (`#@&+*  C( c @*``. CG`&`)` ` 0@ 3ِ bcb0]68!17#d35#`bG"HbIJђ P1G "h C 7ђ 9= " 9 ђ 4  @U 1@ 2ݐ   @g;ђ b! "̒  +/bȔԐ  PP PG5ž$3bܐG #h2 єc#l##p@<Ѯ @6h b ` `@ @d@l @#h#\hp@` ` $O ђc8@hh=#@lm 3@9Ѷa#\ ͱ   ۰ +ѐct ?-ѐx7  ?  G`@ѡ*c|3"   ?r ;ѵ. c  ?c c  ?] ; @n@  . ! N@  !`.  k@ * *   K@  - #+  r@  /`  - } R@  (`@& .@ْ o g@  )` (˒ a G@ * "*  S b@  - + E BH /` $ - 7 9Ɍ#̯̎P;@*c;Ғ`΁ P@ O@ @9Ґ G`b"Ȃ< cD @  )#DbR `@Ґ&(a  㻘79/ /!P$5Ă$@i P  Ħ2  O` 0p?` +;`” ` N$OO``@>OĈ@6 y ~2 2? @)`9 O O`@`/  $OK`O  NO`@   OגQ03˩a㻘79/ /!5Ӓ$ @Lղ  EON.OҔ. "`@E`O !Һ " @<y%``N `M,O-Ҕ,@`@#`O 3Ғb@Ґ1K" z˝(Ԓ$@!#"` !!%k` `H @ ` @    +`@`* 2H+`` ``4 &O  / "@` @ `@ R +'@+` `$"@,J`8 @,2O ``OސAO٪   -V@` "@$`@- #*@  $@"@,I 8`2@$,$#$O` @+ 5Lb4H `@ @ߌ A @ g/ P 8 @l`  4&OL;ҐbX  tH 7$@ 7ᬠ`.  `) @U    @a / Ȯ   H ,J䀢`@@ bR @ 5@@5` @- 0`H,&O !"Pb"!TKǔ`@31+-c"t"Юئ'` ((` F`@   ` @@$O !'""T%$PK Y† Ґb@ז V ܐ(‚$@:!` @+!ܺbb  <#@@ $2@< 6"@c b#c  d3b `S`2@@/p0:0' 3`2(c3`2+Ӧ'@3`4,ţb" T`T: d 2@c d-Ŏ  >` #3p?V cc #c #c @5x`9Ӱ"r㿈;``f [@Ӱ,hQ R@9ݴ̀@Q`V`@ӰcpV#`!㈔c f,![ @@,cH.`  1(`".܀T9Ӑ  @{Ⱅ/`Q`2@ `@ ! #Ǹ @mƐ d@)"Lt@Ԑ4 d-`f@X@O@ @   `- `X@sc b#c  d3b `S`2@@/p0:0' 3`2(c3`2+Ԧ'@3`4,ؐ`\W T`T:3P d 2@cI d-ÐxC >` #3p?Uݐ cc #c #c @5ĭ9Ӱ#`ħ㿘; P7/a;Ԓ`ଐﭖ @`@ b̓( #H@)`  +"+` ǐ ` d/0b/V⠷.`&.  `0@u` $O`@V+ #@ *@ I 82@`͐`U`3<< .H ?`  %  &@ ݒ??s  㿘; K7/a;Ԓ`Ȕ? @`@ b̓( #H@)`  +"+` Y ` d/0b/V⠷.`&.  `0@` $yO`@V+ #@ *@ I 82@`_`U`3<< .H ?i`  %  &@ o?4? ) 㿘/W`R`@-԰<̀@3԰aù R V @ F9԰!8ð(ԒPad @` @ ) ;cH*@    , b@+ d01/V"(` *  0@ `$O@V"+$+` J`8`@ڐ U4`@=`@<.H > c @&c  &@ ? ?~  p; 7/a;7ԒaᘐJ @@ * H@,  +b .`- @7ᴁb̚ d b3"/Vbb*W V" W#|*` 0@27`@;4H 2'@ @ }@ x 6HV-M`t@/؁`@9"N t`@ِ`.   c   c   @Ɛ * < ###6O@-V.`&-N8`@ R`7 9 8`@.H >& `  @-" V#6 @$ @Բ E/#V  6%.  WĤ$& '{b  Hw p; A/a;7Ԓb8Lu @u @ . H.` 7* ⴺ/`@  @Jh"̒@B@T``#O`@+Vb-&-N8@0`R`7 9 @8`@.H =`# ## V"6 @$ @Բ ’/#V  6%. `WĤ$&'b H p; B/a;7Ԓbⴐ @j`@ (` #H)`! + @ *@  `@Ԑ!"@@H` $.O`@/V⠃/  @. @N8 @0`R0 :`@8.H =`c  #c  @ `@V@? /' 6& . `WĨ%@&'v㿐 `@+V %b-&@- $@"@ L 8@ ; ۔6 3p?㿘;7ԸbT;5Ԓ'a V @W @ "̑(;cH*@    , b@+  d4` @ -W`.`&- 0  ,1  (`. (Q`VQc| @`20 :`4H 2 @  @  `H#bL t@%@@㿠j ;* aP;@շb`@ Y 5* ֒O ;* a̒P;@՚b`@ < 5* 2 ;* b 㿠' * ;bP5 * `@㿠 ;* bp㿠 ;* b㿠@@ @' * @  @'@@@@  - *  t@@.@@@א 5* @  bHɐ ; * b T㿠.?`@>! ""-~  ``Wc>[8  b@@@ `d @ d@6  <@ %`Ȁ d@ d"H. ^ 2z>`K 2 >>`%`@  㿠@ `@ &  j O `@@`@$Ottttttttttttt,,㿠ϐ 5ɠж%V@.@@ f  @ @ _  q   m @U  <@  $H  M  _   [ @C  2@ !$H  ;  M   I @1  `@ +  @  d$H  #  5   1 @  @ 2@  !$H    !    @  @ @ %.  @ . ~ 2@ . w @ 2. p!,@ K . i! Z2H . z\@:K 2 ? :%@$@.  a+`:  a @ a @ b ` @(:? @ R` S`@ "@S  S`"@S  S`"@S  S`"@S  S` "@  ` "@  ` @"@ ` @-  @) S``2@% S  2@! S S`@ "@  `"@  `"@ ` 2@ `  2 20?` `   c4H c* 㿠'` V`@ @ @$ ` 2@ ` `$` &O` @ ` @p2@  ` $` &O` 㿠;@b* > 㿠;bb ` `@ ` @   $ ` &O`T`NT`@@?= 57` `@P   #@  `f@@ @B@ "@9$@ @:&@4$V + +`@ H8"@+$R ) !@(@M8 @&   @!4@$ 2@ $"@$ `@$@ @`` @ $O@@.@-@@" $ &$`$`O@` .- .` @0㿠ǐ@k  b6 b耡 d6H. ` @= ` @@/` `$` &O`V` 6@N?`@.     @'&@$   @ 4@ $`` `@$ OؒV`@?` @ .@-ђ" $`&$ $`O` / @- .` ?* @+  @ @  " &H " @( b* `*`P@ @"@ ` @ `  @+` @  "`$`@ `O2 `  $`&O@ * (@v @ S``$@S` $@S` @  < (@ `@  `S`Q@ $`@$OQ O 㿠;b` @-* @`-  d 2@`6> d 2&H  bvxbW`` @@Vb !L܀@ А  2@ A`@Ð     '@ ဤ@)7․"H7/`@ @b2@`l H`eH ```&O @  bcP @ zP: aK 2 : :(!@ 9 @ @; " 2p?bK`` @` @耢 @ S`#@ 3`S` @ 3`P3b䀦@Ѹb @̺bUU`'օ? H3 %  ; ? / "-*`"Ӑ-'`` @u Ȁ`@3 AL K @ K P g -. p`'   LK`@V` "g1։; I0 8; &@* /`# @A#Д DL K :`@ A P 5 +.ap`%   L`K @``V` 1אbg; I@10 8;  @* +# @   =``@ ! @  D'L``@ Ԕ @ = gK 2 = > %3ג`@ڔi D 5 @̒ [ D㿠; b ` @   &O @ );ג `( P O )ג  ,5  @5ׁ8 = UU+ך >`K 2 @>>` %Đ`@`;ג `L;# 5b̐7 @w`  DP;b`@C75% ` .`+9"7+ `@ `a P ޔ ` PPs  2  ̔ NK`@;9ג  ” <`  H/ג h- t  +bM K@1א   FM$@? @ b !`@ %?& !L " G"ט`ȴ`` __"@G ;O_7`ᙂ @`@%@*08:08*/_H%/ .` P .'הŘ l  {l2@&  @*08:08/_@ 2OO_ &  㿠;1b"V`6.` ? @  +b%' 5 5 5 '! ᨘ "bR`@#`2㿠@  9O""@@$ '"H  )א! " @ : +ׂa$ @ r @ : ׈0! e הa< ]׸0a@0@ x P@N1פ!DO0 @ M @M "OM @@L `@ H` &` &`$  @`M`+@`-"HL &`$  L @ 8@ܒ4 PO`$ @&`  㿠i"@ ^`]6@ R2@  &`U2O` &`5 `   øN` @ @ #\ `@#צaX 1  `2@ -! `@ #\-`@ %#\!!?  #\? gH20 <& #ר aФ_@_ ϐ /`%Z ` Ȑ[ z: J@2p >: !@' -a \/ג ܖh\ Ŕ ג ^* 8@@5הܐ\' K\  גa A* 9 O倢i\@e"$(` +@ *:` @ .H- @ @%  %@ -!@= 8&H% z$ X@; K@2 ; ;" ,H $ @` `@ )   @ &`  @   *b b/S  \@̩\ 8 'f\&`\@6`@ . "@` ג 2?/'&` g  `` "Q`@ H`@ @# צ"$  ) ? gJ@ 1p ? = %'@;{bx @  %qP '׸i,  !צ" ]_7#5 뭐 zba+" Z \'Z8bI0 8=#@O\  ?F* >`@/`װ̸  @'e\@}%%(!@) +8` @ .H- @ @%  %@ -"=  :`&H%  }`z!X; K@2 ; 8 @`,H  @  @ #  @ &`  @2ע +" /N ܐ\@ˤ\ 3 '\ג bȘ\ % גⴔ?* ;``O`&``@` @` x;bb  @ @ װb!װ#@`@^c$\@YH\I`@\ /` +`  @ڐ8"/AԐ82@ 9a#l@8 P +6 \)cT~8z #@@T@ `, @@@tK'`$@'`薐8b " T /T8 P J\ גc7V  d6H, 8*  cH@*  P /ߘ ټה*\\b`  \ @i @@X  ׶ ڐ @ $O ' @ $H' \ J8* -H@- P %Б n<*#b\  \1" @@` $H' \ ;b @7ؒP '%)؞$ d+ؔ`x @@.cH(@ ` @@;j` b * *` `  @/ P 0 9" @ @k)-ؔCm+"c@y@wE "~&w7 `dZ6H,`燐y%`% `$ ###//V Z  Pژ ط ؒa n D)Ko@'ؙ5ؔ,ےg ,)3@@`1 ́;b` @ "@ذa@ذT%L`@ @`'@yt\)@t!\d`@ \1"..`@j@dlt 0,4T<$\||㿠73԰bV% y@b/ @@ _+b ` @%ذ @ $$[QKQ("пҫݾ죁Մo Y&ށ* ]ry׳爁-ذ(;/b4VV/ @.`&. @ ! `H5J`@! .%<,c @+3Va+b̥.!6a5,`'b1/$5-b5"!!< @ `\^ #/` (&"%- ؐb0 ͔ ;"P b4 Ô ` @ؐbP  ؒ bl ؒ " J@`@ ؐ 8)!)ؐ" 8"В  % %z'w'HT<`@?+b@5cH#<@  ; /b. c<鬒ܒ P Θ ֫  ؔ#T x?=  'Dϐ܀@  13ѐbܬ ."Rc@!#` @)% ,M"Ok  d̺74b4"3bRန# 2`# !#`#'#`@%` & +ذb"㿠 @=. <+@.`b%%b` .  "O`` \\@6  + 6 #@ 6 *&  %@    ( `@$-   `- ` &O 㿠 @t!'P$$". +ᬂ"a<(`9 @@ "& \[*"# 5* @ & @  @-@.`\@%$ "3` P@3` 㾈1/"̴"̰Т W 7W 7W 7W 7! 'W 67W 87W :7W <7W >7W @`7 Ԕ V? 6 V?6V?6 V?6?&V 56V @4B W`` 4`6W3`B`OḒ  WWWWWWWWWW6 6  6?6?6?6?&?6 6 6 6  㿠@]'D/M`@W`@R@'&`D @D`'D`D`X@D'D`D l@D`'D `Dv@D 'D`@ODD `@D`'DDX@Dl6@ DL D 'D v@ D'D = D 'D$ODDD8  ? UUI@ 10 <?  (` ' ` & O? *G急6O 5  1-b̒ @ `06#(bȲV`@J!U ,b̀ @ T6!4B"̚S`64V`63M b456b̪5`B` ``  $O 㿠; bb5'7`7`(`%V Z/` ( $TX /` 7`*-7a-#@* @.` *-9`=  ` `@9 <22 `     1`R 2 $O`Waf@G@O 㿠9-"̶".!} (U`2 @; ;5 dapl o` @ @H  @O( @O aY` ` `"2 OА d@ d &H 6㿠;9c(c(+`' "`& 6 @ `(n `)"2  *g +b1`@ )% `,Z `-"4  .T/4`㿠 d;+b̰ ` V.'.`S,`D@`&#!,@`#  @&`# ,,`#``$OS d&H d&㿠 )"̰ @$# #H `$ #O)` `@    @/ *  @  4` 4** ` &O`5 c d/`/ - -`0".",   `@  <⠆⠊`)`8<)`9  @&O'`@ b H , d ,G ,F`@ H,F`,3   @ &O*` 5 )` (  b6`3 cb̪-`b̦,b̢,`b̚>O+`āx7 ࠸ ܢv @ @@? "@ e   % / & ``$O}ؐ h ?  ؐ  ? ؐ c ? ْ  ( ?  ِ `h ?ږ   #$bٔ*` a Pb̷<  +` ,e )< gJ 2 >&@,$ -`%  O  `+ٔ a`@  * <`Q@`S `  @? $`a@ `? @`$`a@`*@ @@`?@7ϐ @〥H7ٶ bbc$*`5-b̐ b1 `39!;!(") c(@%, V  #, F     ?G a @*a`.`` + @ ' @  a P@И ) < "gH 0p < =&+   $ .`&` &O` `ᙐٔ a0@~   * ; Q@ S  `@?"& a"@l ? `@ & a@ *@ @&@5 ?@P Yΐ`@DHC 57)1!l , /3#(`&#(Ɣ (  b    at  ? ِ  ? a @G 1ٴa!-+)/)` ̭)@` c( + (`.  % `% 1@ #\" a P )UU< H3 =`< $,``&@$ + @ ,j`O¦/ `ᙐٔ ab@Ȗ W 5* 9`Q@SА @?) %a& "@ @? @%a@*@ @&@%?@ΐ` <  1-"O` @H% ;/.`1+̐"L9 `+ $ + *@  !  `   : bT  ? "  ? 9@T"Ԑ  * = Q@ S+[ b"@G @ @y@n@?H5;ܐؐԠ- ȲȺL @, `K @``O+ ` `M`@-``L@``O,  Zb<; Ua\7P 8 ''31'bȢ"' ''_  `d    Ia @ `26`2`B 1 #(@P,R +`@56`3`B* @ $O `0@ /.##̲ '0̛-#@+  -`  d$c`=!c"P*P00,02 ْ c" J(@/٬@` J``$O ِc@y   NA* 9 Q@S~  @A "@@  "@= 8@UU>K 2 >=`$/ $*& l 2@UU=>J 2p 9`= (` .`%Y 4@ .` GQ#`#O 6GK.@ GG %@E  㾠- J@ ْ #d ?5 ِ c ?+  ِ # ?7    ? `X  ,%  ࠐ (P`,V` $ @" @ޒ`t`@ْ`ڐ0` P`0a `` `$O% $д ڸ O ڐ@  @/@@ / * @@@O ڂ `@ 5``$O#/g Ъc,`@Na@ ڒ `5 /ڒ    7  B$ *W   00  /O!ڒ  Ƞ d 7ڐ`В  7Ѩ @ W$ $V &@ "     $OQ `@o= zI@ 2 ?`= &.`'-@@  GҺ  T i0 0  B @'+  (* ;`@@ d@9  g0K@30  ; 9 %* *`! @ 0| 7 1ڐ  t 7  $OV9ڐ  p >`@  5 d7E.LO|I<j@Q/ڴ"X" bR`*2`,bP002Ґ  z   [ڐ?ߒ ?ے ڐ?a ֒   ]* ;`Q@ `S' ݐ8@\` @V` @T` @N`r@L`p@`?*H!}Ð!8 [b15# !#bP*0,bS`03`2  )  j!?  ?  _ ]* > Q@ S@ @ @ @ r@ ?@;?¦ /   > ;xa8㿠@# bL! @ @  @ ^) 9;@aX!2 )$%6`@%`> %!Xf* <Q@S  7` 3p?㿠O;9ڐa7! !5 3  a .@  @ `` O  O㿠;c9M #`@'#5 &: c, #.:` c-!@ 2?#2p?! : `2?!20? @` @0? መ"` @+ @ @   㿠;aa ` @"   "  ?).?## &@%#@ 㿠. 㿠6 *0030+`/p0 300 6 㿠& *  & *  & *  @& 㿘 @@/ @ `/㿘@ & ' OV @)! 6@?               wus q   "k i | O|`@3|6 V b(`'@/ @`. ` . `@ `. @xW` 6 W`6 W`6 W`6 `. `. W`. . 6  tpɐ `@% @@,`?&@+-` @.@.   `@a @@.`?#@+ `Д"*@ @.  W`V 6 `. `. W`6 @`  . @;,`` $(@(`V 6 V6 . . V6 `@` `. `"@* .`$ П,`# +`@ @.  `@5? .  @@ 6 &`~`8@ 6 . .  ?㿘Ő          㿘. )&@9"-#%-`    } { y w u s q .  @ /`h  O~ | z x v $t (V`FTRP`   ' ` ' `    $ @ ' `$ ' `(@' $`, (@' (x. 9@!<3/`a C (&= ; a@ڐ?/ @T @% ش   f@A  @ ` , , ,@@ O/ز   C@ x@`/ @ ` ` -`*  @)`ݒ@ O)K!܁? 㿘; b;b ζ>O9/# ;5bȮ .a.a`ܐ O O' 􀤠@?` `@ :* '@ @*@@ @1"Ȃ0` 3p?-@` `$O  |O| s`  O  ct |  @ `+"@ `@@/Ȟ@@#@`  $O` ` O `_ @v <㿀   @   @*- )`". @ ) f`Z@V T @`  c. `-`@- `>O,` @  + @;b̲`.`@ @-̤@  ,쀈@ @' b̄(! & * @3b̸ / @ @%̞@ `+而 @̨@ - ?O  b̆Ā?O (怢`@@a?`@;b̴b̸  {性 &O @  o`怦@ &O 㿈;b; b̶b̐!h P   @ <  @k`*`O-!x =  `@@ 7?,`#a ` @@%,?`k    (` % "`@ 6 $O   B `$OD % " $ (`Q `@䀢`2@ *`,ې.`0 2Ґ4ߐ`SS 6@S3S@ 3 ͐`  Ɛ RÐTV`  ~N`P X^``\ Z`b dfh`j l9 n1|x`pv|`xy rvtszW`USQN LJH (^[b V#S:7b4",)p8908(%;/cDU!|S#"`2@ `7d?@   "`&O"@  ?7lH?㿈   @-؀`>@/Zo?;b@ 5N⸀ @;Hat`@7`@ Őܐڐؐ֐Ԑΐ͐ːɐOאV; @@ ڐb?'@    #   +``4+`  &O `@1   @r p      d b y  x v t $V (T )R ,V .T 0`4&O ;b@~  x;?Dc@Y31/?b̺#H <@EW؀`"@H? $6@D? @. `-`,W [@TĔ `$4 V"Ȁ@ ,`5```+7+` - W4 Z@ PbbĈ@ b0bO  3rb?5ḿ? W`@ |    i 2@7zАzIzWOP֐ҐАΐ̐W` @ c0 WW`B@$@#WW@`B@c8  `G/ +&@'`  B@  '``G  sq󀥠G ``&@%  B@ %GW/4WW@ ;Wc|W?N9!@@?`@E!97̤" <@3 * 9`@@$* < +@+  ,W@)`(!((`V7` 4 OԐ5ڐo?#?` @ @ ڐ\q?`@   @.l@ O -+ې`<Q?-U @*3/b`   $V" @` @ / #@+  R 6 2 W`%, ?`, @;`$&O`)   -#3, "@ 1"U`2@ 5.3 #P  ( 㿐;9c,;7c-51#./-ې8 (+)%'%%.!wbu!]*[0om#Lc @%ҐX;Oc @#ʐ`pb+Mc @3`=a@ @5?`@  ON @ `9! @@ `7}?@⠺⠤   <`5 3p?,8 `5 2?,9&O`N@ n `@ Oad?`@ "  * ȐƐĐON @Ca!!` @@ `5 (5?@ `   4.`*ON @9!D#"@N?`@ X bI!"@7"@N? @at7̒$ / !̑*  !c,(`%( ,%@- ,`#`  "Ⰰ@ѐa?J@   2@=?`@O'L`@)!m@+a?3b:􀥀@1!܁?9#.@;a? ᬰ #* @)`(㿠&;a9’" 75&`@?u1! 2H?㿘;7'c;b/"N䀦@ )!U @+!bP 3aC ٬@5ۮ4@#i @1"L4#1/+'.#,---c.,(  / @7ۮd#  % @9ۮ"x#@;ۮb #쀠`@ۮ#! c, #- .b̒   , a . #- @  a @! ! H)#)b"L⸀@-Mt`@ /-] 915(b#*&|&#`7#*  b̐ *a]Q ,@"ېh@Z܁ 㿠  @ .`?`9##@ J 2p (:  )> !* (&   4` &O `2O`- ` @ /@7Kȁ1F!` 7;a95u$!@&507/㔴%@'-@4!# 9##\#c#`#dbdc# @ٚ##\37+/∄#`c#dԔc̘%;@Ú#!'-a - @ʒ a#``@ P    H#@ `6  a `! + `H2O;#!b#Ta$!PK @'  ) @* @  `@ ܐb @`@ܔ @ܔ" @\#@mbܐ @h A `n@#`n+@`bl -ܔ n@YАlܒ@TU  b@ @ ܒ"@I   ܔZ @Aؐܒ @;  BM Cܺ`bc P cl#\̒b#`\ #d@$O`3-1+a&!P%aTÔ '@ ` 2@ 5@7$45㻘9 7!5N$3\@&c7`5"- l!c|9$31c!%!(`!`- @Ē  @    H#`@ 4``ᬺ``- 4 HO391a'!Pb&!TJ`@'` -@) @Oc 1@Hc11B#'ܐ#!ݖ$67 B2%ܒ@eMC,@`c' @Z!ݐ @S @ݐ`@L A  n@ݔ# n@B`$ ݔn@;0 "@ @ݒ`D@.   ݔZ @&`<ݐ P`@U ݐX @ݐ אd@$O{ 7-1+&!P%aT u!# ` @ #c@'%h㿠O;ݴ`;ݐ  `Ē 1| ݒ `! t/ݐ <n-ݐ dh d /* =`@D1@!p2@a3@ݐ 4@%' 6 2  . * & " * = O1㿘1b̴!3aPb ?#`/ P#\) #d!@(P`%'`@@@.``$@/ P.`L%+ "  @: .H/ @Ѐ`@ `A@L @2 8@ O Ɗ  @ O `c<@@Q#@@7@ @2 d@@  @d @  @[` `$P& c8 @ @  *J` `$"P  #@` `$P"L  @:  .H O`%P&]/8@(@ @# d@  @   @  *` `$"P  #` `$P!`L   @:  .H  Oʀ`%P# L@    @  O Ʒ2 ; @ O Ʋ`@a&O!L\    "@ ! `&OP!ݒ ! 㿠  @  Ė *   - /` O㿠t@;bWbWb$㾰7 ,7 ̺ ݐaN Pݐ@Q 6@j @Y@ v@ v &H    3`6`2B$O %#@aE @4@S@-ݐ % +@ $b1 @ @?@ 1' $/` @ƒ" @ @)@ '` 㿠I㾐9 ! Z  C V /-"$+ )'ݻ*`%ݺ'@ #ݷ/`!ݲ;`097  5) X 3V /V     bV V V V   "      V      c0  #T  ݒ x ݒ c ݒ #   ݒ ߔ ޒ ڔ ސ`( Ք ޒ `LД ޒ `p˔ ޒ  Ɣ  Δ ޒ  ޒ  ޒ a a$  !H  l    a  ؒ    *`# * @"H` "H `&@ ` K ` G`&"O `@ `~@ +``K `O`~+`'/XX@) ޶!#4 g>;J 2 >=!@ N/`/`(#@/, &`I<@```Og#ސc<@! @O@k! @h@f1; ,"a @? a `l <5@! `@2@,`<`$@'g<L8K@3 /8`<# *` *`-" $ * \i O#X\<@' `<   `<   &O` ސc`xD@! @zO"@ ! ,@  6@ * l  P @K)ސ#@W`'ޒti @=@7`-+X@W`cW @+@7`1/F#А@W`㴒E @@ې7`734@W`cԒ3 @@ɐ7`$x `@bܐ̥޸۬c˒ۀ@TOb̀A@8a@6n@N@g@ ̏V   V`5 e@́V   V'  uV   U ݐOۀÒA  V  //7/T $`# `" x @ -$!-  /`@(*%ߨ ``@O a `b n@ N@ g@ G@ e@ E@   5  55  7ߺ   V`Q{  `d@?`zK@30 ; ?`"("@*) @H+cL@ߐ B  ֐ؐؒ䀠@  *% * * @(`* ܀ @W @SWV  @#V W쀡@@ WV @WV  2@V  A`@@WW-@V @W'@V 6H!@W쀥 &HWꀡ@HWV  H WV  @ ` $@ @`Wꀥ $@@`W耡@4@ `V 4@ `V  4@```@On`d!e!ߐ #А``OO0 n `@ /`!5(` @+`/ *㿘 @*.`߹;`@]` ߒ  @@G &H `c@  c@ 7` W` ̰^Ĩ%$W` \$/` p;9ߒ`!h @j@,@H+   .`⴮- ئ7ߴר0e@DO׀ A@, a@* s@ SH rO׀ r@ t.O׀ t@ TH q֐O׮ q Q55`  3p?2?`G6` {͐Yadʵ"# ##`'# '#`'#D7xx;bW`*W`6 @ʗ7̔  /V ; ܒ?Ԏːጁx. '.1 .` @' m H @-m/W 7W 7 / /W 7W 7W 7W 7S`S`[?!㿠?%b %` %^ %\ %Z %X ?;bV*V06.6,6264 = p  ֐    J    r  a"ځ㾰;bUbꀢ`@)'!#@4 ̐T@/a @@/* ̓=5bꀢ`@`5b ;@ 5b ;9<a"̴ Vb.b6`x9!` @!75⠸  <  0Ubꀤ@  <Ӓł`` `@&O㿠;b̶b" 0+`+`' .`$@ , -@+ = :`  <@ 9`2 2  p` `12a@PaPa0aOVf@G뀧@4O /` (`@/`<* &@-@3 `  @&&` && 5߰㿠@;b̴b̮&  V`V`V` `@$OV`㿘@<9! $`@6.`8`5;Vc8 V o `.@. -#+`.` R@ @ @ Oܐ㿠;Wa€`@a9 ## U@@ @4@析U &O㿠;Wa€`@!a957!~ဨ   S@@@ `@ ,/ ``-`9 W`` @&O  ,D8P㿘9-"̐"UU@1O !`7aa"0 G@. ƀ 1U⾲ .U⾲ +U⾲ (U⾲ %U⾲ "U⾲ U⾲ @U⾲ U⾲ U⾲ U⾲ U⾲  U⾲  U⾲ U⾲ @UU⾲ `%% @J.  `$UO $? `@8` @ .H- @3 @ A@O @0`@ `: @@$`@O` !`@ @`@ O`!`8@|@F@.@ @)@@H  @ *k` `$U#@   @^` `$U   #S` `$U `O ` @8` @ .H- @OĀ `%U⾖#  ʨ!@  @ @  * +` `$U"  #  ` `$U"`O ` @8` @ .H @ OՀ `%U⾐"`!@G@.@)@@H  @ *` `$U `@   @` `$U"   #ٖ` `$ UO ` @8` @ .H @ OĀ `%U⾞%`@P!@@ @@  * ` `$U `  # ` `$ UO ` @8`  @.H- @OՀ `%U⾞ @!O @ `@ @`@ O`!0``@8@@`@O`! &OO 32ba>,l<L\(8H`p8H㿘;/b̶b̐(V`V`@O-x% p@. ƀ<UD`FUꀢ@  6bј d{FKws;o1kgV a]C YzUPbꀢ @  0I/ dEQ"ꀢ @  1b9Rꀢ@  3"D +'Sꀢ "@ `$  Tꀢ @  4 @m d9"8`c @6`cĐ @.c @+㿠; cٺ  @" . .....`.`㿠@%@@@ 5| 7@ 0`@?V`V`;;?c'`@ @9@ː  @@@ 㿠;c @ 'c  @`d`d @ @`d㿠 7@`d @&  | @+` @?U U 33?c/& @ @0@-@k㿘@ @[ @'9!8@-) @ @`  @ @  @=   @@ @ O`@ O  㿠;c`@C 5 J5 .` &`-@ -`= :K (`!(@/`3p =K ::" )p03p =)`$*@) ?`H 30 ?`@8`=#@.00%@-00:p0:0:0@U `, < $O  \PPPP@P 㿠7& 耧 @B/ @@?``d @ R  @, @`d )!@d #ߐ b\@  ՁB@ 2@  :O  .`%-@@.` f  㿠;a`@ d 㿠;a` d@֔ $@@@ d @  d@ @2`"H>V Xy &8`U @@ &@<`@@V  U #@=`@@ @#9` @.H |pS   . !K( +`. !!E* W@ V 6 W   3 W2W2 V` d!V8.H `@ V`V %<`@.H1 @ @ P@` P&H ZZ@} T@2@ hT@ h' ~ې`h'  @ @ a`hd##"c$ 㿠 c`87` @;c "I <<<<  @ ` @  @@ "H , -`- `, `@  V&`````  $O` l\㿠7& P @4/ @@      .`>  2@  O  z .`%-@@.` y 㿠;#cc ?VV c^^@%`#\W`W` `@$  㿠;#cc ?T c&#\T W`W` ^^@`@T @#` 㿠;c;7'c pԁ 㿠9/`#3 &c  x@#|#l#x& ##p#W W ^^@ R !R\@ #t`  d| # K #|` x ``#xP P `N\\ X@X@"@]#\`@Y@WJ\`@  l  H   d)  H%. @  dU U @, `@%  l@ H@@  l H"H  p ` L@ dP &O lP `@Oـ`t!l #d#h#\#` h#`` p@3  d#\ t#d#h#`c h `l l @  dPp #$Op a5@ؐ?@@ .`@%@?@@@#@`@ܔ@@ P@$H P! @˔@ݐ@ `@$H `@`P@  P&H ) (@@Đ@ @$H /<@@@ @$H o  ;@ 'c$& d@ 9 Pqْ`@ d$S`S` \@\ oѐ  @v & h"c  0#\ ,#`{  ,cc03 @n@+og`xn Oᙐ `"@/@/%@9  %c` @L@M@o@``@ 0& dU-`- & dS *" *`& dQ ( @& dU -`%&  p& dU& dU & dS  p*" @& dQ` (!& &  d!p#R&$ dR` &&<&(&@`@)@@6/|Y& +'#& Lct& Pؠ`@& Tt & X . . . & \{ 㻈    @h#l& `` `n"@Un฀@ )"L;n`@ ',\A3nx`@  )c\6nm`Ā@* *c\)n`@ /-#nU`̀@)@X` @ #l 6@ #l #l p$O @9? 5#pn   @@c'&; &gbGc` 0 ,Ö "HIJny @ ` , --`&% @/``, `8`0 `82`@ `@M `|p ` `,  `O͐l`@'`|^ᰶX ݒt&O|+%&z|^Mc\`@`@'`"HCP ) o!|$}  }`@;  a!"Ԡ +a  )b 5' oܒa{$| }>@ #%,a#Ԫ  1- *!a$." %Ԣ   I!@  l`@  |ʀ`@ ' " ` 耢@ O"?@@ 5" ` t@$O" 5,!o!{$@^@/ |^`$` d,S S @&d T 2@ `tT @2H`t`l$l t $O`d@ٖ$lt$O$`m` |^,`+`@ `$`(&`9 @  (8@8(2O(`dU U ]]@ `dS #\S #d#h#` @ $`p`t$O`7!,o!{>$@@mO 㿠 /`  ^^@]@\#\ X$@ `㿠@N`@@/`@   ^^@ ª@#\ X `@ @x@#|#x& #l#  ^@^\ #p#t`|x #|K#x ` t #t  O ]^@`X^@ "@W#\@S`@Q#Lc\@    H   )` H"*`@   @+ @$  @ H@   H"H   ` L@ &O  `@Oڀ p #d#h#\#` X `$ @$  #\p#h#`#d X `$ @ l`# $O||@`X)bN  $`@8@2`&`h@" &` H L6`R <6`-`M!@5*`6`6` H`6` '''@'`%P  -  - ``-  -@'  '@ΐ- %$O (`X  1P  - - `-`-@''  @-%``$O `X@ ` `4 `8'''@```\``\+&hĴ6` 6`"/ @n㿠$ĸ $@}`$O` X `@@㿠;c`@#)'#xl  @ $ ;  .H  @ " "  8.H @@ > P9+#c `d%@`@   `h$O`d7   3 ax1  ">`@.H/ @ " % <.H# `@  @ P@` P&H wx 㿠;c`@-+a '#㼦 $cd@@@ h$Od9!5w`  ";`@@`  "9` @@` ' 8@`  &=.H uw㿠 @@iX`@Ȕ &2H X 4& @&Y  +@k `H`L6W`<6-Ma @5,6`H6`H6¸$IJ  &`'  @M(Ā`&&($O  "  )  ? @7  ^% <@# \@+ @@_ @ @WaX 6*@7 1* @*/  " &=@)  ]$ ;`@@ Z ,   @2 @;@*aX  *@  * *>    [  +`    Yน(`      Z@ )` 0    Z * ถ p@ !p    *  *   ฝ㾠 X.?` @@@5!lk@ؐ3a@@7@Րᜁ㿠;av`svŁ㾈| }@ |9?#&@ @*?~&@ `@ 0  44` 2? @30?@)?#@@?O`@Ot{N O?#&@@ @H}Hv@n`|@x   0p?10?`@&@  @ @  @#\#\#`! #d!Ȑ#h kS &O@  $ @(,@0 4 @8 4 4<#\) #`!ܐ#d #hk. O @ O`t`N` O@yܐ@z{s s s s 㿠;a `u.`@u0.u@. ?` @3@`hH;`h`h@@@2O  㿠 dX$`@3 3ĺbH`` `@@` `@  `@@ ` "H`,``,` ,` ,`@ǐd`@f   `$O㿠9#`@#; c쀦@ `hO PP\PHPP(㿠7 & 8 @B/ @@a `d X@ d ` dX@l  )!d X`@  `  ].`> YW 2@  QO  .`%-@@.`  㿠;a ` d$  㿠;a` dम^^@&#\X` @$ 㿠;a` d&#\X^^@@`@՚$` 㿠;a` d 㿘\#\#`9!d  d`X` @P3\ `,@՘ /@@@ P@|$H P@@@ `@k$H `@P@  P&H %' ' @e@w"@@R4H' 4+b,@V@h"@@C4H' 4!8@& d3 tĖ d  &     "l& L & Tc|c& X  & \. `< .  ;. 9 7& P@d db@! @b@c dfޒP@R@ dN 2@ d5@2XD`X'@`HL d6V< d5 Lἀ"@ d dྉ)`0H`2`H d  2 dXdIJ``@$O d d    ^  ]/ @ @;@b| d@  st d 㻐'D; @ib7`┬ `f"@V;fb@)-"Mf@ 1.#\Bfyb@ (\77fn⤀@#,b! ,#\*fa⨀@  )afVb@)@Y @ '$ @; 'c"hD&O@ @?@cs`c`h#\bĘD  @@$%9)'!<!Xa\ `@#\$~  a`#h%@Os<fJ\@@'"HC-P%;'b%h8̖tW$uE u@!)+"%bԸ +"̤ *" 5 d53#bhat5$u# uy@ ("#bԤ   d  c!"Ԓ * *   d%L@  d  X `@  d d%ఐ @ h h$`&O35c gϒs$@@4`@/ !  %`` `d -`@%  d  2@ h @ 2Hhd `h$Od@`d`h#` &O%``eϐ @6   ((`$('`<`@  ,<``@<`,`2O, d``[@[@* d #\ #h#`#d@G  d h!`&O  㿠 aX`` @' ra`@.H i{  `. s, /`. 3am- W V 6 W1 W0W6@,@TT&@=`"@ @= #, 3  :$8 8`& P@  P@  *``6`-`@,=+ @,`#T`d#@R`: .H  @R`  T@!@8.H @, ZZ@,`@kOU @2@`hU @`h&l: h& @ @ a`hd#""b 㿘3b 85@h#\7cxI#d?#`b? `  ` @d @ ` @@ @ "H0d`- + *`d, `@z  .&`\@   H@@ L '$O H``O \`` d` #\3#` `#d` $O ` l\㿠7& ሀ @4/ @@      ;.`> 75 2@  /O  M= .`%-@@.` L 㿠5-;9cl7"@.` #\6T` T`. `9` `@ @&  'TT ^ ^@ # #\T`T`  @"``@ @` 㿠9/`#l3&b 㿠;9"Ĩ ck.~7``  ` +`3 8 `>  @  `/@@ " /@: K)p0100+ (_] ]3`)`@6 ; . @  O؋844 `t;` *@ $O ` O 㿠;9"Ĩ cj.~7``  ` *2`8?  @ /@ `@! ` `/@ 9`K@)00+``0p0_] ]3 ( (`6 :.   +  `O׵84,`2 4t;` *2 $O ` O 㿠;9"Ī ch.>7`   ` *28 9  @ `/@  @!"  `/@ 9`K@)00+`0p0`_]@ ]@3 ( (`6 :.   +  `Oן844t;`@ *" $O```O P?@m@k$@@g%@@c?` ` @  c|;+'@ @-@ c|,a@Q4"`4`& @@ ,` @C4" '` @@4`a@!a @!,a`@`$` @`a @!` @!,a$``@"4@`@   =``@  6`.`@   ,`.`@@@M ??J@ H@!b ("d?+l* @`X'@! ")(`"d * + @ Z@'@ R.``@@  M.``@@" @ D.`b  `?-bX -`l)` `@^-  'ԕ4 "@,  *.`  `?l`$*` , "A`)` ذ`@^(  Y@'@+ ` Z@'`@'.`    I@ @M@@@8@6`@-5`I!@@(@@ ?㾔 r` `l" ?)`A؃*`.  @[* ^*5`@ ' 'S``@7 N``*@2  l"-`(`` ?( +`  ]@ '`!` "`b-`*`( @['@  `@@ `+l" ` ?-bT-@ ( @ [@, 'Е2 2H `@%#@ @.`@``@` ?M2@~3O@@u@/- 4) @@;+ `b-2@)l ?UU0%`~=`J 2  :`="`)  @.`(+`  Z( @@ '[` '0` ?* -`( `[@@ '( `[ '@?a   -`(` @`- ]@6`@ '@ ? @0?#ߔ -3*@3 )l"; -`bt `?-`*` Y') b ` * "t, @( @^@@'c Ā#\ #h #`#d{h``t@  P?@m@k$@g%@@c|@@|< a   =- $ *@@P4@ ` ` @@< 4 `  > .  $ `,@@5@4 @ `@   .`@@ JM@@/@2@.`@%@@  @ l Q1 #h ?(c( ,@l)  "[@ 'R  +` @'`` `?)  . l+` @ `]'+;`c c` `(`,@-  Z@'@  @@  l-`T  ?c- @-`@(  X@2 '2H @%# @ @.`@  @ K@u `J@l@ *21 @@#H`l ('" ?/`? ) @ @?+ @*@ 3@\+ '@  \@&'ĺ!  UU 8?`~?I0p @9 ?`$.  ?ȃ+` )` @Z(  'Z'` 8`??ȟ.  @@[@ '( [@ '@5-? 2.` *@0`ct1 - #4 ?( l*  X'.`1 `#t  -#4- @+ @ \'.`# @ 6@.`@   @  K2@ `L@ @/-`3`! @@;)  cL,1`@)l ?UU 0% ~<`?I@10 8`< @?-& +`** @@ Y+ @@ '^@` '` 0` ?+?`-  +` @? `Z* @ '[`@ '@?c @=  $- ?-?* @?`X@+` 2` Z@'쀍`'@?! < - ?* `, @@]0@',  *@6`!l#x; - c8 ?-`* @Z@'!x  (#8-``- @^@'b% ŀ  #\#`#d#hh{`` t@  㿠.`;59b. !=``W`+W` @&` q$ i&@%"  OIΘ `$O/ X@+b#&`##l#T T b #t^# ^@T` #!2?\@#!`T`  #x #|2p? #p#l #N ` _@\@||`#  #H` ` ZY@#|2@pxl#`#d#h#\`h  `lss@W[[Kp`@1  `l@ Hss;[[@ `l Hss@[[ `p Lss@[`[@$O`lOԺ x l#d#h#\#``h  `pss@  [[t#`#@$O{ 㿘;c /  /@/&#\  7$O#\  . +/ ct0_]/`- ($@Ւb䐐@ / #l W/  @#`#\#d  #h@ƚ@ W@l l #p$#t #xeV$@?# '#)##l #|' #O#@O ` @O#@O`:@b@hV{ON2@%O@T#p@@WVjp`@ # #<@LV_@7h@CVVO F@b@ c@5VH@x @@)V< @   `@$ J  J*JO*@ *J* $OJp  | \@@ L  *@ L@ L  `@$OL``O xldt"OYd|lp`@2@  ?.`Ǻ #d@qW cؐ@@ː@+@c?@@@)@ @@@ P@$H P'@@@ `@z$H `@ P@ P&H (@v@@ @a$H %<@e@w@ @P$H U  @W  & d!"@ `PW`@-, 6+`;$, * #h@ dV]#hV , \-@U  @& & h" `0h#\`,#` ͐ _d0@5 @U xdT Oa ` "@/@7/$@ b$ @@@T`@ 0%%e%!%% @ p%  %%$%(!!p 0% d pR@% dQ` % dP. @%!p dV` %+`# %  dR%$ dR %(3%bb%<%@ @b@`@o5b& 9!& P#& X#& \  & L. . . a 㻈;… `@7 `& ` `TT@` $`TJ`@--`%`T@@!`@C` @  ` @ ` V``$O` @9?T  1@1 '!#n3$)+''#! /bI #?0 ,3 bHbGbJ? Ti @ `` , -`-$#b@- ,8082`@ `@o; a ``  , `Oɐ `@$`5,X  x$  O,z%$`,35ab$c c]@ 0S +;Oc\@  --$""  ! a(!bԒ ,! *\++"  b`@o`@7#! .`a #l @ .`&`` @u' &`l `x`d&``PP @u&`l`x$O.`%#`-lc -, `@* `$`($ 9` @  . 9  @9 .  2O. @. dV`V` [Z @ ct H "@    #!cp h##p@ "#h!#p  chS$aP@~@##h #\ #` #d@! 6`&p@ @}; #h  #\ #`#d @ &txd  V`#\V` #d#h#`@~ &px$O` *+'%") 35"-@b@+ 2 6`@+3`6(`2 68@ @*`@1` @7` & 7`& 7`&@"@`. 2  `@@(0`@) 0@ @66 @6 6`O`` `O ) @}h!( @}d!?!a'(`$a a@+b  z @-RY@s '( /RMᴁ 㿠@ ?&H @&  &`?&H &` @ `@ T d 26@&`& 㿠T ;/* aV& V&`㿠;75c8c4 @T T ă. ` @.&-@ G.  *" *`.`Q@ G`T`G .  @ Oې* @4 + #@  * ƀ`8@ : 8@  `8@  86H  1{ { {㿠. /.`4&. @ @//` *c" *`/ P@@#S` @ہD@%T` @T d 2@Ɂ㿠@d&`97c#4  ƪ B SS/ *" *@ @>/ @ (!(.`S`@3`R`@.fH*bS  @z ~@ /U@zz| @&O  OG & 㿠@n&97c#4  BSS ƹ-`+`# . G-` *`" * .@QG`U G @ c8-``7 3p?GԐ` @ /8-` @  2p? GŐ`@ `@ `"H@`"H 8  O㿠S(  9S$  T!xS  * +W@'aឪ -T@T@ SS $` BG$G- @(c4!($8`@yR@4@  *``Oؐ B@ OЪ 㿘"I`‡ @7fWؔ #\RՐ  @  #`? 8`RRǐ? @i . ``@@@\ @ @VOR A@ @JOF8 @;l @4m@,^R Ȁ @yK` F@yB 3``d@y: 2`y5 `@  +` .O€Ĥ O@RX\ &O`㿠@C;9c#4 d   R@R='` BG@#`G, ( (`@, +%+`/` R@ `HR K@ ږ  && O͐&OȬ 㿠9`/-`#4 QQ%@`BG@!@`G-` -#+` `@-`*`" * (`@Q@ `S@ H "  OӐ㿠@ '  `@O㿘;ﴐWaa@67a/-8&   |  `.@@. + #@ *.@ Q@ H £ `Oݐ`@Oخ 4` @y  #8 @E(@@; " `@("  @ )@  @ `+@ `@ + @ ``)@ @  *  @ ``@O+@ @@ *  @ +@ `@$O!O€@@@' " `@"  @ @ +@  @`+@@ ` @O* @@  `*  $O!Oր@㿠>`>> # >3?# 2?`@@ wO O㿠@ww`@O@@ ww`@O㿠@@5=`wkO@@ 6> `w]@O㿠5`@= 5wJ?`wDw@w=㿠Pt  @  @ "H @@ "H @5 <w"7`@>`w@4`@< w@6=w 㿠PC ; b̛> 9W #@30?P9  P5  &P1  &@P-  @&$`F :  P @<`=>" <2p?!0?``@@4vĔOO&O 2@!$@@ vv`@O`%@@ vv`@O㿘O̐ ; b̗>W " 2?OÐ  O  &O  &@O  O  @O  '`&@ #\ O  `&#`O  ' @#d$&\`& d` : : \ `d}㿐On  ̙;&``P`# 2?`#`Oa  O^  #l&&@#\@#h'``#d&  $`$  &``dd :^ :\hl8 2 O$  @ @o"H @ "H' 9\ 9\ 3 9\  0  N  BN  -N @-@@ uu O\@@@@ uu\`@ O@NȐ @ 00N @\N @uv㿠N ; >&` b̪ & W ` &  #@&` 30?` `% :` $% $ 9N{  %  9@ @H"HD@"H 0 ` 0& &` yNK  !ЖNC  N= d P@  N0    h&  0 &``*N @N d 2@&`&``` &`&```M @ƒ&``& M  &`*@e&`M  / @^`M  )Mڐ  `"MӐ @  Mʐ @  I 0?`=`>" ? 1p? 0p?  @@to OOM &` M ` M  &` ʖ M  ` –  6͘M{ d 2@Mv  &@@Mc  &ْ֒ӒВMR  ML   &`MD  `& M<  M6  㿠. 9#@/``"@N`C -@u2 3p?* #@+` ``"@`  0p?* #@+` ``"@`  0p?㿠. 9#@/``"@N`C -@u2 3p?㿠. 9#@/``"@N`C -@ux2 3p?㿠. 9#@/``"@N`C -@uc2 3p?㿠. 9#@/``"@L`C %@uN@- @`$@5 3p?㿠. 9#@/``"@N`C -@u02 3p? ;& a`&`  ` & &`    : ` y $?$ 9 0 ̪LWS` @(ah%2@( a% (;!%b `S`/ ?4`*00`:02 1p?/ =$O`%@8/N‣@-_`P$ 0$P` (@ & \L` a,@ *h&  @ @` &` @K*  S `@O OH& &`  ` `& &`  m  :` $ۘ ?$  9J 0̬KP`  @#(b0b<S% (@(4K% <@5(b<C% P@;@K  @  @ H/• "@#@ "H;!&bD("&P($&"`((&l ('&bx(#bc&(8% 5(% b- T N2 $   30?@)`=`$O% `@)#  (`* **@ @ `@ @@`$$`$O``O ! (08"'`'`'` '`'`'`'`L‣@/^ Qc$` 1c$R(@ &` XK  ,@ +h&` ` 2@#\\&      $O&  @@z``#p&`&`#d`&`#``&`#h&``#l&``#t`&`\ c  ] Đ W Đ Q Đ K Đ E Ȑ ? Ȑ 9 Ȑ 3 Ȑ - ̐ t' ̐ `! ̐ d ̐ h А l А p  $O&``@Ԓ  Ԓ ` @$OԐؒ   ؐ   ߁㿘#\#d #`'` @  6H @@g 6d  `: &\ 7`@ :% %@#8L-` @Hpٔ` ` *L+@ #@%H*H2@(XH^"H()p :$p 9p =I d K@  - Q$$OL O d`@ 6d-\4&`8?`%#@ N`` @`9@ `&@`,Hg`8"HG@@%`@"H@ @R1a R`0s/V  3ጐ S`5d@R  3a  R3!R`1a( P0FS`(3!u  R`2ጔR``1!  P0a)I@ d 2@@Q`1 0R P`6!I, d 2@S `3! R2a`$OhN` O`㿠;a; ahI `* %- 2O ;bO …@ !l\wb S#$̟,p0;0 3#$R``2@ !`(]@H  H9/ -h9!p 㿠;a; ahH`* %- 2O ;bO …@ !l\;b S#$̟,p0;0 3#$R``2@ !`(]@H  H9/ -h9!p [㿀#h3cD#p'&LcD d'"`hp"@h#\@@#\h#4p#d#`#l\@\#\Hm @hpHb @p%`@H h$ @ -hpqHF @pGAGhG瀤O-`- %-`@ & >`@ ;@ :@J`* @. !@)  @"> @":`@ #p#h"`@ ; -  (d`(+be` "`%@q. *`$" * @`@ `:@n$O` ƀOUp8- @ 8#p#hIp&@#h #p#hLc6@?#l (`  .&P&L-)fQL L#l0pl`@ ̀`@  *`  (̃(-`̘`"#lG 6@`#pp% =$ @d$ : " @ #ppGh2O\ fL @    `PQn8 fL@&O  b` @    bd ben%G] @   b`&O 㿠;7c4;5c8ĦVĠ  T(`@ @@ (`+`% +  @"H ` `$OU 㿠֒ @. )-#4%-`@ : 2&@ ƀ2&@   2@ 1 ?`# 30? 㿠 B@#`@!/`%4- %@, `2@9#8/`@F d Z@ @o `@㿠.@+ VR`@@) #D#DM-̀@&@? ?V @>?V-X @8?V@,@5 ?-\V@@6@. @/ @(@`@H` @$OH` ``@O@7.&Ѐ8@  +@ *# +`-# 2` @. @ : '@4 < @ * ."*%@, "@1 $38;`; @ (+ !@) % + 6 #@ 2?` :`Gy @ -*  @. "*'@4 "@1 <8a @ `.,!@) %-` 0`$3@> ;`VI @+ % +/`#@ 2(` &:`5`@< {1 @ `* ,"*%-`"@1 $38;` @` (+`")`$ - !0`# 2@>  :v `d@ <`-`(` -/` % >`? # <30?" 20?`@#/  /`@-`&@` @ &`-`@O-@4@ -`@$O- O& 8@   --́   㱰90'#D#D  `l+ 8`O  AO "U` @"  ET 2  1p?W`*<  pg2   #mX3?`"m\ X- `@=\ -`@  /@\@  /@\OX`@O뀠 .$  EXE\I`h@UU>H3 <>&+ #@ @UU>K 2p :>"-`!&`"H& @o`D  P@dDސ dDې  T@: @  2@V`H( @I @C 2@>`@2&@ )dݔ 2@/`֔ 2@(`H 2ʔ 2@`H d 2@`@  2@```1$Oa  `k7 ?`O   Ak. ?O A  `k% ?`AO  Ŷk ?AO @" DLDG .* @ @ @ @ @ , + @ *.`O @3! ̯*   `@   ` ``@`   O@`̀@  @Ѳ`В&   $`̀@O@  2̒ Z``O 2  3Ē (O 3 @C   ה Cܐ   є  UUU :`K 2 :`@:&@ 4H  &H C¬ #C   C  @`@ %``O  nT@N%` @I5  H@: @V@@5 B5G3 c4@,#CC Ɵ-`+ #@ *@ `G-* "@)`.`P G@SO `H&O  C  ﵒ  C  ﮒ  C  戮 㿠.`.@%-`@ C4  &   C.  `@&  C%  C!  $ C ?` = >? "@10? @3?@@ < i͔O`@OB @`@ @`@ @@  @@ B  @ "H "@   BԐ`@  B͐ @ Bǐ B` i㿀'  '; '  ' 7/c; '  c? '''&.  @@ * B* @@& O & &O퀦   O  )B~ .By <-#4 %-`@`G. * #"@)`/`P`G@SOސ i !,#㿠;>-c0P>K 2 ?` >&,@-&-- ,`& @       ? hO  AO    `h`@OO [h*  $AO㿠135.#3c  B ƨ 756ᾪ  6’    /-8 53 1(4@ . @30c<@ . #@@ + 8 (4@ . @30c<@ . #@ ( 8 *4 (@  0 2c< (@ #@`  +@ 8*4(@  3@ 2c<(@ #@ O*  `ƈ!a AO 3b 6 b3b5b5bS 2aS (h3c$1a@3S @-7P`@757V$d@ +#D73P@ +cD03<@ (D)3(@ *#D"3@  )cD3@  )#D3 @ *cD 3@ /-D3- -D3Nah@ N @ *Dc!| c@  (D"Q` @1 *cD!S`@ ! P€@Na `@+d@) @"P`@"@` @@ `@@`(@H N‡`2@Nအ 2@ N`2@N〥H  @ `@)#TE0ƨ !9## /#3$a| `"@  "@! l e`"@   "@ k f`@@` g"@R  h$@R  jR  i 4H j `@@` g@ h ` "@ `  j`"@S` j$@S` jS`  4H j\\\\\\H5Q`V @#\`\\R@``Ztps@.@3``t`pu@!@3 7 !;5cH ' `0p?d  ?? ;U@ !` @|* @  @ n2@t`$  @o(5#+  `$@J`8 2@c`$6@ ? 2@[`$ `n@  , @% M @C "HX@ j  P n @ `"Hv#`w. `@c4S*- "Hvې. @`S- -\#`&#\ % `$#$OzbQ *Q ,[@墕: *0:p0@(`8 @1 ,`@?#1 ,? .@* @ @ 1 ," (1 .:` 1 . @@ 1 ,1 . @ @## `@!#` !# bQ 0Q 2[@ : *0:p0@(`8 @1 2`@?#1 2? 4@* @ @ 1 2" (1 4:` 1 4 @@ 1 21 4 @ @## `!#` !# 㿠9W!€`@A!753b̠  'zV@-U U @(*` > 8`H3p )`>> @` b2H+ +00;0 + :4@5 5 U"U"Ԁ@2@`#%#`W  &O㿠7g>K 2 ?`>%@,,@S` aӸb̑;`;J0 >`cH;`%(`$. @, @@'aA@A"@ Jy@ id %Hy/ (yR R  Rc  ," +b U@7`>-: ቄK 0 > : %,*`" )`-`) @f`>-< aH 2 : < !@ -@- %@,. (@Qή % QȐdaE`6㭓>J@ 1p >` >%() &* , @2 K`〣 @ (Q"@_O> @L 〠`H-Q<> "O "N〦 @'QX> @ 2 `za= H3p <= " -"*`.`@ V \ @V ^@V ☀@RdK V \ "@V ^`   V ^"@V @ 1 d4H 1 h V "@(`z<aJ3p ; <" .`"@)`@-`@#V#aN#], @N#Z 2H$ &H % V d%d V d@  d=gJ@ 1p )==%@޻ x V @ +N#]d@   V T@ !N#]H bV T !`@=e d @ N#]1Pې  h* =X  TT`3 N#] @ , 2@, V"܀"HV 0, V 0V 26@V T V T @V \ `@V ` `@V ^ @V * V ,6@V Z V Z"@V R4" V R`"@V n&` V n"@V p" V p"@V T2% V T"@V V% V V "@V X=#  V X`"@V NŠ#` V N@#> V P`"@V bk ` V b"@V dh$ V d "@V fǒ$  V f "@V h"  V h"@V l  V l"@V jư  V j`"@V ru$` V r"@V t& V t "@V vC!  V v`"@V xm!` V x`"@V zȗ"` V z"@V \$ V \ @ -V#<@ % V `"@ V ^V#<1 `ې%  V ^@ @ V#zaK@30 =>%- "*, @8#  &#  V R"@ T`T`@,4` )#`@  g  1O  #`d@>`bgJ 2 >`=`$)`@) @@ 3bMX@/ f O # &# Le`@ < d @  $@  " $  !`0&  ` #`U@@ @V  @# +6 =`"H $#$O` @  c `&c   `P@ B2@ `$V`@!`*`6: "H `$$O` @  c 'c  `$ xV @ bb  $S @  ``B2@ `$V`@ 6`V`$ &O Icd @ ; d 6@   ( R|`@*"` 4`| V| @# fY LG  U @ N   2 -b3Na U5 S`@  3` +b㿠;b;bO ]@@L @3NӐa,-NАlN+Qia"H 5 4 㿠;b;bO ]@ⶀ @3Na-N N+QHb`"H 5ⶮ 4ⶰ ,,,H,,ht H H8@X0xP|`80Xh(pP@ `(㿠T.5̶@,Vb耐@/:V"ᨸ%` }@/ @@H`@)"N @  *"Mb#c#c "-@/kkɁkl(jjŁlwādbJfCfEfGfff\\.%[Ɓ[_ׁ`eDd=c$r;lҁlVnghف.`́QZhn#nnGloDq/ ;rxyup4;quqpށG -",G>7 ⸴ MՁ㿠;bVbր@b.&,`#@#H+  @    @/ `&O ` 7 ( @   $@%`@!`@` @`@@`@`@@`  @`  2H 7     $ (7&'?/'?'?H'?'?'? -H , , , /  / c !&c H;b̶bW"܀`@I@P*P,@@BR 0R 2@= d% :@6R*R, @1S 0S 2 @,S`R`@(UV`@$T`\@ W X`@U `@T^@P`P@PT@ Q`Z @T | @ c Jr`@"S"ހ @Sb쀦`@ U܀`@#c쀍@ d9 H/#L@  dH/ 5cȒ Lt̺ d-H95 "@"@`"@L# "@eR`VZR` J w`"@`=!`R<@?` /c L=ز< P +g o bL4S`S`  ? ߐ # "@ "@"@ `"@Q"@1b2R T`2@K2"R `d6@G2"R"܀`"@R"@#`2"c&c2"U"9"@R"Y %@( LU Pb쀣@#2b#!# sRURNː V"ڀ @ 'L~2@S"U`~%5`~S`Z @c&c Ks@4Hax@0P(axH$ +c¬axc   Q@ @) `.  ` @@- `V: `U `@&O I!@!(K@!'+,Ua€ @)##a¤   ` `) P`&O Ja @, )a*Jက @,S!*က @!cc   `@ `@@ -   `-? T`@&O` K!~@!*~ I!~@ Qa*a~ @/aª  `   * T@ &OSڀ`@Hb "O㿠5 B̮ ƶ6bV`V`5-b5"444b3 b  +ax+#**~*a b SS@6@S3SS@&H3bX"@V`.bV``@bO`i 2HNb.b@ bMi @Nb2H Nb.b(Nb H"R@yܒJ"`@]ɔ %%]Ô 8,  @*@.,b;#RJ Qa >S1acq c% #@%#&c#c  " c a!c    3Q/U `5cq&c`# >;L⸀ @R`@5}R#96aT  @S!4a!!+` a @1T`` V!€6@V V @yΐV` Ra6@yŐ ScS`~ 3`~S!”"@Q ~* # #(V@@"@ @- %`6O`Q ~`d@I"`@`. `I" 2@Q ~Q ~`d@I"O`#"@## "@##`"@# # "@Q Q )SQ "Lx "@:aM`@e. dc"@cc "@cc`"@c ^c `"@V`wV`SlV` "Hx"@:2J"`@6 c"@cc"@cc "@c /c `"@R`HR`'Sm _e WKOb`@Ob@}y HG"I"`@eI"`@eI"@bK 倢@d!J#|2@QI"Q `@1 %4-Q 1 b" 1"GH7(W`*7`,7 .V`06`254X  ̐  2 e   "U`| @ +GGb3 |!'b̐!h@\"4",b"I"@ @&t$@&gYI)㿐/9%0?'!0& $&@3$@>``$N` @0 #@/N`:2@?  V@@] @ @ @@  `"@ H?"O@&`@ `&`"H 㿠@\7`ᬸ @(@  @&`& `` @\@[`@&` 㿠@[5 `@   & @@[@[ϐ & `N `M@ O `2@O   :@`F @ +`c@]4 "@ 6` `K@ /`@]$ "@ 6`  `A@ 5`@] "@ 6`  `E@ ;`c@] "@ 6` `R@ `c@\쀢 "@ 6` `V@ `@\耢 "@ 6` `P@  ``@\Ԕ䀢 "@ 6` `C@ `@\Ĕ "@ 6` `H@ ` @\܀ "@ށ 6` `B@ `@\؀ "@ځ 6` `L@ #``@\Ԁ "@ց 6` `O@ '`@\Ѐ "@ҁ 6` `M@ +``@\t̀ "@΁ 6`  `N@ /` @\dȀ "@ȁ &` `TH5` $@\SĀ "@ā &`  㿐N `N@2 @[ :2@. N`@ @Z@ `@@! /`$!`#+` " a! 2@I  `D@%`@  `2@8  `X2H3 )!@  +`(@[ @9 !.`.` .` @ .` !4@ $@  2H  B4@ ,$H  㿘N `N@4 @Z :2@/  O `@  @ZAa@ `@@ #!/`` "a< !@  +` #`M@a @  '4@[ "@  -  `GH* `2@N  2@N  2@N   2@N  @J0  I 6@  .`  .   㿠` .@` &O`?  /@&  㿠; b@  78ޔ@ $ 9#Ք@; `8Dؒ `N N@1a @Y :2@/  O @  @Y#a@ `@ @1 /`&!`%/`&&2@#  aG@(2@N  2@N  2@N   2@N  @I  Ib 6@,2 ,3 I@@    T@Z "@ ** W2  W@@  ``@Z䀢 "@ , 0, 1W4 $  A@M@  "@ L :2@ L`"@   .,@X-(@Y@ /@Y< :@@ @@Xݐ@(`,L@XԐ$@ @., "@ L:2@| L"@x   Oʶ P@%@Ё  #\ p#`ܘؐ @Z!Ԁ @5 W3 + + W3 W3 W3  F@9@  N "@A  J``@` @ `|@  M @ @|2O -  M "H |@  M G |"O 2@ M `O֨  D2H @  C2@  㿠; bo@  78f@ $ 9#]@; `C` 㿠; `8`8,@  2&O ;`CL . , XN  N@8a @X[ :2@/  O  @  @W/@ `@@ /`"!@) @`(@$  @& $ &$ a I@ @  Ė@Y> "@  ,`,` W4`  W@ @  ) Ж@Y#䀢 "@  .`(.`)W6`&` P@% @Ё 5#\#`ܘؐ @YԀ @ W!0((W0 W0W0 F@9 @  N `"@`  J`@ @ |@  O `@` @`|2O /  O "H |@  O G|"O 2@9 O  Oָ  A2H.  @  @W :@ O` /`@` @1  Ȗ@X "@  6.60 㿠; b1@  78(@  9#@; `B" hN %`N@3 @W4 :2@/  O @  @VӐ @ `@@! /`$!#`+`#*@ &˒ 2@& `W@ @  '@X "@ .`.`&` `X@ @  /(@X耢 "@ ..( `T@" @  ;a0@W܀ "@   )`)`)`! &8 @2p?`C@ @  !ؒ!<Ԙ@Wƚ̀ "@ ,$,%,&,' `F2H<  @  N `"@3  J`@ @ |@ `N`@ @|2O`.``N` "H` |@ `N` G|"O`2@  N` Oֲ   㿠; c&@  78@  9 @; aHA 㿠; $a8@ ( 7@ , 9"8@; ad@ hN `N@5 @V  :2@/` O` @` @U7'4@`  &@ -9%+`@,@'!a# 2@ذ  /`D@@  i2@Ű  `G@) 2@N   2@N  2@N   2@N   @E  Ej 6@ .B)`C `I@*@ #\#` @V쀢 "@ (`.`-` ,W4` W7`  `W@ @  1!ܘ@VԀ "@ * @) AW0%  `B@2@'  0 0`@ '`&O `@   N @:@`O`@:2O`/`:2H Œ 8N  N@/a @Sג :2@/` O``@` @Sv@ `@ @ "/``@ &r&2@5  a S@ @ :    @S"@" *   @SD `4O R@, @ #\+#`#daȔ#h @T "@ W3W3W3W3W3W3W3 W3" X@ @   ܒa@TxԀ "@ *$*%*0 I@ @  !В!@T^Ȁ "@ W42,&,' H@ @  )Ē!@TC "@ .`(.`).`,.`- W@ @  @T& "@ / */ +/ ./ / F@9 @  N  "@n  J``@` @ `|@ `O`@ @|2O`/``O` "H`|@ `O` G |"O`2@G O``Oֺ  C2H<  @  N  "@3 J @ @ |@ `L`@ @|2O`,``L` "H` |@ `L`` G`|"O`@R6 / `1.`1L`OԢ 㿠; \aL@9 "=O N `N@7 @Rc :2@/` O`@` @R a@ `@ @) /`%!$`a,@, #a @" & &  +`S@a@ :    @R!"@ *   @QŐ 0`,O `C@4@ #\ #`#d"0#h @S "@ W68W5:W5`W4@W4`BW3DW3`F `X@4`@́ #\#`Ą#dbH#hؘԐ @RЀ "@ W5HW5`JW6`LW4NW4`PW3RW3 TW2V `I@ @  9"`@R "@ W1`XW0Z `p7`t `A@@  "p@R "@ 4`4 b3`d `M@  @  b|@R| "@ / f6h5j6`l `B@(`@ #\ @RY "@  @*@ `, .  )`)`)` `T@@  -` 2@ &` $Hx  `E@82@  1"|(xt@@Rp v "@t &@Z p &@V t`c4@R p c4@N  .{.w.s.&;`# 2?`F2H:  @  N `"@0  J`@ @ |@ `N`@ @|2O`.``N` "H` |@ `N` G|"O` 2@  N` Oײ  㿐N `N@,` 4@` @- %+ '`#b$ᬚ@Q @9 !.`.`.`.` `D2H ;a @  2@  㿀N N@G @PC :2@*   @O@P7 :2@. N`@ @O֐1!@ ];@a4@` @ .#`#@+  "aƒ ! 2H-   I2H( %`@ '#\ⴔ#` @Q @; a.` W6`.`.`.`.`  㿠N `A@+` ,@' 59#L :  @$@ `@6@ $`$@O"@ *  @O[`. "1@7p$0" 㿠 `"@ "b   "@ "\  `@"V  㿠; a;B۔ $59`'!/-3aᜰ%㿠;9a 5C1`/ &!+'%%a$ 㿠;9a"5D1` / <&!+ђ'%%b$⨁㿠;9a 5E1` / 4&!+'% %`$$(㿠;9a 5F1`/k ,&!+'%%`$؁㿠;9a#5H1`l/O H&!+}'%%c$ 㿠;9a!`5C1`/3 &!+a'%h%al$p㿠;9a"5J1`,/ @&!+E'%%b$㿠;9a 5K1`/!&!+)'%%`$㿠;9a!d5M1`|/ߔ &!+ %l%ap㿠;5aT3M/`c-)#/ .02p0 $%\% `$`d㿠;7a05N1`X/+%_+02p0 $!ђ%8%a<$@㿠;9a#5N1`/ &!+'%%c$㿠2345 Ð, 1@Kg,3 x7 5 , /@K\, 4&- a<+&!8;) "a@KJ &c8  #  @KC &45 "@K: % "@K2 %   @K, %c<   @K& C%#@a,` v,  + @ *@K  "` ) !@ g(  .  @.`3@K  &- %-`&  U/`   +$,`$+`@J #" F @ @J @" ?% @J%"H 8  @Jݔ "a<a<`5  ,#`U --`@JΒ % `O33Ht bȂt `@ ,@bH`@+`@bM *@bM@  O) @; bȆ  %a@bȀ%!@O  9b!Ԓ  㽠 @J! @J!!!3| `@" !|⠶  `<,(`@  1 - 8-`P@0@$O  `<@ O  W``S  `~R2S?RO2S 2W @\"R|,  5Q!|3(@J? &cX `@< d/7X9!   < ,(`@< `@` @/`R RR (6@....R2```$O ``  < *:`@&O @I! @I!/3#" @ -5  ``H`@ ` 7` @.>`,U 5#H@&O A V ` `V`~  U?5?VU?O5?V5?W@ ː"P , Sc+ @I "H`&`@6 d3aHcc   H A @< @@`3 @/`PPP * 3 ****P 0!`/ ;`H&O @Io! @Ik!35a6`@   Рa E,@ ``4 )`:`) P@0@`,@&O  V  T``~ T?4?TT?O4?T`94?/`W!+@I. !#a @5 d!`к`Р   , @<`@ @3 @.PPP + 2 ****P``0``.  ,;&O 㿠  '   ? 'v$߁b0` .㷠;9"8a,2$-  @ D$-l'"da,$,Lp@? ,t$$@  `'4,eO,A$!!Ėt+$,ߒ @,Ȓ!m`@ #b$-!%@)'~"@-+wbt@1/m<j#X@53cc`@97YV#@;P`L @FD B `J@ <`8@2`.@($! E@aD`Y@#!!an@'%@+)"b$R@/-Hh@@71"53"xb؁㿠3;a;@aVa @a`  ^ZU &O`*`(  ! I $O O HcX a< @ a<   `` `O57H1/"-+c@)'#<%#c4!;#89x351a410/a#-]+Y4)U`l'Qb %MaD #I!@!EB?c=bx; 9aN7!a!a!a㿠;N 7aaf㴐   `@2ON @G  @G1." a,,."@+ %@* @ )`%*!.(,@,` 2 `5N ` Oܰ . .`,`.$-`!+(#@-  + (` ,``4@`1`4`5@2ON 㿠c?%  =    ("2?)`@-`(&(`"@/`* #.`!@+`)  -` @ '`@@!@ @@ ``@ @O`@ @ G - N?@FE .?? G`a.8:085- @ 4 0? =㻠;Aa;aa .` . @F=  @#$ Ӑ @ )!tV'|O%` O 0! 9!$ 0;!$!a$  @   @E` @ @ &OI @E `@+  `   4@Eڐ`@%!4@E   &O$?` @   _` &O`.7)&$'% $ 㿠 @  "@  "H  @  ;"@  H;  a0 Lԝ㿠㰻. .  &R.,  @ %g * <` @43a/ ⠈& ) @  0>  ` = X$ !p`@,`ĀV`@ @ `&H?@3 :@~  @V `@ %  2HV #]2H`V ]@V `@` @V @-`_@V @ - &H?-V$V=` @:`@T@`RV *\3  @ :@@@/`#7`@>`@@/`&1 8@@/`%5`@:`@ @'@/`#@2 8@@ 1b/`?`= H0p ?`@? $@@  b/`=`; H 2 =`@=" @ @ )b/`>`9 H@3 >`@?`$@@+/`:   > @@/`@= =@@/`@8``@<@@ //`g%-`= J@ 20 > = '@@/`@ @/`$3`@8@@ 9 b/`>`:J@ 20 >`@8$@@ V/`b=`;H 30 =`@=%@b>`; J 2p >`@9` @@$2  9`@V  @b?+`<=`H3 =`@=%@V @ @`@ @h`@ (`% / ;  .H h@ @/`%@@V @ - &H?-"V 9  8@V@U @<gK 2 ><&@@KVV@ /  &H?/  V "g=H0p ==&@@  &H?V3  : @@   &H?VV4<`@@$ ݅=`?`#.p0:0@ 6 ڐ ( bg> VH[0p <> $@+0802 6=Ð`V*00:0@ S6 V UU(~gV>`K ?`H0 2 @=>`8`%?`%,p0:0 ) 9` @6  V+p0;00 6 $@" @1@ &  @+ & z @/ @& r @ @& 㿠V @c  6 @ [ @V ' 6 Q @V `6  $  @"  @ @)" @) " @ ) " @)" R `@@ ?" @ ?" @ ?" @ ?" @ ?" @ ?" ( "  @@( " $ @  (" @ ("  @ ( "  @" $Dttttttll (   0 h 0 h 8 t D(L\l  4Hl 㿠 @ d ^b$`@- @ `@ ) & *`#@ 7  &  `A@  V  -08p0@6 x V  .p09p06 `@` & g 2@   & $` @% $@& $@ & Q @@ @& ` @9 & B @ & `@  & 3 @ @ & `@!  & $ @  & `@`   `` @.  }. @/@ @w& `#@  p& `(@ @ i& `-@@  b& `2@`6 #&  @V% @R& @ & א @H- @D& `;@`? ;& ǐ @ &  @03 @,& @  &  @! &  @  & `C@) &  @+ @&  @9 & `H@`L $ & $@ `YV @  & @`\s V  ,0;p0@ 6 k V  .0:0@ 6 @ `b` V  -p08p06 @ V bg.`@?`H0 =?`&6 `@ & ې` @`2 $& $@ `P6 V  ,p08p06 @ `Z & @+V  & @@  6  @V `6 V "g.@=J 2p >`='t6 `@`2 $`@m& $@ `K `& d@  V  -0080Y6  V  .p0;00 6 ې V   /00 $:0 6 D& $`@@ =& `-@`A $ 6& $@`K $ 0& $@ `U & M'@   & D V  .09p06 `@@  & `(@`< ;& @ @ & `P@ &  V  ,080@6 `2@  !&  p V  .09p06 `@ ` & @` $ & $@`" `& P @ `& @@ & `.@ @& `:@  & `F@% @& `P@V "g/ @=J 2p >=%6  V  .0;0@ 6  +^ *@* @  &  @v `r&  &  @h `d&   &  2@   & % @R- $N& $  & mӐ @D @&  & _Ő @6 2&   & Q @( ` $&  & C b& < $& 5V ) & `@  6 $ &  @  &  & v @ &  & g @ `&  ! @ $ & $ & Q @ `&  & B @ `& Ґ  & 3 @  & Ð' @3 &  @ @&  @  &   @}   y&  $`@u& $ $ q& $ '@l&  -@g&  9b&  3]&  @X&  S&    N&  @@I&  %@D&  +?&  :& Đ @5/ @1&  ,&  '&  @"  @ &  $ & $ $& $ $` & $ @  $ & $ $`& $ $& $E㿠 @7 $& $ @  $& $y @  $& $V `@ m 2@V V 6 V @ a 2@V V  6 V `@ U 2@V V 6 V `@ I 2@ $V  6  $+@ 7< @3 $& $& $0 @; $& $h @뀦 o@逦 "@. &+`  * `@9 $ @%`@5% @  %/6 56 66&& ?&$;a`@/%m d@   d$ d) : $8 3? &H76  /,  @g<`; J 2p =<`!@Gg< = H0 8`< # O`@ &$"cV* 6 ;66&& &$, '@g,` $;=` 0K 20 ==`, " @` O&ڐq@ ̈ 0`O! bg<`=`K 30 :<`"@ @ @ bg< 9`H0 8`< %@  OԮ 0@ $@ &$A* $+ + &@ &@ $' &$@-@$@&$V @9$@&$88888884(㾈1 !        @R d !X  " cHcH"`@!+`@%4% 4$4" 4'`4'  4& 4&4$4$`4`@$O @ @@ @`@ @ @ @@`@- -`@SP 3a@KaH  @!T @  @`$`@( 8 @<H@LT@X`@d`l`@p#\#\x#d;#`b9#h#l#p#t!" # 㿠;1aa` /  .`@8’ &# @  ;` @O6"O5# 㿠. \?`@ @ "@ 㿠; 'b;7.p8/c:08.㬁㻠  @  @;bL@Ԑ @# ;aҒ$@$ 㻠;bt@ @ @7@  @# @쫒 @짒 $>M@$l 㿠@옒 : @G 㿠@쏒 @싒 @ " @ =`@&@@ @ '=`@.H; _@%@@' 㿠@ٝ@l `@  @eO@ 㿠@م@T `@  @MO@ 㿠@m@< `@  @5O@ߒ 㿠@' @# /@@Ґ 㿠@ @ 7@@Ő 㿠@  @  ?@@ڸ 㿠'P7/'T 'XP@  @ӒN`@J N@ b@ ,@=N@@:O"H.`7N@l@ b@d"H `-N@@ s"H`'N@@# ` !N@`` @# N@`` @# N@@# `  N@ `@ג  @#N@`O@76  @'@` @a  N%`l@ O@@b"H(`d"H `L`@s"H'`F` `@X@> @"S %9` ``@J@0 @"E & +` `@"} -#` `@L@ )# @"<$` +``@rc$ @{ @ @"5 &`` $ON @r$ 㿘;9/c0;c<#@)@O.` 㿘?9';7cD#T\2@?㿘;97#p/c,;xc`@c|53, B Pc,㿘;97#/c|;㘐c@c53| ( Pc|㿘;9/c;c#͚2@O 㿘;9'c;cԔ#ؖ@ @#%㿘?9';7cܒ#2@?㿘;9/c;` 2@O ``( ,`0`D Hy`L`X \p```l pg`t` ^㿘;9'`;` S2@ 3p?㿘;9'`;` ?2@ 3p?㻠@Y ;9@'aa;@@]`H5@A  83@< @@B]@@@@0@`$@! 㿠;a`@?9 @\!㿠;a`@ 9@E!2 3p?㿠;a`@ 9@!2 3p?㿠;9`;@`7@ 5@@@a@㿠 @  @;a@ @!v 㿠 @  @9!(@  @Ж @;a8@ @ l . 㿠 @  @;a`@ @!I 㿠 @ { @9!p@u  @ @;a@j @ ? . 㿠 @ ^ @;a@X @! 㿠 @ N @9!@H  @v @;a@= @  . 㿠 @ 1 @;a@+ @  㿠 @ ! @9"@  @I @;b@ @ . 㿠 @  @;b8@ @  㿠 @ @9"H@  @ @;bX@ @ & 㿠 @ה @;b@ѐ @  㿠 @ǔ @9"@  @ @;b@ @ & 㿠 @ @;b@ @ h 㿠 @ @9"@  @– @;b@ @^ . 㿠 @} @;c@w @ ; 㿠 @m @9# @g  @ @;c0@\ @1 .  㿠 @P @;cX@JW @  㿠 @@ @9#h@:  @h @;cx@/ @ 6  㿠 @# @;c@W @ 㿠 @ @9#@   @; @;c@ @ה 6  㿠 @ @;c@ @ 㿠 @ @9#@  @ @;`@Ր @ . 㿠 @ɔ @;`0@Ð @ 㿠 @ @9 @@  @ @;`P@ @} . 㿠 @ @;`x@ @Z 㿠 @ @9 @  @ @;`@{ @P & 㿠 @o @;`@i @- 㿠 @_ @9 @Y  @ @;`@N @# . 㿠 @B @;a@< @ 㿠 @2 @9!@,  @Z @;a(@! @ . 㿠 @ @;aP@ @Ӑ 㿠 @ @9!`@  @- @;ap@ @ɔ & 㿠 @ @;a@ @ 㿠 @ؔ @9!@Ґ  @ @;a@ǐ @ & 㿠 @ @;a@ @y 㿠 @ @9!@  @Ӗ @;b@ @o &  㿠 @ @;b(@ $@L 㿠 @~ @9"8@x  @ @;bH@m @B &$ 㿠 @a @;bp@[ (@ 㿠 @Q @9"@K  @y @;b@@ @ &( 㿠 @4 @;b@. ,@ 㿠 @$ @9"@  @L @;b@ @ &, 㿠;c@@L @}?  @. @/@  @ʔ "  @;3c(@ cH@ .0@Ő 㿠;cX@Է@ @O?  @ @+c`@ ǐ @ "  @/@  @ -.`0 .`1 .`2 .`3 㿠 @ @;c@  @@e 㿠 @ @9#@   @ @;c@  @[ .@ 㿠 @z @;c@ t A@8 㿠 @j @9#@ d  @ @;`@ Y @. .A 㿠 @M @;`0@ G B@  㿠 @= @9 @@ 7  @e @;`P@ , @ .B 㿠 @  @;`x@ O C@ސ 㿠 @ @9 @   @8 @;`@  @Ԕ .C 㿠 @ @;`@  D@ 㿠 @ @9 @ ݐ  @  @;`@ Ґ @ .D 㿠 @Ɣ @;a@ O E@ 㿠 @ @9!@   @ޖ @;a(@  @z .E 㿠 @ @;aP@  F@W 㿠 @ @9!`@   @ @;ap@ x @M .F 㿠 @l @;a@ f G@* 㿠 @\ @9!@ V  @ @;a@ K @  .G 㿠 @? @;a@ 9W @ 㿠 @/ @9!@ )  @W @;b@  @ 6 㿠 @ @;b(@ W @А 㿠 @ @9"8@   @* @;bH@  @Ɣ 6 㿠 @ @;bp@ ߐW @ 㿠 @Ք @9"@ ϐ  @  @;b@ Đ @ 6 㿠 @ @;b@ W @v 㿠 @ @9"@   @ Ж @;b@  @l 6 㿠 @ @;c@  @I 㿠 @{ @9#@ u  @  @;c @ j @? . 㿠 @^ @;cH@ X @ 㿠 @N @9#X@ H  @ v @;ch@ = @ .  㿠 @1 @;c@ + @ 㿠 @! @9#@   @ I @;c@  @ .  㿠 @ @;c@  @ 㿠 @ @9#@   @  @;c@  @ .  㿠 @ה @;` @ ѐ @ 㿠 @ǔ @9 0@   @  @;`@@  @ . 㿠 @ @;`h@  @h 㿠 @ @9 x@   @ – @;`@  @^ . 㿠;`@[@’ @?  @  @3`@ k @@ "  @9 @ _`@# 㿠;`@3@њ @˒?  @ | @3a@ C @ "  @9! @ 8 @  /` 㿠 @+ @;a@@ % @ 㿠 @ @9!P@   @ C @;a`@  @ߔ & 㿠 @ @;a@  @ 㿠 @ @9!@   @  @;a@ ݐ @ & 㿠 @є @;a@ ː @ 㿠 @ @9!@   @  @;a@  @ & 㿠 @ @;b@  @b 㿠 @ @9"(@   @  @;b8@  @X &  㿠 @w @;b`@ q $@5 㿠 @g @9"p@ a  @  @;b@ V @+ &$ 㿠 @J @;b@ D (@ 㿠 @: @9"@ 4  @ b @;b@ ) @ &( 㿠 @ @;b@ W @ې 㿠 @  @9#@   @ 5 @;c@ @є 6 㿠 @ @;c8@ @ 㿠 @ @9#H@ڐ  @  @;cX@ϐ @ . 㿠 @Ô @;c@ @ 㿠 @ @9#@  @ ۖ @;c@ @w . 㿠 @ @;c@W @T 㿠 @ @9#@  @  @;c@u @J 6 㿠 @i @;`@cW @' 㿠 @Y @9 @S  @  @;`0@H @ 6 㿠 @< @;`X@6W @ 㿠 @, @9 h@&  @ T @;`x@ @ 6 㿠 @ @;`@  @͐ 㿠 @ @9 @  @ ' @;`@ @Ô .  㿠 @ @;`@ܐ @ 㿠 @Ҕ @9 @̐  @  @;a@ @ .  㿠 @ @;a0@ @s 㿠 @ @9!@@  @ ͖ @;aP@ @i .  㿠 @ @;ax@ @F 㿠 @x @9!@r  @  @;a@g @< .  㿠 @[ @;a@U @ 㿠 @K @9!@E  @ s @;a@: @ . 㿠 @. @;b@( @ 㿠 @ @9"@  @ F @;b(@  @ . 㿠 @ @;bP@ @ 㿠 @ @9"`@  @  @;bp@ @ . 㿠 @Ԕ @;b@ΐO @ 㿠 @Ĕ @97@"@ߐ @ @;b@ @Ĕ . 㿠 @ @;b@W @a 㿠 @ @9"@  @ @;c@ @W 6 㿠;@=Wa 㿠  @ @;c0@h @= ;7a 㿠;@"Waā 㿠  @ @;cX@M @" ;7aā 㿠  @r @@ @  @  H*08:p8@% ;c@( 㿠  @S @@ے @  @ ,*08:p8@ ;c@  㿠  @4 @@ @  @ϔ   ;c@ 㿠  @ @@ @  @ h ;`@Ӑ 㿠  @ @@ @  @ h ;` @ 㿠  @ @@k @  @~ h ;`D@ 㿠  @Ȗ @@P @  @c h ;`h@ 㿠  @ @  @ @@. @ @A  @< hԐ ;`@Z 㿠  @ @@  @  @  i  ;`@? 㿠@ @;i `@/ 㿠@ @ ;j *00:p0@ a @ 㿠@Ւ @ ;j-@Ԑ a,@ 㿠  @3 @@ @  @Δ j8*00:p0@ ;aT@ 㿠  @ @=3ax@ @  @25@ @ @'  @ @ @ @ @  @   @  @ k ;a@ 㿠  @ʖ @@R @  @e l  ;a@ 㿠  @ @(  @ @!  @ @@) @ @<  @7  @2 k ;a@O 㿠  @z @ 9"@f @o @@ @ @   @E *08:p8l  ;b@" 㿠;b4@@ @I @@ђ @  @$ *08m4:08 ;b<@ 㿠  @- @#9"d@ @" @@ @ @  @ߔ m#*00:p0@ ;bp@Ґ 㿠  @ @5  @ @.  @ @'  @ @ @p @ @  @~  @y  @t m ;b@ 㿠  @ @  @ @@< @ @O  @J m[*00:p0@1 ;b@d 㿠  @ @0  @ @)7@t @} @@ @ @  @  @5 m8*00:p0@ ;b@' 㿠  @R @P  @K @I  @D @B-@0 @9 @7/ @% @. @,@ @' @ɔ  @Ĕ  @  @ *  @ *08;08?`n*08:p8@ǐ ;c(@ʐ 㿠  @ @C  @ @bl#@s@8"x!@m@2@g@,b@a@&"@[@ @U@@O@b@I@"@C@ b@=@ "@7@@1@@+@c@%@c@ @# @@0@@ې@@@֐cP@ @ѐ`@@̐p@@ǐc@@#@@@@@@c@@#@@@ސ@c@ؐ@#@Ґ@@̐@;9`;@Đ@`7@@ 5@@}03@@w@/@@q`P-@@k`+@@ep)@@_`'@@Y %@@S#@@M!@@G`;@|@A 9@v@;75@n@33`/@f@+- +@^@#)'@V@%#@N@!a@G@ ! @A@ a0@;@ !@@5@P@/@`@)@ap@#@a;@@!9@@ܐ7@@֐5@ @Аa3@@ʐ/@@Đ-@@a+@@!)@@'@@%@@b #@ې@"0!@Ր@<@ϐ@bH@ɐ@"X@Ð@d@@p@@|b|@@v"@@p b@@j "@@d@@^@@Xb@@Rb@@M"@@H@~@C@y@>c @t@9,@o@48@j@/cD@e@*#P@`@%\@[@ d@V@cp@Q@#|@L@@F@ c@@@#@:@@4@@.@c@(@#@"@ c@@ #@@ې@@Ր@ @ϐ`@@ɐ;9`(7@@ 45@@@3@@L/@@`X-@@d+@ސ@p)@ؐ@`'@Ґ@ %@̐@#@Ɛ@!@@`;@@ 9@@y75@@q3`/@@i- +@@a)'@@Y% #@@Q!a@@J!$@@D a0@y@> !<@s@8H@m@2T@g@,a`@a@&al;@[@ !x9@U@7@O@5@I@a3@C@/@=@-@7@a+@1@!)@+@'@%@%@@a#@@ސ!!@@ؐ@ @Ґb@@̐" @@Ɛ,@@8@@bD@@"P@@ b\@@ "h@ݐ@t@א@@ѐ@b@ː@b;@Ő@"@@@@@@{b@@v@@q@@lb@@g"@@b @@]@@Xc(@@S#4@@N@@@HcL@}@B#X@w@<d@q@6p@k@0c|@e@*#@_@$ c@Y@ #@S@@M@@G@ c@A@c@<@97#5@4@3@.@/@(@`-@"@ +@@)@@ې`$'@@Ր 0%@ @ϐ<#@@ɐH!@@Ð`T;@@ `9@@7l5@@3`x/@@- +@ڐ@)'@Ґ@%#@ʐ@!`@Ð@ @@ `@@|  @@v@@p@@ja@@da;@@^!$9@@X47@@R@5@@LaL3@@FX/@{@@d-@u@:at+@o@4!)@i@.'@c@(%@]@"a#@W@!!@Q@@K@a@E@ !@?@@<@@[?@?@֐ @.@@M?@?@b@@"(@@ܐ b<@@֐ "P@ @А\@@ʐh@@Đbx@@b@@"@@@@@@b@@@ې@@֐@b@ѐ@#@̐@@ǐ@$@@c4@@#D@@}T@@wcd@@q#t@@k@@e@@_c@@Y#@@S c@@M #@@G@|@A@v㿠;9`;@e`7@a ,5@]<H@Y@W㿠 @ @;`T@{W @? 㿠 @q @9 d@k  @ @;`t@` @5 6 㿠 @T @;`@N @ 㿠 @D @9 @>  @l @;`@3 @ . 㿠 @' @;`@! @ 㿠 @ @9 @  @? @;a@ @۔ . 㿠 @ @;a,@ @ 㿠 @ @9!<@  @ @;aL@ِ @ . 㿠 @͔ @;at@ǐ @ 㿠 @ @9!@  @ @;a@ @ . 㿠 @ @;a@W @^ 㿠 @ @9!@  @ @;a@ @T 6 㿠 @s @;b@m @1 㿠 @c @9"@]  @ @;b$@R @' . 㿠 @F @;bL@@ @ 㿠 @6 @9"\@0  @^ @;bl@% @ .  㿠 @ @;b@W @א 㿠 @  @9"@  @1 @;b@ @͔ 6  㿠 @ @;b@ @ 㿠 @ܔ @9"@֐  @ @;b@ː @ .  㿠 @ @;c$@ @} 㿠 @ @9#4@  @ז @;cD@힐 @s .  㿠 @ @;cl@판 @P 㿠 @ @9#|@|  @殺 @;c@q @F . 㿠 @e @;c@_ @# 㿠 @U @9#@O  @} @;c@D @ . 㿠 @8 @;c@2W @ 㿠 @( @9 @"  @P @;`@ @ 6 㿠 @  @;`D@W @ɐ 㿠 @ @9 T@  @# @;`d@ @ 6 㿠 @ޔ @;`@ؐW @ 㿠 @Δ @9 @Ȑ  @ @;`@콐 @ 6 㿠 @ @;`@쫐W @o 㿠 @ @9 @원  @ɖ @;`@쐐 @e 6 㿠 @ @;a@~ @B 㿠 @t @9!,@n  @ @;a<@c @8 . 㿠 @W @;ad@Q @ 㿠 @G @9!t@A  @o @;a@6 @  . 㿠 @* @;a@$W @ 㿠 @ @9!@  @B @;a@  @ޔ 6 㿠 @ @;a@ @ 㿠 @ @9"@  @ @;b@ܐ @ . 㿠 @Д @;b<@ʐ @ 㿠 @ @9"L@뺐  @ @;b\@믐 @ . 㿠 @ @;b@띐 @a 㿠 @ @9"@덐  @ @;b@낐 @W 6 㿠 @v @;b@pW @4 㿠 @f @9"@`  @펖 @;b@U @* 6  㿠 @I @;c@CW "@ 㿠 @9 @9#$@3  @a @;c4@( @ 6" 㿠 @ @;c\@ @ڐ 㿠 @  @9#l@  @4 @;c|@ @Д & 㿠 @ @;c@ @ 㿠 @ߔ @9#@ِ  @ @;c@ΐ @ & 㿠 @” @;c@꼐 @ 㿠 @ @9#@꬐  @ږ @;` @ꡐ @v . 㿠 @ @;`4@ꏐ @S 㿠 @ @9 D@  @쭖 @;`T@t @I .  㿠 @h @;`|@bW @& 㿠 @X @9 @R  @쀖 @;`@G @ 6  㿠 @; @;`@5W @ 㿠 @+ @9 @%  @S @;`@ @ 6  㿠 @ @;a @W @̐ 㿠 @ @9!@  @& @;a,@ @” 6 㿠 @ @;aT@ېW @ 㿠 @є @9!d@ː  @ @;at@ @ 6 㿠 @ @;a@鮐W @r 㿠 @ @9!@鞐  @̖ @;a@铐 @h 6 㿠 @ @;a@遐 @E 㿠 @w @9!@q  @럖 @;b@f @; . 㿠 @Z @;b,@T @ 㿠 @J @9"<@D  @r @;bL@9 @ . 㿠 @- @;bt@'W @ 㿠 @ @9"@  @E @;b@  @ 6 㿠 @ @;b@ @ 㿠 @ @9"@  @ @;b@ߐ @ & 㿠 @Ӕ @;c@͐ @ 㿠 @Ô @9#@轐  @ @;c$@貐 @ & 㿠 @ @;cL@蠐 @d 㿠 @ @9#\@萐  @꾖 @;cl@腐 @Z &  㿠 @y @;c@s $@7 㿠 @i @9#@c  @ꑖ @;c@X @- &$ 㿠;c@*@ @’?  @s @3c@: @ "  @9 @.`(@ 㿠;`$@@i @?  @K @3`,@ @ "  @9 L@ @ܔ /`( 㿠;`l@ؐ@? @p?  @! @3`t@ @ "  @9 @ܐ`,@ 㿠;`@@ @H?  @ @3`@ @ "  @9 @結 @ /`, 㿠 @ @;`@碐 0@f 㿠 @ @9! @璐  @ @;a@燐 @\ .0 㿠 @{ @;aD@u 1@9 㿠 @k @9!T@e  @铖 @;ad@Z @/ .1 㿠 @N @;a@H 2@  㿠 @> @9!@8  @f @;a@- @ .2 㿠 @! @;a@O 3@ߐ 㿠 @ @9!@   @9 @;a@ @Ք .3 㿠 @ @;b@ 4@ 㿠 @ @9",@ސ  @  @;b<@Ӑ @ .4 㿠 @ǔ @;bd@O 5@ 㿠 @ @9"t@汐  @ߖ @;b@榐 @{ .5 㿠 @ @;b@攐 6@X 㿠 @ @9"@愐  @貖 @;b@y @N 66 㿠 @m @;b@gO 8@[ 㿠 @] @97@V#@x @聖 @;c@H @] .8 㿠 @< @;cD@6O 9@* 㿠 @, @97T@%#d@G @P @;cl@ @, .9 㿠 @  @;c@ @ɐ 㿠 @ @9#@  @# @;c@ @ & 㿠 @ޔ @;c@ؐ @ 㿠 @Δ @9#@Ȑ  @ @;c@彐 @ & 㿠 @ @;`$@嫐 @o 㿠 @ @9 4@囐  @ɖ @;`D@吐 @e . 㿠 @ @;`l@~ @B 㿠 @t @9 |@n  @眖 @;`@c @8 .  㿠 @W @;`@QW @ 㿠 @G @9 @A  @o @;`@6 @  6  㿠 @* @;`@$W @ 㿠 @ @9! @  @B @;a@  @ޔ 6  㿠 @ @;aD@W @ 㿠 @ @9!T@  @ @;ad@ܐ @ 6 㿠 @Д @;a@ʐW @ 㿠 @ @9!@亐  @ @;a@䯐 @ 6 㿠 @ @;a@䝐W @a 㿠 @ @9!@䍐  @滖 @;a@䂐 @W 6 㿠 @v @;b@p @4 㿠 @f @9",@`  @掖 @;b<@U @* . 㿠 @I @;bd@C @ 㿠 @9 @9"t@3  @a @;b@( @ . 㿠 @ @;b@W @ڐ 㿠 @  @9"@  @4 @;b@ @Д 6 㿠 @ @;b@ @ 㿠 @ߔ @9#@ِ  @ @;c@ΐ @ & 㿠 @” @;c<@㼐 @ 㿠 @ @9#L@㬐  @ږ @;c\@㡐 @v & 㿠 @ @;c@㏐ @S 㿠 @ @9#@  @孖 @;c@t @I &  㿠 @h @;c@b $@& 㿠 @X @9#@R  @倖 @;c@G @ &$ 㿠 @; @;`@5 (@ 㿠 @+ @9 $@%  @S @;`4@ @ .( 㿠 @ @;`\@ )@̐ 㿠 @ @9 l@  @& @;`|@ @” .) 㿠 @ @;`@ې *@ 㿠 @є @9 @ː  @ @;`@ @ .* 㿠 @ @;`@⮐ +@r 㿠 @ @9 @➐  @̖ @;a @ⓐ @h .+ 㿠 @ @;a4@⁐ ,@E 㿠 @w @9!D@q  @䟖 @;aT@f @; ., 㿠 @Z @;a|@T .@ 㿠 @J @9!@D  @r @;a@9 @ 6. 㿠 @- @;a@' 0@ 㿠 @ @9!@  @E @;a@  @ 60 㿠 @ @;b @ @ 㿠 @ @9"@  @ @;b,@ߐ @ & 㿠 @Ӕ @;bT@͐ @ 㿠 @Ô @9"d@ὐ  @ @;bt@Ა @ & 㿠 @ @;b@᠐ @d 㿠 @ @9"@ᐐ  @㾖 @;b@ᅐ @Z & 㿠 @y @;b@s @7 㿠 @i @9"@c  @㑖 @;c@X @- &  㿠 @L @;c,@F @  㿠 @< @9#<@6  @d @;cL@+ @ & 㿠 @ @;ct@ @ݐ 㿠 @ @9#@   @7 @;c@ @Ӕ & 㿠 @ @;c@ @ 㿠 @ @9#@ܐ  @  @;c@ѐ @璉 . 㿠 @Ŕ @;`@࿐ @ 㿠 @ﵔ @9 @ௐ  @ݖ @;`$@ऐ @y . 㿠 @ @;`L@ @V 㿠 @ @9 \@  @Ⱆ @;`l@w @L . 㿠;`@I@ @?  @⒖ @3`@Y @. "  @9 @M`@ 㿠;`@!@ @?  @j @3`@1 @ "  @9!@& @ /` 㿠;a$@@^ @?  @@ @3a,@ @ܔ "  @9!L@`@￐ 㿠;al@ϐ@6 @g?  @ @3at@ߐ @ "  @9!@Ԑ @ /` 㿠;a@@  @=?  @ @3a@ߵ @ "  @9!@ߩ`!@m 㿠;a@}@ @?  @Ɩ @3b@ߍ @b "  @9"$@߂ @W /`! 㿠 @u @;bD@o $@3 㿠 @e @9"T@_  @ፖ @;bd@T @) .$ 㿠 @H @;b@B %@ 㿠 @8 @9"@2  @` @;b@' @ .% 㿠 @ @;b@ &@ِ 㿠 @  @9"@  @3 @;b@ @ϔ .& 㿠 @ @;c@ '@ 㿠 @ޔ @9#,@ؐ  @ @;c<@͐ @ .' 㿠 @ @;cd@޻ (@ 㿠 @ @9#t@ޫ  @ٖ @;c@ޠ @u .( 㿠 @픔 @;c@ގ @R 㿠 @턔 @9#@~  @ଖ @;c@s @H & 㿠 @g @;c@a @% 㿠 @W @9 @Q  @ @;`@F @ . 㿠 @: @;`<@4 @ 㿠 @* @9 L@$  @R @;`\@ @ . 㿠 @  @;`@ @ː 㿠 @ @9 @  @% @;`@ @ . 㿠 @ @;`@ڐO @힐 㿠 @Д @9 @ʐ  @ @;`@ݿ @씔 . 㿠 @쳔 @;a@ݭ @q 㿠 @죔 @9!$@ݝ  @˖ @;a4@ݒ @g . 㿠 @솔 @;a\@݀O @D 㿠 @v @9!l@p  @ߞ @;a|@e @: .  㿠;@ Wa 㿠  @߄ @;a@K @  ;7a 㿠;@Wa 㿠  @i @;a@0 @ ;7a 㿠  @U @'@ @  @-UH;/;@ b47@-- ⴔ@/ @@ 㿠  @+ @#b@@ @ǔ  @)U!H,,+b`@9@/`"  "@ٔ `O6 㿠  @ @%@Ő @뚔  @-` H;/;@ܴb7@Ր,⠔'@/ @@썐 㿠  @Ӗ @!"@ܚ @o  @)! @H,`,`+b@܉9'@/`"  8@뀔 `O& 㿠;@Ab 㿠  @ޞ @;c @e @G ;'b 㿠;@&b 㿠  @ރ @;c4@J @, ;'b 㿠  @o @!#\@6 @   @)! @H;+;c|@%c3,`'@@D/ ` @.@ 㿠  @B @@  @ޔ  @%` H..'@'@3/``  @ . 0 O& 㿠;@`$ 㿠  @  @;c@Ґ @괔 ;'`$ 㿠;@`( 㿠  @ @;`@۷ @Ꙕ ;'`( 㿠  @ܖ @! <@ۣ @x  @)!@H;+;`\@ے`|3,`'@@/ `Д&.@i 㿠  @ݯ @@v @K  @%`H..'@e'@3/``ж' @\ . ( O& 㿠;@`ԁ 㿠  @x @;`@? @! ;'`ԁ 㿠;@`؁ 㿠  @] @;`@$ @ ;'`؁ 㿠  @I @%@ @  @-`H;/;<@a\7@ ,'@/ @@ؐ 㿠  @ @!!h@ @麔  @)!@H,`,`+a@Ԑ9# '@@͔  /`&` &` &` 㿠;@c 㿠  @ @;a@ڰ @钔 ;'c 㿠;@qc 㿠  @Ζ @;a@ڕ @w ;'c 㿠@I @; a@ 㿠;b@ @ܦ @@. @  @達 *08:08 ;b$@_ 㿠;bL@} @܆ @@ @  @H   ;b`@@ 㿠  @k @@ @  @  *08:p8@ ;b@! 㿠  @L @@Ԓ @  @  *00:p0@ϐ ;b@ 㿠  @- @@ܵ @  @Ȕ  *00:p0@鰐 ;b@ 㿠;c@ @  @@ܒ @  @̔  *00:p0@鍐 ;c@ 㿠  @ @@s @  @膔  @v ;c<@٢ 㿠  @͖ @@U @  @h  @X ;c`@ل 㿠;c@ @۫ @@3 @  @m  i*08:p8@^ ;c@a 㿘   @ۋ @H@ۄ @A @} @: @v @3 @o @,@ @' @  '@  @  @  @  D@ې@ؐ ;c@  㿠@Œ @;  c@ 㿠@۵ @;  ` @ 㿠@ۥ @;  `4@ې 㿠@ە @; n `X@ː 㿠@ۅ @; y `|@ػ 㿘  @ @<  @ߖ @5  @ؖ @.  @і @'@Y @" @l ' @t  @o  @] \*08:p8@r@? ; `@r 㿠  @ڝ @@% @  @8  ; `@W 㿠  @ڂ @@  @  @ E ; `@< 㿠  @g @  @` @@ @ @  @ 9 ; a @ 㿠  @? @@ǒ @  @ڔ  ; aH@ 㿠@ڳ @;  ap@ 㿠@ڣ @ ; *00:p0@硐 a@Ր 㿠@ڏ @ ; C@玐 a@ 㿠  @ @@u @  @戔 G*00:p0@p ; a@ף 㿠; b@ @ʖ @@R @  @挔  ; b @ׄ 㿠; b0@ @٫ @@3 @  @m  ; b<@e 㿠; b`@ @ٌ @@ @  @N  ; bl@F 㿠; b@d @m @@ @  @/ z*08:p8@  ; b@# 㿠; b@A @J @@Ғ @  @  *@ΐ ; b@ 㿠; c@ @( @#7 @ @ @@٥ @ @ߔ  @ڔ *08:p8@ʐ ; c(@͐ 㿠; cP@ @ @7 \@ @ @@q @ @嫔  @妔 ʐ ; cp@֝ 㿠  @Ȗ @  @ @@I @ @\  @W ؐ*00:p0@> ; c@q 㿠; c@ @ؘ @@  @  @Z  ; c@R 㿠; c@p @y @7 @e @n @@ @ @0  @+  ; ` @" 㿠; `0@@ @I @  @B @@ʒ @ @  @ؔ  ; `<@ 㿠; ``@ @ @Q  @ @J' l@ @  @?)  t@ @ @4+ `|@ @ @)@} @$ @䷔  @䋔  @Ɣ *  @ *  @伔 ? *08;08>`!ϖ ; `@Ք 㿠; `@ @׻ @6/ @ @װ @+3 `@ @ץ @ @- @ @g  @{ *  @v *08:8? #*08:p8@J ; `@M 㿠; `@k @t @@ @  @6 $3*08:p8@' ; `@* 㿠  @U @0  @N @)7 @: @C @@˒ @ @ޔ  @ٔ  @ $-*00:p0@亐 ; a$@ 㿠; aH@  @ @5  @  @.  @ @'  @ @ @ׇ @ @  @㕔  @㐔  @㋔ $: ; aT@ԧ 㿠  @Җ @:  @˖ @3  @Ė @,5 x@ @ֹ @!@A @ @T  @O  @J  @ㅔ *08:8%W ; a@` 㿠  @֋ @?  @ք @8/ @p @y @-3 a@e @n @"@ @ @   @  @? *  @: *08:8?`%+ ; a@ 㿠  @? @  @8 @@ @ @Ӕ  @Δ %A ; a@ 㿠  @ @  @ @@֘ @ @⫔  @⦔ %C ; a@Đ 㿠  @ @  @ @@p @ @⃔  @~ %C ; b @Ӝ 㿠  @ǖ @  @ @@H @ @[  @V %D ; bD@t 㿠  @՟ @  @՘ @@  @ @3  @. %  ; bp@L 㿠  @w @  @p @@ @ @   @ %  ; b@$ 㿠  @O @@ג @  @ % ; b@  㿠  @4 @@ռ @  @ϔ % ; b@ 㿠  @ @  @ @@՚ @ @᭔  @ᨔ %, ; c @Ɛ 㿠  @ @@y @  @ጔ %: ; cL@ҫ 㿠  @֖ @@^ @  @q %h ; cx@Ґ 㿠  @Ի @@C @  @V %| ; c@u 㿠  @Ԡ @  @ԙ @@! @ @4  @/ %f ; c@M 㿠  @x @@ @  @ %` ; c@2 㿠; `(@P @Y @@ @  @ %R*08:p8@  ; `<@ 㿠; `d@- @6 @@Ծ @  @ %N*00:p0@Ṑ ; `p@ 㿠  @ @  @ @@Ԙ @ @૔  @ঔ &*00:p0@ፐ ; `@ 㿠  @ @  @ @@l @ @  @z &3 ; `@ј 㿠@R @; &^ `@ш 㿠@B @; & a@x 㿠; a(@ @ӟ @@' @ 3@` R b.'.M`8@N ; a<@Q 㿠; ad@o @x @@ @ 3@9 R b.'.M`9@' ; ax@* 㿠; a@H @Q @&@ْ @! @  @-R '.&@-`$"@  L`87 3p?.8 .8:p8@ ; a@ 㿠; a@ @ @#@Ӣ @ #@۔ R b,%,`6 @ + 3' c.  ` `4 `@ ; a@п 㿠; b@ݐ @ @$@n @ #@ߧ R b,%,`6 @ + 3' c.M -p8K`5-p8:p8@W ; b(@Њ 㿠; bL@ @ұ @@9 @  @s 3p?@e ; b`@h 㿠; b@ @ҏ @@ @  @Q 3p?@C ; b@F 㿠; b@d @m @@ @  @/  .8:p8@  ; b@# 㿠; b@A @J @@Ғ @  @   @.8:p8@ ; c@ 㿠; c$@ @' @@ү @  @ @D*08:p8@ڐ ; c8@ݐ 㿠; c`@ @ @@Ҍ @  @Ɣ @ ; ct@Ͼ 㿠@7 㠒 @  㬒 @ "5  @ o Ē @  cԒ @ ; c @ 3 c @ /  @ -  @  `$ @ + `4 @} )  D @w  `T @q ' d @k % x @e # ` @_ !   @Y  ਒ @S  ` @M   Ȓ @G    @A   ` @;   ! @5 9 ! @/  ( @) 7 4 @#  @ @  L @  a\ @ ; ah @  3 ax @ / ᄒ @ !-  @ " a @ #+ a @ $) !̒ @ % aؒ @ &'  @ۖ '%  @Ֆ (# b @ϖ )! " @ɖ *   @Ö + b0 @ , "@ @ -  "T@ .  bd @ 0  "t @ 19 " @ 2 ⌒ @ 37 ☒ @ 4 ⬒ @ 5 Ē @ 6 bԒ @ 7; b @{ 83 b @u 9/  @o :-  @i ; c @c <+ c, @] =) #8 @W > cH @Q ?' X @K @% ` @E A# ch @? B! #x @9 C ㈒ @3 D c @- E # @' F  #@! H  c @ I  #̒ @ J9 #ܒ @ K  @  L7  @ P   @ Q  @ R `, @ S; `< @ T3 `L @ U/ \ @ߖ V- l @ٖ W `| @Ӗ X+ ` @͖ Y)   @ǖ Z ` @ S' ༒ @ T% ̒ @ U# `ܒ @ V!   @ _  @ d a @ e !  @ f  !,@ h  a< @ i  !L @ j9 !\ @ k p @y l7 ဒ @s m ᐒ @m n  @g o a @a p; a @[ q3 aВ @U r/  @O s-  @I t b @C u+ b @= v) "  @7 w b0 @1 x' @ @+ y% P @% z# b\ @ {! "h @ | x @ } b @  ~ " @   "@   b @   " @  Ē @  В @  ܒ @  b @ݖ ; b @ז 3 b @і /  @˖ -   @Ŗ  c @ + c$ @ ) #0 @  c< @ ' H @ % P @ !# c\ @ "   ; ch ; @ #ct 3 @ $c / @ %㔐 - @ & + @y 'c ) @s (# ' @m - % @g 7̐ # @a AcԐ ! @[ B#ܐ ;@U F  @O K c @I M  @C P @= Z` @7 [`( @1 d  0@+ `@ @%  P @` @ p @`| @  ` 3@ ` /@ ਐ -@  +@`Đ )@ ؐ '@  %@ #@ݖ a !@ז ! ;@і   @˖a( @Ŗ !8 @ @ @ aT @ ad @  !x@ a @ ! @ ᨒ @  @ aԒ @ 2a 3@a /@} -@w  +@q b  )@k " '@e , %@_ 8 #@Y bD !@S "P ;@M \ @G bl @A "| @; ⌒ @5 b @/b @) "Ȑ@# bԒ @  " @  @  @  c @ c 3@ c( /@ 4 -@ D +@ cT )@ #` '@ l %@ۖ  #@Ֆ c !@ϖ # @ʖ  @Ėcؒ @ # @ @ `  @ `8 @  L@  `\ @   l @ | @  @ ` @ ;` @| 23` @v/ܒ @p - @j +a @d)!$ @^ '4 @X%P @R#ad @L !!t @Fᄒ @@a @:! @4 ἒ @. aԒ @( a @"  "@ b @  ", @< @  T @ bl @ ;b @ 3b @ /ⴒ @ -В @ +b @ )# @ږ ' @Ԗ %0 @Ζ #cL @Ȗ!#\ @–l @ c| @# @ 㜒 @ c @ cĒ @  #Ԑ@  c @  # @  @  @ `, @z ;`< @t3`L @n/` @h -p @b +` @\ )  @V 'ऒ @P% @J#`̒ @D !  @> @8 a @2 !$ @, 8 @& aL @  ad @  !x@ a @ ! @ ᬒ @  @ aВ @ ;a @ 3a @ /  @ -$ @ޖ +b8 @ؖ )"P @Җ 'l @̖ %x @Ɩ#b @!" @ ⴒ @b̒ @ " @  @ c @ c$ @  #8@ cL @ #` @ t @~  @x c @r ;c @l 3c @f /В @` -ܒ @Z +c @T )  @N ' @H %, @B #`8 @< ! D @6 P @0 `\ @*  p @$  @ ` @ ` @   @  ! ` @ "  В @ # @ $ @ %a @ &;a @ 3a( @/< @ܖ-T @֖ +ah @Ж)! @ʖ 'ᔒ @Ė % @ #a @ !!В @  @ a @ " @ , @ bD @ b\ @  "t@  b @  " @| ⬒ @v  @p bؒ @j ;b @d 3c @^ / @X -, @R +c< @L )#P @F 'd @@ %| @: #c @4 !# @.Ē @(cܒ @" # @ @ `  @ `8 @    H@  `` @  x @  @  @ ` @ ;`В @ 3` @ږ / @Ԗ - @Ζ +a( @Ȗ )!< @– 'P @ %d @ #ax @ !! @ ᠒ @ a @ !Ȓ @ ܒ @ a @ b @  "@ b0 @z "@ @t P @nd @h bt @b ;b @\ 3b @V /⨒ @P - @J +b̒ @D )"ܒ @> ' @8 % @2 #c @, !#, @& @ @  cT @ #h @ | @ c @ c @  #@  c̒ @  # @  @  @ ` @ޖ;`8 @ؖ3`P @Җ /h @̖- @Ɩ +` @ )  @ '̒ @ % @ #` @ !! @ , @ aD @ !\ @ x @ a @ a @~  !А@x  a @r  " @l ( @f 8 @` bL @Z ;bd @T 3b| @N /┒ @H - @B +bĒ @< )" @6 !' @0 "%  @* ##c$ @$ $!#@ @ %` @ &c @ '# @  )㼒 @ *cԒ @ ,c @ -  @ . `  @ /  < @ L @d @ܖ`| @֖;` @Ж 3` @ʖ /༒ @Ė -В @ +` @ )  @ '  @ %  @ #a4 @ !!H @ \ @ ap @ ! @ ᘒ @ a @| a @v  !ؐ@p  a @j  " @d   @^ 4 @X bD @R ;b\ @L 3bt @F /− @@ !- @: "+b @4 #)"Ԓ @. $' @( %% @" &#c @ '!#( @ (@ @ )cX @  *#l @ +〒 @ ,c @ -c @ . #@ / cВ @ 0 # @ 1 @ږ 2  @Ԗ 3`  @Ζ 4;`4 @Ȗ 53`H @– 7/` @ 8-x @ 9+` @ :)  @ ;'̒ @ %ܒ @#` @!! @  @a0 @ !D @ X @z al @t a @n  !@h a @b ! @\ Ȓ @V  @P a @J ;b @D 3b( @> /< @8 -P @2 +bd @, )"t @& !'ℒ @  #% @ $#b @ %!" @ &В @ 'b @ " @  @c( @c< @ #L@ c\ @ޖ #l @ؖ | @Җ  @̖ c @Ɩ;c @3c @/ @ -̒ @ +cؒ @ )# @ @' @ % @ d#` @ e! , @ f@ @ g`P @~ h ` @x ip @r j` @l k` @f l  @` m ` @Z n  В @T ܒ @N @H` @B;` @< 3` @6 / @0 -  @* @+a @$ )!$ @!'0 @"%< @$#aH @ (!!T@ `@ al@  !x@ @@ a@ a@ !@ܒ aĐ@֒ !Ԑ@В @ʒ  @Ē @b@ ;b@ 3b$@ /4@ -D@ +bT@ )"d@ ' t@ % @#b @!" @ⴒ @| bĒ @v "Ԓ @p  @j @b @d b @^! #@X" c @R$ #  @L(,@F 8@@ cD@: ; cP@4 3@c\@. /l@( -|@" +c@ )#@ '㬐@ %@  # c̐@ !@#ܐ@ @ c@  @ @ `,@ `<@ڒ   L@Ԓ `\ @Ζ  l @Ȗx @– @ ` @ ;` @ 3` @ @/ @ -В @!+`ܒ @")  @$' @(%@ #a @ !!@z  ,@t @a<@n !L@h \@b al@\ a|@V !@P a@J  !@D @ᰐ@> @8 aА@2 ;a@, 3a@& /@  - @ + b@ )", @'H @%` @ #bx @!" @⬒ @ bĒ @"@  @ޖc @ؖ c, @Җ  #D@̖  c\ @Ɩ #p @9# @7㔒 @ 㤒 @5 @  @ c̒ @ ;cܒ @ 3c @ / @ - @ +`  @~ )  @x '$ @r %0 @l #`< @f ! H @` T @Z `` @T  p @N | @H ` @B ` @<   @6  ` @0   В @* 9  @$ 7 @  @ 5  @ $ @  a0 @ ;aD @ !3aP @ "/\ @ #-l @ $+a @ %)! @ &'ᘒ @ܖ '% @֖ (#a @Ж )!!Ԓ @ʖ * @Ė +a @ ,! @ - @ .b @ /b$ @ 0 "4@ 1 bD @ 2 9"L"X@275h\@>;3/bpb|c@4-+)'b D@*%#!b 8@ "b!@  9bĖ"`"@ 75b̔ؖT@;3bcȘ`@/-+)`| @'%#! a0!p@! c,"$@ڐ  4c@b"@А975#HTL@Ɛc\;h``@@3/-+cp|`@)'%##㐖ha@!#㤖b"\@  㴒#bИ#@97#Ėㄘ@5;ȔԖ`8`x@3/-cܔc,@v+)'%c#᠘@l#!` Tb@b   $cH@X 97 0`<#@N5HT@2;3X`d`p`@>/-+`lx$ad@4)'%# ؘb@*! ࠖb"@   ഒ c@#@97 Ȗ4@ 5;Дܖ``@3/-+`\a@)'%`!P@#!a!Ęc@ !!$cx@ڐ 97!(a4 ,l@А5<Ha @Ɛ;3/-aPa\ᔘ@+)'%ad!pH@#!axa"<@ !a#`P@ 97᠔! @5@@;3/aȔaԖb4@-+)'ܔa#@v%#!a \@l!bb!P@b  9$b!Ę"@X75,b8x@N;3@bLc,cl@D/-+)T`c 0@:'%hx@#!ഘ`b|"@* "b!ha@  97⬔""\@5ĔԘ@ ;3/bܔbc@-+)'c 8x@%#! c ,@ #4c$!a@ 9Lc<"T"@ڐ75Pc`H@А;3dctcc@Ɛ/-+)x`p @'%#!㐔a$!d@!ؒ㨔c"@  9Вc""@75cؔ@@;c`4@3/-+``@)'%# 0\a@v! 8Hb"P@l   P``#@b975 l|x@X`,`l@N;3``@2/-+)ഔĖ`! @>'%#!̔ܖa!@4"H`"@*  9 `"#<@ 75$@;a,`d`<@ 3/-+aDTaX@)'%#!\l̘b @!!tᄖb"@  !a#Ԗ4@d975!ᴖ|@Za;aĘbd@P3/-aܔa L@Ɛ+)'%a"@#!b"$t`@  "0"@a(!h@97L"\ܘ@5dp@;3tbbb@/-+b┖Dc@)'%#"⨖`8@z!"⼖` @p  9"ĔbЖ!`!@f75ؔT@\b;bȘc@R3/-c|@+)cc @'%#T`@!#ᰖb\@  # #c0@Ԑ 9#(#@̐750@8a|`@;3/c@a̖@-+)Hb8"@ܐ'%cP㬖@#!4cX @c` !0@Đ  9cl!"@7xTp@5;@ cc3@ cc/@ -㴖@ +)cĖ x'@ cԐ@ޒ %#ap!@֒ #@В c"t9@Ȓ   b7@ #x @ ,@ 5<;@ LaP3@ a`X@ /`dА@ -+xb)@  c4@ '%#@ !` @| ༖`9@t ! ̐7@l  `ؖ!X5@d  ᨐ@^ @X p@R ;ab3@J cha @D /-0+@< )a< p@6 'aL%@. #\aȐ@( !!l∐9@  ax#87@  !c5@  t!@  ᜖$@ ᨐ@ cȐ;@ 3a`T@ /a̖H-@ +ؖb`@ )!c|'@ڒ %@Ԓ #!b!L9@̒  a7@Ē ""5@  b,#,;@ "@̐@ Tl@ hؐ@ aDb|@ 3/b-@ Pb@ +)b"'@ (b̐@ %#cȐ!@x "4@r c 9@j  #aL7@b !#$@\ 0@V 5ܔ@;@N Pc3@F c`c/@@ -pT@: +a0c)@2 #b@, '%㘖Ԑ#@$ !c#\@ 㰖c9@  p#@  cȖ @ #ؖሐ@  㿠@~ ;c9@@~ 7#5@@~3/@ؐ@~-+@А@~)` '@Ȑ@~`0%@@~ @#@@~P!@@~{`;@@~u`p9@@~o7@@~i5@@~c`3@@~] /@@~W-@@~Q+@@~K`)@@~E '@z@~?%#@r@~7!a@k@~0!,@e@~*D@_@~$T@Y@~ah@S@~!t@M@~ a@G@~  !@A@~@;@~@5@}a@/@}a;@)@}!9@#@}7@@}5@@}ܐb3@@}֐/@ @}А$-@@}ʐb4+@~@}Đ"D)@~@}T'@~@}`%@~@}bl#@~@}"|!@~@}@~ې@}b@~Ր@}"@~ϐ@}@~ɐ@}@~Ð@}b@~@}"@~@}| b@~@}v #@~@}p @~@}j0@~@}dcD@~@}^cP@~@}Y#\@~@}Th@~@}Ox@~@}Jc@~@}E@~{@}@@~v@};c@~q@}6#@~l@}1@~g@},@~b@}'c@~]@}"#@~X@}@~R@}`@~L@} @~F@} (@~@@}8@~:@|`H@~4@| X@~.@| `h@~(@|  x@~"@|@~@|@~@|ې;9`;@~@|Ӑ`7@~@|͐ 5@~@|ǐ3@}@|/@}@|`-@}@|+@}@|)@}@|a('@}ސ@|!8%@}ؐ@|H#@}Ґ@|T!@}̐@|al;@}Ɛ@|!x9@}@|75@}@|}3a/@}@|u-!+@}@|m)'@}@|e%#@}@|]!a@}@|V!@}@|P a@}@|J " @}@|D@}y@|>,@}s@|8b<@}m@|2bL;@}g@|,"\9@}a@|&l7@}[@| |5@}U@|b3@}O@|/@}I@|-@}C@|b+@}=@|")@}7@{'@}1@{%@}+@{b#@}%@{"!@}@{@}@{ސc@}@{ؐ#@} @{Ґ(@}@{̐0@}@{Ɛc<@|@{#D@|@{ cL@|@{ #X@|@{d@|@{p@|ݐ@{c|@|א@{c@|Ґ@{#@|͐@{@|Ȑ@{@|Ð@{c@|@{@|@{~@|@{yc@|@{t#@|@{o@|@{j@|@{e` @|@{` @|@{[ @|@{U`(@|@{O 4@|@{I@@|~@{CL@|x@{=`T@|r@{7 d@|l@{1 `t@|f@{+  |@|`@{%@|Z@{@|T@{`@|N@{;9`7@|F@{  5@|@@{3@|:@z/@|4@z`-@|.@z+@|(@z)@|"@za$'@|@z!8%@|@zې@#@|@zՐP!@| @zϐa`;@|@zɐ!l9@{@zÐ7t5@{@z3a/@{@z-!+@{@z)'@{ސ@z%#@{֐@z!a@{ϐ@z!@{ɐ@z a@{Ð@z !@{@z@{@z| @{@zvb,@{@zpb8;@{@zj"D9@{@zdP7@{@z^X5@{@zXbh3@{@zRx/@{@zL-@{@zFb+@{{@z@")@{u@z:'@{o@z4%@{i@z.b#@{c@z("!@{]@z"@{W@zc@{Q@z#@{K@z @{E@z 0@{?@zc<@{9@y#L@{3@y c\@{-@y #h@{'@yt@{!@y@{@yc@{@yڐc;@{@yԐ#@{ @yϐ@{@yʐ@{@yŐc@z@y@z@y @z@y`$@z@y <@z@yT@z@yl@zݐ@y`@zؐ@y @zӐ@y@z͐@y`@zǐ@y @z@y@z@y@z@yz`@z@yt!@z@yn a(@z@yh !H@z@ybd@z@y\p@z@yVa@z@yPa@z@yK97!5@z~@yC3@zx@y=/@zr@y7a-@zl@y1+@zf@y+)@z`@y%b '@zZ@y"8%@zT@yP#@zN@yd!@zH@y bx;@zB@y"9@z<@y75@z4@x3b/ @z,@x- "+ @z$@x) ' @z@x% # @z@xِ! c@z @xҐ#4@z@x̐ cL@z@xƐ #d@y@x|@y@x@y@xc@y@xc; @y@x#9 @yݐ@x7 @yא@x5 @yѐ@xc3 @yː@x/ @yŐ@x - @y@x`4+ @y@x~ D) @y@xxT' @y@xrh% @y@xl`x# @y@xf ! @y@x` @y@xZ `@y@xT  @y@xN @y@xH @y}@xB `@yw@x< !@yq@x6  a@yk@x0  !0@ye@x* H@y_@x$ \@yY@x ap@yS@xa; @yM@x!9 @yG@x @yB@x@y=@xa@y8@w@y3@w@y.@wb @y)@w"@y$@w0@y@wD@y@wߐbX@y@wڐ"p@y@wՐ @y @wϐ b@y@wɐ "@x@wÐ @x@w @x@w b@x@w #@x@w  c@x@w  #0@xڐ@w H@xԐ@w \@xΐ@w cp@xȐ@wc@xÐ@w#@x@w7 5 3 @x@w{/ @x@wuc- @x@wo+!@x@wi)!@x@wc` '!@x@w] %!@x@wW(#!@x@wQb+%@ts@s8")%@tm@s2'%@tg@s,%%@ta@s&c#%@t[@s # !%@tU@s$8@tO@s$cL@tI@s$#d@tC@s$t@t=@s$@t7@r$c@t1@r$#@t+@r $c@t%@r $#@t@r$@t@rސ%@t@rؐ%`@t @rҐ`0;%@t@r̐ D9%@t@rƐX7%@s@rl5%@s@r`3%@s@r@s@r@s@r`@s@r @sې@r@s֐@r@sѐ@ra(@s̐@r!<@sǐ@r%P@s@r%ad@s@r%!|@s@rz%@s@rt%@s@rn%a@s@rh%!@s@rb %a@s@r\ %!@s@rV%@s@rP%@s@rJ%b,@s@rDbD@sz@r?"\@su@r:t@sp@r5@sk@r0b@sf@r+/%-%+%@s^@r#)%@sX@rb'%@sR@r"%%@sL@r#%@sF@r !%@s@@rc;&@s:@q#49&@s4@q%7&H5&@s,@q%3&c`/&@s$@q%-&#t+&@s@q%)&'&@s@qِ%%&#&@s @qѐ%!&c@s@qʐ%#@r@qĐ %c@r@q %#@r@q%@r@q%@r@q&`@r@q` ;&@rې@q 9&@rՐ@q$7&@rϐ@q45&@rɐ@q`D3&@rÐ@qT/&@r@qd-&@r@q|`x+&@r@qv )&@r@qp'&@r@qj%&@r@qd`#&@r@q^ !&@r@qX&@r@qR&`@r@qL&!@r@qF&@r{@q@&(@ru@q:&a0@ro@q4&!8@ri@q. &a@@rc@q( &!H@r]@q"&P@rW@q&X@rQ@q&ad@rK@qap;&@rE@q !|9&@r?@q7&@r9@p5&@r3@pa3&@r-@p/&@r'@p@r"@pa@r@p!@r@pݐ@r@pؐ@r@pӐb@r @pΐ"@r@pɐ& @q@pÐ&b0@q@p&"@@q@p&P@q@p&`@q@p&bp@q@p&"@qڐ@p &b@qԐ@p &"@qΐ@p&@qȐ@p&@q@p&b@q@pb@q@p|"@q@pw@q@pr@q@pmc @q@ph0@q@pc-&+&<)&@q@p[cH'&@q@pU#T%&@q@pO`#&@q@pIl!&@q~@pCcx;'@qx@p=#9'@qr@p7&7'5'@qj@p/&3'c/'@qb@p'&-'#+'@qZ@p&)'''@qR@p&%'#'@qJ@p&!'c@qC@p&#@q=@p &c@q7@o ' @q1@o'@q+@o'(@q%@o'`8@q@o`H;'@q@oސ X9'@q@oؐh7'@q @oҐx5'@q@o̐`3'@q@oƐ/'@p@o-'@p@o`+'@p@o )'@p@o''@p@o%'@pݐ@o`#'@pא@o !'@pѐ@o' @pː@o'a@pŐ@o'!(@p@o'4@p@o~'@@p@ox'aL@p@or'!X@p@ol 'ah@p@of '!x@p@o`'@p@oZ'@p@oT'a@p@oNa;'@p@oH!9'@p}@oB7'@pw@o<5'@pq@o6a3'@pk@o0/(@pe@o* -(@p_@o$b@pZ@o",@pU@o<@pP@oH@pK@obX@pF@o "h@pA@o'x@p;@o'b@p5@n'"@p/@n'@p)@n'@p#@n'b@p@n'#@p@nܐ 'c,@p@n֐ '#D@p @nА'\@p@nʐ'x@o@nĐ'c@o@nc@o@n#@o@n@o@n@o@nc@o@n@oې@n @o֐@n+()(`'(@oΐ@n (%(@oȐ@n4#(@o@n@!(@o@n`L;(@o@n{ X9(@o@nu(7(d5(@o@nm(3(`p/(@o@ne(-( |+(@o@n]()('(@o@nU(%(#(@o@nM(!(`@o@nF( @o{@n@ (`@ou@n: ( @oo@n4(@oi@n.(@oc@n((`@o]@n"a ;(@oW@n!9(@oQ@n,7(@oK@n<5(@oE@n aH3(@o?@nX/(@o9@mp-(@o3@ma|+(@o-@m!)(@o'@m'(@o!@m%(@o@ma#(@o@mڐ!!(@o@mԐ(@o @mΐ(a@o@mȐ(!@n@m( @n@m( @n@m(b0@n@m("8@n@m (bD@nߐ@m ("P@nِ@m(`@nӐ@m(p@n͐@m(b@nǐ@mb@n@m"@n@m@n@m}@n@mxb@n@ms@n@nN@m@mi@nƒ?@k?@nAb@m@m\@n?@k?@mT"@n@mO@n@n*@m@mE@n?@k֒?@nc@mv@m8@n?@kɒ?@m0# @nf@n (@mc@m%@n?@k?@m(c@mU@m@nt?@k?@m(#$@nD@m(,@mA@m@n`?@k?@mې(4@m3@l@nR?@k?@l(c<@n"@mǐ(#H@m@l@n>?@kr?@m (;(cT9(@m@lѐ7(@n-?5(@k`?@lǐ (3(#`/(@m@l(-(l+)@m@l())|')@m@l(%)c#)@m@lc!)@mܐ@l#;)@m֐@l9)@mА@l7)@mʐ@lc5)@mĐ@l3)@m@l/)@m@l}`-)@m@lw +)@m@lq())@m@lk4')@m@le`@%)@m@l_ T#)@m@lY)!)`@m@lR)`t@m@lL) @m@lF)@m{@l@)@mu@l:)`@mo@l4) @mi@l. )`@mc@l( ) @m]@l")@mW@l)@mQ@l)a @mK@la;)@mE@l !(9)@m?@l87)@m9@kH5)@m3@kaT3)@m-@k`/)@m'@kl-)@m!@kax+)@m@k!))@m@kڐ')@m@kԐ%)@m @kΐa#)@m@kȐ!!)@l@k)@l@k)a@l@k)!@l@k)@l@k)@lߐ@k)b@lِ@k)"@lӐ@k )b0@l͐@k )"D@lǐ@k)X@l@k)l@l@k)b@l@kzb@l@ku"@l@kp@l@kk@l@kfb@l@ka@l@k\@l@kWc @l@kR#@l@kM,@l@kH<@l~@kCcL@ly@k>#\@lt@k9)h@ln@k3)ct@lh@k-)#@lb@k')@l\@k!)@lV@k)c@lP@k)#@lJ㿠;)9)c;)@9c7)@5#5*@13*@-/*@)` -*@%(@!@㿠 @I @;*`4@CW @ 㿠 @9 @9* D@3  @a @;*`T@( @ 6 㿠 @ @;*`|@W @ڐ 㿠 @  @9* @  @4 @;*`@ @Д 6 㿠 @ @;*`@ @ 㿠 @ߔ @9* @ِ  @ @;*`@ΐ @ . 㿠 @” @;*a @ @ 㿠 @ @9*!@  @ږ @;*a,@ @v . 㿠 @ @;*aT@ @S 㿠 @ @9*!d@  @ @;*at@t @I . 㿠 @h @;*a@b @& 㿠 @X @9*!@R  @ @;*a@G @ . 㿠 @; @;*a@5 @ 㿠 @+ @9*!@%  @S @;*b@ @ .  㿠 @ @;*b,@W @̐ 㿠 @ @9*"<@  @& @;*bL@ @” 6  㿠 @ @;*bt@ېW @ 㿠 @є @9*"@ː  @ @;*b@ @ 6  㿠 @ @;*b@W @r 㿠 @ @9*"@  @̖ @;*b@ @h 6 㿠 @ @;*c@W @E 㿠 @w @9*#@q  @ @;*c$@f @; 6 㿠 @Z @;*cL@T @ 㿠 @J @9*#\@D  @r @;*cl@9 @ & 㿠 @- @;*c@'W @ 㿠 @ @9*#@  @E @;*c@  @ 6 㿠 @ @;*c@W @ 㿠 @ @9*#@  @ @;*c@ߐ @ 6 㿠 @Ӕ @;+`$@͐W @ 㿠 @Ô @9+ 4@  @ @;+`D@ @ 6 㿠 @ @;+`l@W @d 㿠 @ @9+ |@  @ @;+`@ @Z 6 㿠 @y @;+`@s @7 㿠 @i @9+ @c  @ @;+`@X @- &  㿠 @L @;+`@F $@  㿠 @< @9+! @6  @d @;+a@+ @ &$ 㿠 @ @;+aD@ (@ݐ 㿠 @ @9+!T@   @7 @;+ad@ @Ӕ 6( 㿠 @ @;+a@W *@ 㿠 @ @9+!@ܐ  @  @;+a@ѐ @ 6* 㿠 @Ŕ @;+a@W ,@ 㿠 @ @9+!@  @ݖ @;+a@ @y 6, 㿠 @ @;+b@ .@V 㿠 @ @9+",@  @ @;+b<@w @L 6. 㿠 @k @;+bd@eW 0@) 㿠 @[ @9+"t@U  @ @;+b@J @ 60 㿠 @> @;+b@8W 2@ 㿠 @. @9+"@(  @V @;+b@ @ 62 㿠 @ @;+b@  4@ϐ 㿠 @ @9+#@  @) @;+c@ @Ŕ 64 㿠;+c<@f@g) @fZ?  @  @/+D@Ґ @ "  @.3+cd@ƐW 6@ 㿠;+c@f@g @f1?  @ @/+@ @~ "  @3+c@ .@r 7 6 㿠;+c@fn@fՒ @f?  @ @/+@~ @S "  @.3+c@rW B@5 㿠;,`@fE@f @eݒ?  @ @/,@U @* "  @3,`<@J .@ 7 B 㿠 @< @;,`\@6W N@ 㿠 @, @9, l@&  @T @;,`|@ @ 6N 㿠 @ @;,`@ W P@͐ 㿠 @ @9, @  @' @;,`@ @Ô 6P 㿠 @ @;,`@ܐW R@ 㿠 @Ҕ @9, @̐  @ @;,a @ @ 6R 㿠 @ @;,a4@W T@s 㿠 @ @9,!D@  @͖ @;,aT@ @i 6T 㿠 @ @;,a|@W V@F 㿠 @x @9,!@r  @ @;,a@g @< 6V 㿠 @[ @;,a@UW X@ 㿠 @K @9,!@E  @s @;,a@: @ 6X 㿠 @. @;,b @(W Z@ 㿠 @ @9,"@  @F @;,b,@  @ 6Z 㿠 @ @;,bT@W \@ 㿠 @ @9,"d@  @ @;,bt@ @ 6\ 㿠 @Ԕ @;,b@ΐW ^@ 㿠 @Ĕ @9,"@  @ @;,b@ @ 6^ 㿠 @ @;,b@W `@e 㿠 @ @9,"@  @ @;,c@ @[ 6` 㿠 @z @;,c,@tW b@8 㿠 @j @9,#<@d  @ @;,cL@Y @. 6b 㿠 @M @;,ct@GW d@  㿠 @= @9,#@7  @e @;,c@, @ 6d 㿠 @  @;,c@W f@ސ 㿠 @ @9,#@   @8 @;,c@ @Ԕ 6f 㿠 @ @;-`@W h@ 㿠 @ @9- @ݐ  @  @;-`$@Ґ @ 6h 㿠 @Ɣ @;-`L@W j@ 㿠 @ @9- \@  @ޖ @;-`l@ @z 6j 㿠 @ @;-`@W l@W 㿠 @ @9- @  @ @;-`@x @M 6l 㿠 @l @;-`@fW n@* 㿠 @\ @9- @V  @ @;-`@K @  6n 㿠 @? @;-a$@9W p@ 㿠 @/ @9-!4@)  @W @;-aD@ @ 6p 㿠 @ @;-al@ W r@А 㿠 @ @9-!|@  @* @;-a@ @Ɣ 6r 㿠 @ @;-a@ߐW t@ 㿠 @Ք @9-!@ϐ  @ @;-a@Đ @ 6t 㿠 @ @;-a@W v@v 㿠 @ @9-" @  @Ж @;-b@ @l 6v 㿠 @ @;-bD@W x@I 㿠 @{ @9-"T@u  @ @;-bd@j @? 6x 㿠 @^ @;-b@XW z@ 㿠 @N @9-"@H  @v @;-b@= @ 6z 㿠 @1 @;-b@+W |@ 㿠 @! @9-"@  @I @;-b@ @ 6| 㿠 @ @;-c@W ~@ 㿠 @ @9-#,@  @ @;-c<@ @ 6~ 㿠 @ה @;-cd@ѐW @ 㿠 @ǔ @9-#t@  @ @;-c@ @ 6 㿠 @ @;-c@ @h 㿠 @ @9-#@  @– @;-c@ @^ . 㿠 @} @;-c@w @; 㿠 @m @9. @g  @ @;.`@\ @1 . 㿠;.`<@a.@a @`ƒ?  @w @3.`D@> @ " @ @9. d@2`@ 㿠;.`@a@am @`?  @O @3.`@ @ " @ @9. @  @ /` 㿠;.`@`ܐ@aC @`t?  @% @3.`@ @ " @ @9. @`@ 㿠;.a@`@a @`L?  @ @3.a@Đ @ " @ @9.!<@ @ /`ā 㿠;.a\@`@` @`"?  @Ӗ @/.d@ @o " 2 @.3.a@W!@Q 㿠;.a@`a@`Ȓ @_?  @ @/.@q @F " 2 @3.a@f .@: 7! 㿠;.a@`6@` @_Β?  @ @3.a@F @ " P @9."@:Oah@ 㿠;.b4@`@`u @_?  @W @3.b<@ @ " P @9."\@ @ /ah 㿠 @ @;.b|@"@Đ 㿠 @ @9."@  @ @;.b@ @ 6ⲁ 㿠 @ٔ @;.b@Ӑ"@ 㿠 @ɔ @9."@Ð  @ @;.b@ @ 6ⴁ 㿠 @ @;.c @"@j 㿠 @ @9.#@  @Ė @;.c,@ @` 6ⶁ 㿠 @ @;.cT@yO"@m 㿠 @o @9.7.d@h#t@o @ @;.c|@Z @o . 㿠 @N @;.c@HO"@< 㿠 @> @9.7.@7#@oY @b @;.c@) @> . 㿠 @ @;.c@O"@  㿠 @  @9/7/@ @o( @1 @;/`@ @  . 㿠 @ @;/`D@O"@ڐ 㿠 @ܔ @9/7/T@Ր d@n @ @;/`l@ǐ @ܔ . 㿠 @ @;/`@O"@ 㿠 @ @9/7/@ @nƐ @ϖ @;/`@ @ . 㿠 @ @;/`@O"@x 㿠 @z @9/7/@s!@n @ @;/a @e @z . 㿠 @Y @;/a4@SW"@ 㿠 @I @9/!D@C  @q @;/aT@8 @  6⾁ 㿠 @, @;/a|@&W"@ 㿠 @ @9/!@  @D @;/a@  @ 6 㿠 @ @;/a@"@ 㿠 @ @9/!@  @ @;/a@ސ @ &ā 㿠 @Ҕ @;/b @̐W"@ 㿠 @” @9/"@  @ @;/b,@ @ 6ȁ 㿠 @ @;/bT@W"@c 㿠 @ @9/"d@  @ @;/bt@ @Y 6ʁ 㿠 @x @;/b@rW"@6 㿠 @h @9/"@b  @ @;/b@W @, 6́ 㿠 @K @;/b@EW"@  㿠 @; @9/"@5  @c @;/c@* @ 6΁ 㿠 @ @;/c,@W"@ܐ 㿠 @ @9/#<@  @6 @;/cL@ @Ҕ 6Ё 㿠 @ @;/ct@W"@ 㿠 @ @9/#@ې  @  @;/c@А @ 6ҁ 㿠 @Ĕ @;/c@W"@ 㿠 @ @9/#@  @ܖ @;/c@ @x 6ԁ 㿠 @ @;0`@W"@U 㿠 @ @90 @  @ @;0`$@v @K 6ց 㿠 @j @;0`L@dW"@( 㿠 @Z @90 \@T  @ @;0`l@I @ 6؁ 㿠 @= @;0`@7W"@ 㿠 @- @90 @'  @U @;0`@ @ 6ځ 㿠 @ @;0`@ W"@ΐ 㿠 @ @90 @  @( @;0`@ @Ĕ 6܁ 㿠 @ @;0a$@ݐW"@ 㿠 @Ӕ @90!4@͐  @ @;0aD@ @ 6ށ 㿠 @ @;0al@W"@t 㿠 @ @90!|@  @Ζ @;0a@ @j 6 㿠 @ @;0a@W"@G 㿠 @y @90!@s  @ @;0a@h @= 6 㿠 @\ @;0a@VO"@J 㿠 @L @9070 @E"@kg @p @;0b$@7 @L . 㿠 @+ @;0bL@%O"@ 㿠 @ @9070\@"l@k6 @? @;0bt@ @ . 㿠 @ @;0b@O"@ 㿠 @ @9070@"@k @ @;0b@Ր @ . 㿠 @ɔ @;0b@ÐO"@ 㿠 @ @9070@# @jԐ @ݖ @;0c@ @ . 㿠 @ @;0c<@W"@V 㿠 @ @90#L@  @ @;0c\@w @L 6 㿠 @k @;0c@eW"@) 㿠 @[ @90#@U  @ @;0c@J @ 6 㿠 @> @;0c@8W"@ 㿠 @. @90#@(  @V @;0c@ @ 6 㿠 @ @;1`@ W"@ϐ 㿠 @ @91 $@  @) @;1`4@ @Ŕ 6 㿠 @ @;1`\@ސW"@ 㿠 @Ԕ @91 l@ΐ  @ @;1`|@Ð @ 6 㿠 @ @;1`@W"@u 㿠 @ @91 @  @ϖ @;1`@ @k 6 㿠 @ @;1`@W"@H 㿠 @z @91 @t  @ @;1a @i @> 6 㿠 @] @;1a4@WW"@ 㿠 @M @91!D@G  @u @;1aT@< @ 6 㿠 @0 @;1a|@*O"@ 㿠 @  @9171@!@i; @D @;1a@  @  . 㿠 @ @;1a@O"@ 㿠 @ @9171@!@i  @ @;1a@ڐ @ . 㿠 @Δ @;1b@ȐO"@ 㿠 @ @9171,@"<@hِ @ @;1bD@ @ . 㿠 @ @;1bl@O"@ 㿠 @ @9171|@"@h @ @;1b@x @ . 㿠 @l @;1b@fO"@Z 㿠 @\ @9171@U"@hw @ @;1b@G @\ . 㿠 @; @;1c @5W"@ 㿠 @+ @91#@%  @S @;1c,@ @ 6 㿠 @ @;1cT@#@̐ 㿠 @ @91#d@  @& @;1ct@ @” & 㿠 @ @;1c@ې#@ 㿠 @є @91#@ː  @ @;1c@ @ & 㿠 @ @;1c@#@r 㿠 @ @91#@  @̖ @;2`@ @h & 㿠 @ @;2`,@# @E 㿠 @w @92 <@q  @ @;2`L@f @; &  㿠;2`t@W8@W @VВ?  @ @/2|@H @ "  @.32`@<W#@ 㿠;2`@W@Wv @V?  @X @/2@ @ "  @32`@ .@ 7# 㿠;2a@V@WK @V|?  @- @/2 @ @ɔ "  @.32a,@W#@ 㿠;2aL@V@W" @VS?  @ @/2T@ː @ "  @32at@ .@ 7# 㿠;2a@V@V @V(?  @ٖ @/2@ @u "  @.32a@W#(@W 㿠;2a@Vg@VΒ @U?  @ @/2@w @L "  @32b@l .@@ 7#( 㿠;2b$@V<@V @UԒ?  @ @/2,@L @! "  @.32bL@@W#4@ 㿠;2bl@V@Vz @U?  @\ @/2t@# @ "  @32b@ .@ 7#4 㿠 @  @;2b@O#@@ 㿠 @ @9272@"@f @ @;2b@ @ .@ 㿠 @ٔ @;2c@ӐO#A@ǐ 㿠 @ɔ @9272@#$@e @ @;2c,@ @ɔ .A 㿠 @ @;2cT@O#B@ 㿠 @ @9272d@#t@e @ @;2c|@ @ .B 㿠 @w @;2c@qO#C@e 㿠 @g @9272@`#@e @ @;2c@R @g .C 㿠 @F @;2c@@O#D@4 㿠 @6 @9373@/ @eQ @Z @;3`@! @6 .D 㿠 @ @;3`D@O#E@ 㿠 @ @9373T@ d@e  @) @;3`l@ @ .E 㿠 @ @;3`@ސO#F@Ґ 㿠 @Ԕ @9373@͐ @d @ @;3`@ @Ԕ .F 㿠 @ @;3`@O#G@ 㿠 @ @9373@!@d @ǖ @;3a @ @ .G 㿠 @ @;3a4@|O#H@p 㿠 @r @9373D@k!T@d @ @;3a\@] @r .H 㿠 @Q @;3a@KO#I@? 㿠 @A @9373@:!@d\ @e @;3a@, @A .I 㿠 @  @;3a@O#J@ 㿠 @ @9373@ !@d+ @4 @;3a@ @ .J 㿠 @ @;3b$@O#K@ݐ 㿠 @ߔ @93734@ؐ"D@c @ @;3bL@ʐ @ߔ .K 㿠 @ @;3bt@O#L@ 㿠 @ @9373@"@cɐ @Җ @;3b@ @ .L 㿠 @ @;3b@O#M@{ 㿠 @} @9373@v"@c @ @;3b@h @} .M 㿠 @\ @;3c@VO#N@J 㿠 @L @9373$@E#4@cg @p @;3c<@7 @L .N 㿠 @+ @;3cd@%O#O@ 㿠 @ @9373t@#@c6 @? @;3c@ @ .O 㿠 @ @;3c@O#P@ 㿠 @ @9373@#@c @ @;3c@Ր @ .P 㿠 @ɔ @;4`@ÐO#Q@ 㿠 @ @9474@ $@bԐ @ݖ @;4`,@ @ .Q 㿠 @ @;4`T@O#R@ 㿠 @ @9474d@ t@b @ @;4`|@s @ .R 㿠 @g @;4`@aO#S@U 㿠 @W @9474@P @br @{ @;4`@B @W .S 㿠 @6 @;4`@0O#T@$ 㿠 @& @9474@!@bA @J @;4a@ @& .T 㿠 @ @;4aD@O#U@ 㿠 @ @9474T@!d@b @ @;4al@ @ .U 㿠 @Ԕ @;4a@ΐO#V@ 㿠 @Ĕ @9474@!@aߐ @ @;4a@ @Ĕ .V 㿠 @ @;4a@O#W@ 㿠 @ @9474@"@a @ @;4b @~ @ .W 㿠 @r @;4b4@lO#X@` 㿠 @b @9474D@["T@a} @ @;4b\@M @b .X 㿠 @A @;4b@;O#Y@/ 㿠 @1 @9474@*"@aL @U @;4b@ @1 .Y 㿠 @ @;4b@ O#Z@ 㿠 @ @9474@"@a @$ @;4b@ @ .Z 㿠 @ߔ @;4c$@ِO#[@͐ 㿠 @ϔ @94744@Ȑ#D@` @ @;4cL@ @ϔ .[ 㿠 @ @;4ct@O#\@ 㿠 @ @9474@#@` @– @;4c@ @ .\ 㿠 @} @;4c@wO#]@k 㿠 @m @9474@f#@` @ @;4c@X @m .] 㿠 @L @;5`@FO#^@: 㿠 @< @9575$@5 4@`W @` @;5`<@' @< .^ 㿠 @ @;5`d@O#_@  㿠 @  @9575t@ @`& @/ @;5`@ @  ._ 㿠 @ @;5`@O#`@ؐ 㿠 @ڔ @9575@Ӑ @_ @ @;5`@Ő @ڔ .` 㿠 @ @;5a@O#a@ 㿠 @ @9575@!$@_Đ @͖ @;5a,@ @ .a 㿠 @ @;5aT@O#b@v 㿠 @x @9575d@q!t@_ @ @;5a|@c @x .b 㿠 @W @;5a@QO#c@E 㿠 @G @9575@@!@_b @k @;5a@2 @G .c 㿠 @& @;5a@ O#d@ 㿠 @ @9575@"@_1 @: @;5b@ @ .d 㿠 @ @;5bD@O#e@ 㿠 @ @9575T@ސ"d@_ @  @;5bl@А @ .e 㿠 @Ĕ @;5b@O#f@ 㿠 @ @9575@"@^ϐ @ؖ @;5b@ @ .f 㿠 @ @;5b@W#h@Q 㿠 @ @95"@}  @ @;5c@r @G 6h 㿠 @f @;5c,@`W#j@$ 㿠 @V @95#<@P  @~ @;5cL@E @ 6j 㿠 @9 @;5ct@3W#l@ 㿠 @) @95#@#  @Q @;5c@ @ 6l 㿠 @  @;5c@W#n@ʐ 㿠 @ @95#@  @$ @;5c@ @ 6n 㿠 @ߔ @;6`@ِW#p@ 㿠 @ϔ @96 @ɐ  @ @;6`$@ @ 6p 㿠 @ @;6`L@W#r@p 㿠 @ @96 \@  @ʖ @;6`l@ @f 6r 㿠 @ @;6`@W#t@C 㿠 @u @96 @o  @ @;6`@d @9 6t 㿠 @X @;6`@RW#v@ 㿠 @H @96 @B  @p @;6`@7 @  6v 㿠 @+ @;6a$@%W#x@ 㿠 @ @96!4@  @C @;6aD@  @ߔ 6x 㿠 @ @;6al@W#z@ 㿠 @ @96!|@  @ @;6a@ݐ @ 6z 㿠 @є @;6a@ːW#|@ 㿠 @ @96!@  @ @;6a@ @ 6| 㿠 @ @;6a@W#~@b 㿠 @ @96" @  @ @;6b@ @X 6~ 㿠 @w @;6bD@qW#@5 㿠 @g @96"T@a  @ @;6bd@V @+ 6、 㿠 @J @;6b@DW#@ 㿠 @: @96"@4  @b @;6b@) @ 6め 㿠 @ @;6b@W#@ې 㿠 @  @96"@  @5 @;6b@ @є 6㄁ 㿠 @ @;6c@W#@ 㿠 @ @96#,@ڐ  @ @;6c<@ϐ @ 6ㆁ 㿠 @Ô @;6cd@W#@ 㿠 @ @96#t@  @ۖ @;6c@ @w 6㈁ 㿠 @ @;6c@W#@T 㿠 @ @96#@  @ @;6c@u @J 6㊁ 㿠 @i @;6c@cW#@' 㿠 @Y @97 @S  @ @;7`@H @ 6㌁ 㿠 @< @;7`<@6#@ 㿠 @, @97 L@&  @T @;7`\@ @ &㐁 㿠 @ @;7`@ W#@͐ 㿠 @ @97 @  @' @;7`@ @Ô 6㔁 㿠 @ @;7`@ܐW#@ 㿠 @Ҕ @97 @̐  @ @;7`@ @ 6㖁 㿠 @ @;7a@#@s 㿠 @ @97!$@  @͖ @;7a4@ @i .㘁 㿠 @ @;7a\@#@F 㿠 @x @97!l@r  @ @;7a|@g @< .㙁 㿠 @[ @;7a@UW#@ 㿠 @K @97!@E  @s @;7a@: @ 6㚁 㿠 @. @;7a@( @ 㿠 @ @97!@  @F @;7b @  @ & 㿠 @ @;7b4@ @Ɛ 㿠 @ @97"D@  @ @;7bT@ @” & 㿠 @Ԕ @;7b|@ΐ @ 㿠 @Ĕ @97"@  @ @;7b@ @ & 㿠 @ @;7b@ @e 㿠 @ @97"@  @ @;7b@ @[ & 㿠;7c @IX@I @H?  @ @/7@h @= "  @.37c4@\W @ 㿠;7cT@I/@I @Hǒ?  @x @/7\@? @ "  @37c|@4 .@ 7  㿠 @& @;7c@ W @ 㿠 @ @97#@  @> @;7c@ @ڔ 6 㿠 @ @;7c@W @ 㿠 @ @97#@  @ @;8`@ؐ @ 6 㿠 @̔ @;8`,@ƐW @ 㿠 @ @98 <@  @ @;8`L@ @ 6 㿠 @ @;8`t@W @] 㿠 @ @98 @  @ @;8`@~ @S 6 㿠 @r @;8`@lW @0 㿠 @b @98 @\  @ @;8`@Q @& 6 㿠 @E @;8a@?W @ 㿠 @5 @98!@/  @] @;8a$@$ @ 6 㿠 @ @;8aL@W @֐ 㿠 @ @98!\@  @0 @;8al@ @̔ 6  㿠 @ @;8a@W "@ 㿠 @۔ @98!@Ր  @ @;8a@ʐ @ 6" 㿠 @ @;8a@ $@| 㿠 @ @98!@  @֖ @;8a@ @r .$ 㿠 @ @;8b$@ %@O 㿠 @ @98"4@{  @ @;8bD@p @E .% 㿠 @d @;8bl@^ &@" 㿠 @T @98"|@N  @| @;8b@C @ .& 㿠 @7 @;8b@1 '@ 㿠 @' @98"@!  @O @;8b@ @ .' 㿠 @  @;8b@ (@Ȑ 㿠 @ @98# @  @" @;8c@ @ .( 㿠 @ݔ @;8cD@א )@ 㿠 @͔ @98#T@ǐ  @ @;8cd@ @ .) 㿠 @ @;8c@ *@n 㿠 @ @98#@  @Ȗ @;8c@ @d .* 㿠 @ @;8c@} +@A 㿠 @s @98#@m  @ @;8c@b @7 .+ 㿠 @V @;9`@P ,@ 㿠 @F @99 ,@@  @n @;9`<@5 @  ., 㿠 @) @;9`d@# -@ 㿠 @ @99 t@  @A @;9`@ @ݔ .- 㿠 @ @;9`@~ .@ 㿠 @ @99 @~  @ @;9`@~ې @ .. 㿠 @ϔ @;9`@~ɐ /@ 㿠 @ @99!@~  @ @;9a@~ @ ./ 㿠 @ @;9a<@~ 0@` 㿠 @ @99!L@~  @ @;9a\@~ @V .0 㿠 @u @;9a@~o 1@3 㿠 @e @99!@~_  @ @;9a@~T @) .1 㿠 @H @;9a@~BW 2@ 㿠 @8 @99!@~2  @` @;9a@~' @ 62 㿠 @ @;9b@~ 4@ِ 㿠 @  @99"$@~  @3 @;9b4@} @ϔ &4 㿠 @ @;9b\@} 8@ 㿠 @ޔ @99"l@}ؐ  @ @;9b|@}͐ @ &8 㿠 @ @;9b@} <@ 㿠 @ @99"@}  @ٖ @;9b@} @u &< 㿠 @ @;9b@} @R 㿠 @ @99"@}~  @ @;9c @}s @H . 㿠 @g @;9c4@}a @% 㿠 @W @99#D@}Q  @ @;9cT@}F @ . 㿠 @: @;9c|@}4 @ 㿠 @* @99#@}$  @R @;9c@} @ . 㿠 @  @;9c@} @ː 㿠 @ @99#@|  @% @;9c@| @ . 㿠 @ @;:` @|ڐ @ 㿠 @Д @9: @|ʐ  @~ @;:`,@| @ & 㿠;:`T@C@C @C)?  @~ږ @/:\@| @v "  @.3:`|@| @X 㿠;:`@Ch@Cϒ @C?  @~ @/:@|x @M "  @3:`@|m .@A '  㿠;:`@C=@C @BՒ?  @~ @/:@|M @" "  @.3:a @|AW ,@ 㿠;:a,@C@C{ @B?  @~] @/:4@|$ @ "  @3:aT@| .@ 7 , 㿠 @  @;:at@|W 8@ɐ 㿠 @ @9:!@{  @~# @;:a@{ @ 68 㿠 @ޔ @;:a@{ؐW :@ 㿠 @Δ @9:!@{Ȑ  @} @;:a@{ @ 6: 㿠 @ @;:b@{W <@o 㿠 @ @9:"@{  @}ɖ @;:b$@{ @e 6< 㿠 @ @;:bL@{~W >@B 㿠 @t @9:"\@{n  @} @;:bl@{c @8 6> 㿠 @W @;:b@{QW @@ 㿠 @G @9:"@{A  @}o @;:b@{6 @  6@ 㿠 @* @;:b@{$W B@ 㿠 @ @9:"@{  @}B @;:b@{  @ޔ 6B 㿠 @ @;:c$@zW D@ 㿠 @ @9:#4@z  @} @;:cD@zܐ @ 6D 㿠 @Д @;:cl@zʐW F@ 㿠 @ @9:#|@z  @| @;:c@z @ 6F 㿠 @ @;:c@zW H@a 㿠 @ @9:#@z  @| @;:c@z @W 6H 㿠 @v @;:c@zpW J@4 㿠 @f @9; @z`  @| @;;`@zU @* 6J 㿠 @I @;;`D@zCW L@ 㿠 @9 @9; T@z3  @|a @;;`d@z( @ 6L 㿠 @ @;;`@zW N@ڐ 㿠 @  @9; @z  @|4 @;;`@y @Д 6N 㿠 @ @;;`@yW P@ 㿠 @ߔ @9; @yِ  @| @;;`@yΐ @ 6P 㿠 @” @;;a@yW R@ 㿠 @ @9;!,@y  @{ږ @;;a<@y @v 6R 㿠 @ @;;ad@yW T@S 㿠 @ @9;!t@y  @{ @;;a@yt @I 6T 㿠 @h @;;a@ybW V@& 㿠 @X @9;!@yR  @{ @;;a@yG @ 6V 㿠 @; @;;a@y5W X@ 㿠 @+ @9;"@y%  @{S @;;b@y @ 6X 㿠 @ @;;b<@yW Z@̐ 㿠 @ @9;"L@x  @{& @;;b\@x @” 6Z 㿠 @ @;;b@xې \@ 㿠 @є @9;"@xː  @z @;;b@x @ &\ 㿠 @ @;;b@x `@r 㿠 @ @9;"@x  @z̖ @;;b@x @h 6` 㿠 @ @;;c@x b@E 㿠 @w @9;#$@xq  @z @;;c4@xf @; 6b 㿠 @Z @;;c\@xT d@ 㿠 @J @9;#l@xD  @zr @;;c|@x9 @ 6d 㿠 @- @;;c@x' f@ 㿠 @ @9;#@x  @zE @;;c@x  @ .f 㿠 @ @;;c@w h@ 㿠 @ @9;#@w  @z @;<` @wߐ @ 6h 㿠 @Ӕ @;<`4@w͐ j@ 㿠 @Ô @9< D@w  @y @;<`T@w @ 6j 㿠 @ @;<`|@w l@d 㿠 @ @9< @w  @y @;<`@w @Z 6l 㿠 @y @;<`@ws p@7 㿠 @i @9< @wc  @y @;<`@wX @- &p 㿠 @L @;<a @wF t@  㿠 @< @9<!@w6  @yd @;<a,@w+ @ 6t 㿠;<aT@=@>d @=?  @yF @/<\@w  @ "  @;<3<a|@wa@N#.v@ݐ 㿠;<a@=ϐ@>6 @=g?  @y @+<a@vߐ @ "  @/<@vԐ @Д -.`v .`w .`x .`y 㿠 @ @;<a@v;<b@Mڐ @ 㿠 @ @/<-<@v @MŐ @xΖ @3<b0@v @ &z@ O/@ &`O'@'` 㿠 @w @;<bX@vq @5 㿠 @g @9<"h@va  @x @;<bx@vV @+ & 㿠 @J @;<b@vD @ 㿠 @: @9<"@v4  @xb @;<b@v) @ . 㿠 @ @;<b@v @ې 㿠 @  @9<"@v  @x5 @;<c@u @є . 㿠 @ @;<c0@u @ 㿠 @ @9<#@@uڐ  @x @;<cP@uϐ @ . 㿠 @Ô @;<cx@u @ 㿠 @ @9<#@u  @wۖ @;<c@u @w . 㿠;<c@ @9="@t8  @vf @;=b @t- @ .` 㿠 @! @;=bH@t!a@ߐ 㿠 @ @9="X@t   @v9 @;=bh@t @Ք .a 㿠;=b;@Kc,@Ԑ 㿠;=b;@K c(@Ȑ 㿠;=b;@K`@ 㿠;=b;@Jb@ 㿠;=b;@JbȔ@ 㿠;=b@Jݐ @u @9=#@s @ ;'bȁ 㿠;=c(;@JĐb̔@ 㿠;=c4@J @u– @9=#@@s @ ;'b́ 㿠  @u @@v6 @  @I *08:p8@a ;=ch@sd 㿠  @u @@v @  @* *08:p8@B ;=c@sE 㿠  @up @@u @  @  *08:p8@# ;=c@s& 㿠  @uQ @@uْ @  @  *08:p8@ ;=c@s 㿠  @u2 @@u @  @͔ !*08:p8@ ;=c@r 㿠  @u @@u @  @ 7*08:p8@Ɛ ;>` @rɐ 㿠  @t @@u| @  @ S*08:p8@ ;>`D@r 㿠  @tՖ @@u] @  @p h*08:p8@ ;>`d@r 㿠  @t @@u> @  @Q }*08:p8@i ;>`@rl 㿠  @t @@u @  @2 *08:p8@J ;>`@rM 㿠  @tx @@u @  @ *08:p8@+ ;>`@r. 㿠  @tY @@t @  @ *08:p8@  ;>`@r 㿠  @t: @@t’ @  @Ք *08:p8@ ;>a@q 㿠  @t @@t @  @ *08:p8@ΐ ;>a4@qѐ 㿠  @s @@t @  @ *08:p8@ ;>aX@q 㿠  @sݖ @@te @  @x *08:p8@ ;>a@q 㿠  @s @@tF @  @Y 0*08:p8@q ;>a@qt 㿠  @s @@t' @  @: B*08:p8@R ;>a@qU 㿠  @s @@t @  @ T*08:p8@3 ;>a@q6 㿠  @sa @@s @  @ f*08:p8@ ;>b @q 㿠  @sB @@sʒ @  @ݔ x*08:p8@ ;>bH@p 㿠  @s# @@s @  @ *08:p8@֐ ;>bp@pِ 㿠  @s @@s @  @ *08:p8@ ;>b@p 㿠  @r @@sm @  @ j*08:p8@ ;>b@p 㿠@sU @;>  b@p 㿠  @r @@s> @  @Q  ;>b@pp 㿠  @r @@s# @  @6  ;>c@pU 㿠  @r @@s @  @ )%*08:p8@3 ;>c8@p6 㿠  @ra @@r @  @~ )f*08:p8@ ;>c\@p 㿠  @rB @@rʒ @  @~ݔ )*08:p8@ ;>c@o 㿠  @r# @@r @  @~ )*08:p8@֐ ;>c@oِ 㿠  @r @  @q @@r @ @~  @~  @ ;>c@o 㿠  @qܖ @@rd @  @~w B*08:p8@ ;>c@o 㿠  @q @,  @q @%  @q @@r7 @ @~J  @~E  @~@ Q*08:p8@V ;?`@oY 㿠  @q @@r  @  @~ *08:p8@7 ;?`(@o: 㿠@q @ ;?)*08:p8@" `H@o& 㿠@Eʲ?`p @P! ?x @P ?` @P ;?` @P 9?  @P  7? @P ?` @O ?਒ @O 5? @O 3?}x`/?@O 沔̖@O -?ؒ @Oݖ 2+?`☐)?@OՒ   @Oϒ '? @Oɖ'%? @OÖ##?a$ @O!!?!4 @O d?D @O @?aT @O ?!h @O ? !x@O  ?a @O ?! @O b?ᬒ @O !?a @O%?̒ @O" ?aܒ @O{ ;?a @Ou 9?! @Oo 7?  @Oi ?b @Oc ?, @O] 5?4 @OW @3?bH @OQ /?\ @OK!-?+?pb|@N)?'?%#Ւ"⌖c@M!??֒"✖`p @M? ? ֒"b!$d@Mې??;֒aؘb@Mѐ9?7?5֒"ȔԘ̖@Mǐ?3?/-֒bܔb@@M+?)?'%גb"4@M#?!?גc#ਘ`@M??  ג## a\!@M??c0ג$bP@M;?9?75גc4#@Ę@M?3?/-גDcPx@M?+?)'ؒcTc` ,l@Mw%?#?!ؒlcx  @Mm?? ؔ#c!a@Mc ??ؒ#㠖Hb@MY?;?97ؒc"<@MO?5?3/ؔĒc@ME-?+?)'ْȔcԖ d@M;?%?#!ْca!X@M1??ٖ!̒c" @M' @ @ْ` ‘@M@;9@`c4#t$@M7@5@3ْ(4`(@M /@-@+)ڒ8D` @L'@%@#!ڒP\aP!@Mu@@ڒ`htb#D@Mk@ @ ے `#0@L@@;9ے`` @Lא@7@53ےഖXa@L͐@/@-+ے༔Ȗ bL@LÐ)@'@%#ے Ԕc@L!@@ے ct#@L@@  ܒa! `( h@L@@;ܒ `ܘa@L9@@75ܒ!,a8ᐘ@L@3@/-ܔHa<D@L+@)@'%ܒaP!\8@L}#@!@ܒah!t㬘c@Ls@@  ݒ!|!`` @Li@@aݔ᜖aT@L_;@9@75ݒa!Ș@LU@3@/ݒaĘ⼖|@LK-@+@)'ݒ̔aؖ#0p@LA%@#@!ޒa#$@L7@@ ޔ"a `@L- @@ޒ" La@L#@;@97ޒb,b8"@@L5@@3/ޒDbPb@L@-@+)ޒ\hch#@L'@%@#!ߒt` \@K@@ߖ В⌔b!@K @ @ߒb"ᄘ@K@;@97ߒbb"8x@Kݐ@5@3/ߒb̔ؖb,@KӐ@@-+`@@LI)@'@%#"a@L?!@@# b0"@L5@ @ #,c8# @L+@@;9DcP`Ș!@K7@5@3/`la|@K@-@cxp0@K+@)@'%c#$@K#@!@㨘cc#@Ky@@  ##`l @Ko@@;ȔԖa0ap@Ke9@7@53#ܔb4@K[A/@-`⸘@KQ;A9`;A7`$#|@KG5A3A/-(`40p@K=+A)A'%`8 D$@K3#A!A`T `ᘘa@K)AA  lx"Lb@KA A @@KA;`A9`c#@K 7A5A3/ഔ`h@K-A+A)'̔`ؖ!\@J%A#A!`!И@JAA!`"Ė@J AA aa(#8x@JِAA;98aDc ,@JϐA7A53aP\`@JŐ/A-A+)dpaT!@J'A%A#!xb"H@JAA"ᐔa"@JA A ᨔa#p@JAA;̖`4`t@J9A7A53!ܔa8@JA/A-+aa@J)A'A%#" b@Ju!AA",8c4#t@JkAA  P"Dc (@JaAAbh\`@JW;A9A75bt"P@JM3A/A-+b☖bD@JCA)A'%b"⸘@J9#A!Ab"Ȗlc@J/AA "Ԕ"`` @J% AA"a$@JA;A97 c!@J5A3A/-$c0l@J+A)A'%c<#H0p@IA#A!cTc`#4@IAA #xcl `@IA A〔#\@IߐA;9Acb"P@IՐ7A5A3/㨔bĘ@Iː-A+A)'cȖ#x@JA%A#A!Ԕc Șl@J7AA"cc"@J-B B `#h @J#BB;9`(` @IB7B534@|a@I/B-B+)LXb@"@I'B%B#!dpc#D@I{BB#Ȓ|` @IqB B `` ̖@IgBB;ଔaPa@I]B9B75`В ĖT@IS3B/B-+`ܔؘc@II)B'B%# c@I?B!B``!  @I5B B !$a0!d$@I+BBa<Hb(@I!;B9B75aX!d⬘@IB3B/-tap@I +B)B'%a!4t@I#B!Ba!a8@HBB  !Ȕ!Ԗa!@HBBb@HB;B97bb #D@Hې5BB3/b(`H@Hѐ-B+B)'4b@ ̘ @Hǐ%B#B!LbX!@HBB "pbd"Tb@HB B−"|X@HB;B97bb#ܘ@HB5B3/b`@HB-B+)ĔЖad!@H'B%B#!ؔb("h@HBB"b#,@Hw B Bc#@HmBB;9c(`t @Hc7B5B3/0<a8x@HYB-+BcHb<T@HO)B'B%##`lc@HE!BB#t〖c#@H;B B #c H@H1BB;㤔a aL@H'9B7B53#ȖИb@H/BB-+Ԕcb@HB)B'%c#H@H #C!C` `<@GCC    (` @GCC<0da@G;C9C75`D PX@G3C/C-+`Xd̘c @GאC)C'%l x〘@G͐C#C!`|` 4t@GÐCC  ` a(@G CC ธܖ@GC;C97`Ĕ`Ж"P@G5C3C/-ܔ`D@G+CC)'`a#@G%C#C! a l@GCC! a$a0!`@G} C Ca<!HԘ@GsCC;9Ta`b"@Gi7C5C3/lxc<|@G_-C+C)'a#0@GUC%C#!` @GKCC!Xᰔa!@GAC C aȔaԖ" L@G7CC;bc@G-9C7C53!tc@G#/C-C @H+C)C'%b"((h@GC#C!0b< @G CCbD"P@GC C "Tb`!@FCCbhtbD@F;C9C75b|"@Ge3C/C-+b✖H`@Fې)C'C%#"Ⱆa<@FѐC!C"Ėᰘa@FǐCC  "̔"ؖbd"@FCCcX@FC;C97bc#̘ @F5C3C/-c@F+C)C'%c#(4t@F#CC!c0c<!(@FCC #PcD"b@F CC#XdPc@FwC;C97lcx D@FmC5C3/c`@Fc-C+C)'c!l@FY%C#C!c" `@FOCC"ԔcȘ#@FE C CcД#ܖ㈘@F;CC;9c`< |@F17C5D3/`0@F'D-D+)` a!@F'D%D#! ,bX"@FDD4`@c #L@F D D  H`T#@EDD;\`h`t@E9D7D53 p|(ah@E/D-D+)aܘ"@ED'D`@FŐ%D#D!`"@EѐDD#D`Ș#@Eǐ D D`Д ܖ8@EDD;9`` @E7D5D@F3D/D-+a`a@E)D'D%#!,b@FD!Da4!Dd`@FDDL !\ `@E DD!dtha@E{D;D97|a"\@Eq5D3D/-aИ@Eg+D)D'%a!ㄘ@E]#D!DaĔ!Ԗ8`x@ESDD aܘ!,@EI D Da"᠘@E?DD;9b bT"@E57D5D3/$4cH@E+-D+D)'<bL#@E!%D#D!Tbd p@EDD!$blb|!d@E D D bb!ؘ@EDD;b⌘b@D9D7D53"Ė@c@D/D-D+)̔ܖc 4@D'D%D#!` @DېDD!\c !@DѐD D c$"P@DǐDDc0;@bĘc@DD9D75L#\x@D3D/D-+cl|,`l@D)D'D%##㘖a @D!DD#㴖a!@DDD  #cЖbH"@DDD;bc<@DED97 c#@Dw5E3E/-`(d@D+E)E'%`4 D8@Dc#E!E`L X@EGEE#\`h#D@DSE E p`|#@DIEE;9``l @D?EE75ऒ` `@D53E/E-+`ถԘb@D+)E'E @E%E#E!Ԕ`"$@DEE !`#Ș`h@DE E !@DE;E97a a0"X@D}EE53La<c@C/E-E+)\l`\ @C'E%|#E@C !a!@@C Eጔap;E@C} E!!9@Cu E a"@CmEᤔ`b@Cea"7E@D Ḗcl@Dݒ E5Ȗ3E@DՒ /aؖd@Dϒ -E+`)E@Dǒ '!\@D %E#aؐ!E@D " T@D Eb"А;@D E "$cL9E@D E b0#Ȑ7@D E<D5E@D E`bH@D "X<3@D EbdḐ/E@D tb4-@Dy №+E@Ds )b#,@Dm 'E%⤖#E@De ! b $@D_ E Ė`;E@DW  E!"Ԑ9 @DO E  b!7E@DG E b5 @D? E b3E@D7 c"А/ @D1  c<@D+ E @D% c,$-E@D + 8`@D )E' #D%E@D # Pa@D  !E #\8@D E ch"@C E  #tc@C E #@C  㿠@);E9Ec;E@*Ր@)c7E@*ϐ@)#5E@*ɐ@)3E@*Ð@)/E@*@)c-E@*@)|+E@*@)v)E@*@)pc'E@*@)j#%E@*@)d#F@*@)^!F@*@)X`;F@*@)R 9F@*@)LF7F$5F@*@)DF3F`4/F@*w@)<F-F D+F@*o@)4F)FT'F@*g@),F%Fd#F@*_@)$F!F`t@*X@)F @*R@) F`@*L@) F @*F@) F@*@@)F@*:@(F`@*4@(`;F@*.@( 9F@*(@( 7F@*"@(5F@*@(a,3F@*@(ې@(")F@)8@'@)3@'@).@'b@))@'"@)$@'F@)@'Fb@)@'ݐF#@)@'אF@) @'ѐF$@)@'ːFc4@)@'ŐF#D@(@' FcP@(@' F#X@(@'Fd@(@'Fx@(@'Fc@(ܐ@'c@(א@'#@(Ґ@'@(͐@'@(Ȑ@'c#@(@'@(@'@(@'}c@(@'x@(㿠;@pOc 㿠;G`@7 @b @9G @` @o̔ ;/c 㿠  @bܖ @@cd @  @ow [@p` ;G`0@` 㿠  @b @@cF @  @oY [ @pB ;G`P@`u 㿠  @b @@c( @  @o; [ @p$ ;G`p@`W 㿠  @b @  @b{ @@c @ @o   @o [ @o ;G`@`+ 㿠  @bV @   @bO @@bג @ @n  @n [V`&@oː ;G`@_ 㿠  @b) @  @b" @@b @ @n  @n s@o ;G`@_Ӑ 㿠  @a @  @a @@b @ @n  @n r@ou ;G`@_ 㿠  @aӖ @@b[ @  @nn Z ;Ga@_ 㿠  @a @@b@ @  @nS Z@o< ;Ga@@_o 㿠  @a @  @a @@b @ @n.  @n) Z*00:p0@o ;Ga`@_C 㿠  @an @@a @  @n  [@n ;Ga@_% 㿠@5~P;G9a;a!@>|7G5ᴖ83G@? /aⰐ@? -G+Ȗc()G@? '!Ԗ㠐@? %G#`P!G@?ܒ !@?֒ Ga!@?ϒ Gb\@?Ȓ G"Ȕb @? G b#@@? G$@?  㿠@&F;G9Gb0;G@%@%^7G@&?5G@#?@%Tb<3G@&@%N"H/G@&@%HP-G@&}@%B\+G@&w@%<bh)G@&q@%6t'G@&k@%0|%G@&e@%*b@&_@%$"@&Z@%@&U@%@&Q㿠@a, @;Gߚ b@^b 㿠@a @;Gߟ b@^R 㿠@a  @;G c@^B 㿠@` @;G c$@^2 㿠@` @;GY cH@^" 㿠@`ܒ @ ;Gi1*08:p8@mڐ cl@^ 㿠  @`9 @@` @  @l i ;Gc@] 㿠  @` @@` @  @l i ;Gc@]ؐ 㿠  @` @@` @  @l l ;Gc@] 㿠  @_ @*  @_ @#  @_ږ @@`b @ @lu *  @lp *  @lx 7`? lm ;Gc@] 㿠@`@ @;Hlx ` @]v 㿠@`0 @;Hl} `4@]f 㿠@`  @;Hl} `X@]V 㿠  @_ @5  @_z @.  @_s @'  @_l @ @_ @ @l  @l  @k  @k lK ;H`|@] 㿠  @_? @(  @_8 @!  @_1 @@_ @ @kٔ  @kǔ  @k” l ;H`@\ߐ 㿠  @_  @5  @_ @.  @^ @'  @^ @ @_} @ @k  @k  @k  @k k ;H`@\ 㿠  @^Ȗ @(  @^ @!  @^ @@_B @ @kb  @kP  @kK k ;H`@\h 㿠  @^ @@_ @  @k. l ;H`@\M 㿠  @^x @@_ @  @k n ;Ha @\2 㿠;HaD@3P @^Y @@^ @  @k4 *08m:08 ;HaL@\ 㿘  @^= @@^Œ @ @jؔ ':*08:p8@k@k ;Hat@[ 㿠  @^ @  @^ @@^ @ @j  @j k# ;Ha@[ǐ 㿠@^ @ ;H^u@k a@[ 㿠@^n @;Hf* a@[ 㿠@^^ @;Hf a@[ 㿠@1;Hb  @< ;Hb, @< 9H"8 @< 7HD @<} 5HP @@<+J@ 8@H)J@ 2@`T'J@ ,@ `%J@ &@p#J@ @|!J@ @ߐ`;J@ @ِ 9J@ @ӐJ7J5J@ @ːJ3J`/J@@ÐJ-J +J@@J)J'J@@J%J#J@@J!J`@ߐ@J @ِ@ J`@Ӑ@ J!@͐@J@ǐ@J@@Ja(@@a8;J@@z!D9J@@tP7J@@nX5J@@had3J@@bp/J@@\|-J@@Va+J@@P!)J@@J'J@@D%J@y@>a#J@s@8!!J@m@2J@g@,Ja@a@&J!@[@ J@U@J@O@Jb@I@J"(@C@ Jb<@=@ J"D@7@JP@1@J\@+@Jbh@%@bt;J@@"|9J@@ސ7J@@ؐ5J@ @Ґb3J@@̐/J@@Ɛ-J@@b+J@@")J@@'J@@%J@@b#K@ݐ@#!K@א@J@ѐ@Jc@ː@J#$@Ő@J0@@J8@@~Jc@@@xJ#H@@r JcT@@l J#`@@fJl@@`Jt@@ZJc|@@Tc;K@@N#9K@@H7K@}@B5K@w@<c3K@q@6/K@k@0-K@e@*c+K@_@$#)K@Y@'K@S@%K@M@`#K@G@  !K@A@K @;@K`,@5@K 8@/@KD@)@KP@#@K`\@@K h@@ܐ K`x@@֐ K @ @АK@@ʐK@@ĐK`@@`@@ @@@@@@`@@@ې@ @֐@a@ѐ@! @̐@0@ǐ@<@@aH@@!T@@}K\@@wKad@@qK!h@@kKt@@eK@@_Ka@@YK!@@S Ka@@M K!@@GK@|㿠  @WȖ @3Ka@U @dd "  @.7K@UaxW@eE 㿠  @W @3Kb@Up @dE "  @.7K(@UdaW@e& 㿠  @W @3KbH@UQ @d& "  @.7Kh@UEaW@e 㿠  @Wk @3Kb@U2 @d "  @.7K@U&aW@d 㿠  @WL @3Kb@U @c "  @.7K@UaW@dɐ 㿠  @W- @@W @  @cՔ C*08:p8@d ;Kc@T 㿠@+<A;Kc0 @5ޖ ;Kc8 @5ؖ 9K7$#@∐5K@4^ 3$Dc@4X /K-$H+K@4P )$cL#@4J 'K%%Tx#K@4B !%c\ @5  㿠@C;K9Kcl;K@v@;ct7K@p@5#|5K@j@/3K@d@)/K@^@#c-K@X@㐲@R@@NKc@V?㿠  @V @@W# @  @c6 h*00:p0@d ;Kc@TQ 㿠  @V| @  @Vu @@V @ @c  @c   ;Kc@T) 㿠  @VT @@Vܒ @  @b  ;L`@T 㿠  @V9 @  @V2 @@V @ @b͔  @bȔ  ;L`(@S 㿠@V @;LP `T@S֐ 㿠  @V @  @U @@V @ @b  @b = ;L`@S 㿠  @Uٖ @  @UҖ @@VZ @ @bm  @bu F ;L`@S 㿠  @U @  @U @@V2 @ @bE  @bM _ ;L`@S^ 㿠  @U @  @U @@V  @ @b  @b% p ;L`@S6 㿠  @Ua @  @UZ @@U @ @a  @a  ;La@S 㿠  @U9 @@U @  @aԔ *08:p8@b ;La$@R 㿠  @U @,  @U @%  @U  @@U @ @a  @a  @a *08:p8@b ;LaD@R 㿠  @T @@Ui @  @a| ?*08:p8@b ;Lad@R 㿠  @T– @@UJ @  @a] ;*08:p8@bu ;La@Rx 㿠   @T @`@T @Y @T @R @T @K @T @D @T @= @Tx @6@U @1 @a @a  @a   @a  @`  @`  @` #\*08:p8@b ;La@R  㿠@TĒ @;L  a@Q 㿠@T @;L  a@Q 㿠@T @ ;L .*08:p8@aҐ b@Q֐ 㿠@T @ ;L !*08:p8@a b@@Q 㿠@T| @;L ' bh@Q 㿠@Tl @ ;L)*08:p8@a b@Q 㿠@TX @;L? b@Q 㿠@TH @ ;La*08:p8@av b@Qz 㿠@T4 @ ;L*08:p8@ab c@Qf 㿠@T  @ ;L*08:p8@aN c$@QR 㿠@T  @ ;L*08:p8@a: cL@Q> 㿠@S @ ;L*08:p8@a& ct@Q* 㿠@S @ ;L*08:p8@a c@Q 㿠@SВ @ ;L*08:p8@` c@Q 㿠@S @ ;Lv*08:p8@` c@P 㿠@S @ ;M*08:p8@`֐ `,@Pڐ 㿠@S @ ;M *08:p8@` `\@PƐ 㿠@S @ ;M^*08:p8@` `@P 㿠@Sl @;M `@P 㿠;M`@' @Rɖ @,  @R– @%  @R @@SC @ @_}  @_Q  @_L Ӓ*08:p8@`b ;M`@Pe 㿠  @R @,  @R @%  @R @@S  @ @_  @_  @_ x*08:p8@`) ;Ma@P, 㿠@R @ ;M*08:p8@` a(@P 㿠@RҒ @ ;M*08:p8@` aL@P 㿠  @R/ @@R @  @^ʔ `*08:p8@_ ;Mat@O 㿠@R @ ;M,*08:p8@_͐ a@Oѐ 㿠@R @ ;M"*08:p8@_ a@O 㿠@Rw @ ;M*08:p8@_ a@O 㿠  @QԖ @@R\ @  @^o *08:p8@_ ;Mb @O 㿠@RD @ ;M*08:p8@_r b0@Ov 㿠  @Q @@R) @  @^< *08:p8@_T ;MbT@OW 㿠  @Q @@R  @  @^ *08:p8@_5 ;Mb|@O8 㿠  @Qc @@Q @  @] *08:p8@_ ;Mb@O 㿠  @QD @@Q̒ @  @]ߔ  ;Mb@N 㿠@Q @ ;M*08:p8@^ b@N 㿠@Q @ ;M*08:p8@^Ґ c@N֐ 㿠@Q @ ;M*08:p8@^ c@@N 㿠  @P @:  @P @3  @Pߖ @,5M`@%ː @PԖ @!@Q\ @ @]o  @]j  @]e  @] *08:8 ;Mch@N{ 㿠  @P @(  @P @!  @P @@Q  @ @]3  @].  @]) ϒ ;Mc@NF 㿠  @Pq @  @Pj @@P @ @]  @]  ;Mc@N 㿠  @PI @  @PB @@Pʒ @ @\ݔ  @\ؔ  ;Mc@M 㿠  @P! @  @P @@P @ @\  @\ *08:p8@]ǐ ;Mc@Mʐ 㿠  @O @  @O @@Pv @ @\  @\ *08:p8@] ;N`@M 㿠  @Oɖ @9  @O– @2  @O @+  @O @$@P< @ @\O  @\J  @\E  @\@ i*08:p8@]U ;N`@@MX 㿠   @O @F@O{ @? @Ot @8 @Om @1 @Of @*@O @% @\ @[  @[  @[  @[ H*08:p8@] ;N`d@M 㿠  @O/ @,  @O( @%  @O! @@O @ @[  @[  @[ n*08:p8@\Ȑ ;N`@Lː 㿠  @N @,  @N @%  @N @@Op @ @[  @[~  @[y ?*08:p8@\ ;N`@L 㿠  @N @9  @N @2  @N @+  @N @$@O0 @ @[C  @[>  @[9  @[4 *08:p8@\I ;N`@LL 㿠  @Nw @  @Np @@N @ @[   @[ L*08:p8@\ ;N`@L  㿠  @NK @@NӒ @  @Z *08:p8@[ ;Na @L 㿠  @N, @@N @  @Zǔ *08:p8@[ߐ ;NaD@K 㿠  @N  @  @N @@N @ @Z  @Z *08:p8@[ ;Nal@K 㿠  @M @@Ni @  @Z| *08:p8@[ ;Na@K 㿠  @M– @@NJ @  @Z] s*08:p8@[u ;Na@Kx 㿠  @M @@N+ @  @Z> ^*08:p8@[V ;Na@KY 㿠  @M @@N  @  @Z I*08:p8@[7 ;Na@K: 㿠  @Me @@M @  @Z 7*08:p8@[ ;Nb @K 㿠  @MF @@MΒ @  @Y $*08:p8@Z ;NbH@J 㿠  @M' @@M @  @Y” *08:p8@Zڐ ;Nbl@Jݐ 㿠  @M @  @M @@M @ @Y  @Y *08:p8@Z ;Nb@J 㿠  @Lܖ @@Md @  @Yw *08:p8@Z ;Nb@J 㿠  @L @@ME @  @YX *08:p8@Zp ;Nb@Js 㿠  @L @  @L @@M @ @Y2  @Y- *08:p8@ZD ;Nc@JG 㿠  @Lr @@L @  @Y  *08:p8@Z% ;Nc,@J( 㿠@L @ ;N*08:p8@Z cT@J 㿠@LΒ @ ;N*08:p8@Y c|@J 㿠@L @ ;N*08:p8@Y c@I 㿠@L @ ;N{*08:p8@YԐ c@Iؐ 㿠@L @ ;Nw*08:p8@Y c@IĐ 㿠@L~ @ ;O*08:p8@Y ` @I 㿠;O`D@ ΐ @Kז @  @KЖ @@LX @ @X  @Xf ϐ ;O`P@I 㿠@L> @;O  `t@It 㿠@L. @ ;O*08:p8@Y\ `@I` 㿠@L @ ;O-*08:p8@YH `@IL 㿠  @Kw @@K @  @X > ;O`@I1 㿠@K @;Oi& a@I! 㿠@Kے @;Oi a(@I 㿠@K˒ @;Oj aH@I 㿠@ZOah @) ;Oax @) 9O! @) 7Oᘒ @) 5O @) 3Oa @)ޖ /OȒ @)ؖ -Oؒ @)Җ +Oa @)̖ )O! @)Ɩ 'O  @) %O  @) #Ob0 @) !O"@ @) !OL @) ObT @) O"` @) Ol @) Obt @) O "@)  Ob @)  O" @)~ O⬒ @)x Ob @)r OĒ @)l Ob̒ @)f ;Obؒ @)` 9O" @)Z 7O @)T 5O @)N 3Oc @)H /O @)B -O @)< +Oc @)6 )O#  @)0 'O( @)* %O0 @)$ #Oc8 @) !O#@ @) OP @) Oc\ @)  O#h @) Ot @) Oc @( O #@(  Oc @( O# @( !O㴒 @( "OcĒ @(ܖ #OԒ @(֖ $Oc @(Ж %;Oc @(ʖ &9P  @(Ė '7P  @( (5P @( )3P`$ @( */P4 @( +-P@ @( ,+P`P @( -)P ` @( .'Pl @( /%P| @( 0#P` @( 1!P  @( 2Pࠒ @(| 3P` @(v 4P  @(p 5PȒ @(j 6P`ؒ @(d 7P  @(^ 8 P` @(X 9 P! @(R :P @(L ;P%a<;%@(& Pca$@(  9P7&!4X5P@( 3&D`Đ@( /P-&Xd+P@(  )&ap!@( 'P%&|D#P@' !&a"@' P&ᔖc;P@' P'!$9'@' 'P Ĕa7P@'ޒ P 'a!@5(@'֒ P'Ė$3P@'Β Pa'b/(@'ƒ a#@' Ԑ@' a@' ;Pb ;(aT9P@' 7("ᤐ@' 5P3(0a/P@' -(@4@' +P)(bP"'P@' %(\Đ@' #P!(bl#;P@' P(|cd9)@'} P("㴐7P@'u P)b`5)@'m P )"`T3P@'e P)"Ȗऐ/)@'] P)`-P@'U b!D+)@'O )P@'I c(')@'C 4b4%P@'= #Dt#)@'7 Lch!P@'1 *#\L@'+ P*ch ;*@'# P*x`9P@' *P!hc7*@' P *c!5P@'  P*㤖3*@' PbXc@& #Ԑ/P@& ̖c$-*@& ܖ+P@& )+c @& 'P%+#Q@&ݒ !+` !@&ג Q+aT;Q@&ϒ Q+ (ᤐ9,@&ǒ +Q!`07Q@& Q +`@c5,@& Q+ L3Q@& Q,X`/,@& `d!$-Q@& pԐ+,@& `|ℐ)Q@& c'-@&  %Q@& #-aА@& !Q- ⴐ;.@&{ Q-`#̐9Q@&s Q.̖`|7.@&k Q . ؖ`5Q@&c Q .`!t3.@&[ Q.$/Q@&S Qba@&M !-/@&G  c+Q@&A 0)/@&; a@ 'Q@&5 %/P @&/ #Q!/a`!;Q@&' Q/pb890@& Q/!ⴐ7Q@& /Q#0a50@& Q /a#3Q@& Q0a\/0@% Q0Ė`-Q@% aԖ +0@% L)Q@% bᜐ'0@%  a%Q@%ߒ "<#0@%ْ ,b!Q@%Ӓ 0"<,@%͒ Q0bH#|@%ƒ Q0Tc̐@% Q 1"d`8@% Q1"px@% Q1b|@%  㿠@ ];Q9Qb7Q@ @ U"5Q@ @ O3Q@ @ I/Q@ ~@ Cb-Q@ x@ =+Q@ r@ 7)Q@ l@ 1b'Q@ f@ +#%Q@ `@ %#Q@ Z@ ,!Q@ T@ c@;Q@ N@ #P9Q@ H@ Q7R`5R@ @@ Q3Rcl/R@ 8@ Q-R#t+R@ 0@ Q)R'R@ (@ Q%R#R@ @ Q!Rc@ @ ސQ#@ @ ؐ Qc@ @ Ґ Q#@ @ ̐Q@ @ ƐQ@ @ Qc@ @ c;R@ @ #9R@ @ 7R@ @ 5R@ ݐ@ `3R@ א@  /R@ ѐ@ (-R@ ː@ `0+R@ Ő@  8)R@ @ @'R@ @ ~H%R@ @ x`P#R@ @ r X!R@ @ lR`@ @ fR`p@ @ `R |@ @ ZR@ @ TR@ @ NR`@ @ HR @ }@ B R`@ w@ < R @ q@ 6R@ k@ 0R@ e@ *R`@ _@ $a;R@ Y@ !9R@ S@ $7R@ M@ ,5R@ G@ a43R@ A@ D/R@ ;@ T-R@ 5@ a`+R@ /@ !p)R@ )@ 'R@ #@ %R@ @ a#R@ @ ܐ!!R@ @ ֐R@ @ АRa@ @ ʐR!@ @ ĐR@ @ R@ @ Ra@ @ R"@ @  Rb@ @  R" @ ې@ R0@ Ր@ R8@ ϐ@ RbD@ ɐ@ bT@ Đ@ "d@ @ x@ @ @ @ zb@ @ u@ @ p@ @ kb@ @ f"@ @ a@ @ \@ @ Wb@ @ R#@ @ MR @ @ G;R9Rc;R@ z@ ?c,7R@ t@ 9#<5R@ n@ 3P3R@ h@ -`/R@ b@ 'cp-R@ \@ !|+R@ V@ )R@ P@ c'R@ J@ #%R@ D@ #R@ >@ !S@ 8@c;S@ 2@ 9S@ ,@S7S5S@ $@S3S`0/S@ @S-S H+S@ @ِS)ST'S@ @ѐS%Sd#S@ @ɐS!S`l@ @S |@ @ S`@ @ S @ @S@ @S@ ߐ@S`@ ِ@`;S@ Ӑ@ 9S@ ͐@7S@ ǐ@5S@ @a3S@ @/S@ @z,-S@ @ta8+S@ @n!H)S@ @hP'S@ @b`%S@ @\al#S@ @V!x!S@ @PS@ @JSa@ @DS!@ y@>S@ s@8S@ m@2Sa@ g@,S!@ a@& Sa@ [@  S!@ U@S@ O@S @ I@Sb@ C@b$@ >@"4@ 9@@@ 4@P@ /@b`@ *@p@ %@@ @b@ @"@ @ې@ @֐@ @ѐb@ @̐"@ @ǐS@@Sc@@S# @@S,@@S<@@ScL@ސ@S#\@ؐ@ Sch@Ґ@ S#t@̐@S@Ɛ@S@@Sc@㿠@5`@'`  '`Q@@+SQ;c  @/SQ4-SQ1 $O   '`Q%@3SQ c @;SQc $O 㿠@ Q;ScQ㿈V >@@ #`@c\ ` `$ @`/``!@@`/``"@` /``#@` /``#@/``$`@+ aЀ`@ $@ -S;3P3S@ /S/S $;'P3Sdc;P 㿀a@ b9Sb#' @d/ !S##  @h/ )T $@ @5T/ `  %@@@T/  '@@@T/   !@ @# !T/  0 # @@+T/ `@$  @V =@&5;T7;T :`PPH;T`\:P?  p;@@@ ;T`h'  @@/` T`p `@@/`Tx"@`@ @!@/`T&`@@ ' @@  /`-T%`/%T '/@@ T.Զ& @@T/` !`@ @ T.`Զ"  '@@%T/`$`'@@-T/`%``@/TOҐ̐@1TOʐ ؀"@ 3TOĐ` ԀH  5TOp9T O!(/`> 㿈;@@  T a,"`@@!.T!4" @@) .'T@$@ @@1./TH%@ @@;T.9T!P&@ aXu6 3p?㿐;@@T7al@@' T7@@ %T1 @@ /)T/Tᐪ Q <-`;@H9T /`!t @@` ! @H5  T/`!"@ `! @2@ )T -T@H3T)T /`!-T$@` 7` 3p?-`a  -`> X;D@;@@ 9T!' @  @)/ #Ta"  @'@ / 1T!%@ @@ @ / TȂ& @@T/ А !@@ @'%T/ ؠ #@@1 /T/  %@@@7T/  '@ @@ T/ a  @@!T/ ! "@ @@+)T/ " $@@@T/ b %@@T/  '@@@T/ b  !@ @% #T/ b( " @@/ -T0$ @7T5T/ @ %Pk7 3p?㿐;@@@  T "l' @@ T/ "t"@ @@  );@H7/ 'T•$ )@2@1T @@5T1T/ "%@  @3TN;b? 5T(? 3p?㿈;`c\@ ` `"` @` /  $@ @` /  $ @` /  %@ @`  /  % @ /  &@ @7TN7 ;Tb7 3p?x;@@ +!T+#'  @@`, 5T %@`, T c<#@@T, T&   '@` `@T`H`T`, t" @%T#T, c" `@@ `;T`c'  @` /`-T`%@T/`c%`@@  7U 'ض @@.U ( @ @#Uؕ.`<"  @@/% @@ -U.\ض$&`/@@ U.`tض&`@ V b*`" * $@@ `K8@ `.'Uؤ#`@)UMN @+UMF`@/UMAਐ-UM;@4 3p?/ >5U3UM,M'` 㿠; @@  ;U9UM`)M Զ 㿐;al@ fɐOِĐƐu @V ⠇(` (@`$ @>45 0? 2p?.089p84`+8 8830?4 @ -8 :81p?7`-p8 3?887 @-08 2?;p86 ,8 10?:p86,8 3p?8p86`.08 ;082?2 @ -8 10?9p8@-< J`8 @>5 4 3p? .08;082?4` -8 9p80?4 @-08 8p83p?7` ,8 :82p?7 /p8 0p?9086,08 30?;86 ,p8 :81p?6`-8 3?882 @-8 ;p830?@ - < @>5 4 3? -p8;p82?4`,8 :81p?4 .08 883?7` ,p8 2?;087 @-8 10?:p86,08 3p?8p86 -p8 2p?:86`-08 0?9p82 @,8 ;83p? . = 2@C%U @>5 4 2? -8:p810?4`@-08 883?4 @ ,8 ;082?7` ,8 0?9p87 @.08 3p?8p86 -8 2p?:86-8 0p?9086`-p8 ;830?2 @ -08 2p?:8@,< %UKԐ؁ 㿠;7Ua+`$4\ e 65Kǐ 4mV b.`%-@ #bKUaK㿠;7bD;'cf @J:+)Đa8%!l}@1U-UK!DK F/J5 @*`  "  @ *`   !`@ @   *`  㿠 `' `'   @@ܒ  &   # :` @ :   # :` @ :  @ @ * `" 㿠  @%&& @ && *O%& 㿠 @&'=`5@= @?'  '  ' '   ' O'  ' @ ' ??' ' ' 8O?  & &㿠 Z '  '   @@@V  `& 㿠T2@ ?@*`a` 㿠;@  @  W` 6 3p?㿠'2@` @ @ 2 2?6 3p?`㿠" 7`#3p?㿠@?@9k㿠`@@@ʁ 㿠`@@ @  㿠ؒ@ ` "@ `@ @ `㿠Ð@` @@ @`` 㿠@` @@ @`` 㿠@`@ `W `@  㿠@ ` @`` 㿠r2@` "@ ` "@` 㿠  '   @@O  & 㿠 '`  '   @@=  & 㿠@E '`  '   @@@'  `& 㿠@@\݁@ z㿠`@ @/U L@/Ud@S@E" '  &  @@  & 㿠 @E@@  '` '` & @@@Ւ  `& 㿠@  .`%.`@ > % %& 㿠@  .`%% .`% `@ǔ '  ' 㿠@  .`%` .` @y $ $  @@  & 㿠 D '   &  @@l  & 㿠@  #` @! T@@/` P%-`@H &&  @@=  &   㿠@$  '`  '   @@@&  `& 㿠 @Dy'`@ S& 㿠@  .`&%.`%@͔& 㿠@  .`%` .` $@Z ?" ?"  && 㿠@.` @%  .`@ ?" ?"  &&  # " ?" D㿠 `@?3  X@ . P"*@ & X5'U#\ P  T@ & P  T ` P.& T# & `+`! `?! @ P?@% & ` +`" @n \3`  `3` c@ @?" \@5W*` " \@5S㿠@6 `@`"@ %`%9U/`!`a@ @ *` P#@  X+` !`" X㿠'#?`@^"@   & &  %  %   @@  &  '`&  㿠;U a@C]@ 2@  @ % 2@ `"@`@&H`&2O㿠 &`/`@&& @4Ł㿠@ @Bє  '` '   @@  & 㿠\% @@4@@ @ @@sR@㿠@ @Z6 @9U!@@[@ "H @ 㿘@T ) &@@  ` 㿘@> @`  @j?`@ 4H@ &&`  9U! 㻐@ @ @ *@O`@O``@Z `-'*O@ 㻐@  @ @ *@O`@}O``@Y`-'*O@ 㻐@ Œ @  @Đ` @@e O@} 㿘@   @ ݔ Z@H9U!@ F O`k 㻐@`@ Ub@  @@ (@ @@.`'O@5 㿠`1 @ ;U@.  H;U@b㿠`` @ /`  @ %` " 2?@  @`2 @  `&`&&& { @%`@Aې ' & ?`6 3p?㿠?? @&@  @&"@R @I&V`@A C$@=``@@@ % &O@V @ 3 @ @,&  $``@Q,`@6O@9a&%$.&@&`O 㿠@ o  @@ @ B`" ``"  @*O7V(@9@ :&  &` &`  @@T  & 㿠 '@? `=@@v.@$DXt 4h 0xX`  @ x 0 p  H P D㿐` h'! T$@T"@T  @' + #\Lcc`  '@ ?`0G.`& 5& 5@& ?5 @ 5 & ?5@? /5& GǶ&5 &&5!@&5 & ? &&5 @&&5  &5 ?@ &`&5 &`&5& { & &}& &&ݐ & &r5 & &&& ̐ & &a5 &@&&&  & &O5  ''&&&&  & &&&6& @*5@ &\&*5& %&` 5& & ? :5 & &`5o&  5 /5&aG& 5&5 #+`@ @ `" " G%&5 ?5& `G& &@ 7`" " G٬%&@&&@ "@"@ L &`"@&@ 5"&&3 5#@@ &`@&u&@  "@l"@   & @&V&@ `"@M"@  hZ &b`@&7&@  "@."@ ֔ I8`@.H &? 2G7&V&,@15&%) && @)$`"@&@&  & "H &&&@ʐG5"(` '&@G5!('&G5%*@ '&Gё5"(` '&G5!('&tG5%*@ '&`G5#* @'&G5"@)`'@5&#@+ '`@5&~ ('w5"*@ 'o&'h @ =&@V`@@͐`@ 1&@V \@耣@ %&@/V|@$@G:5#@&+  '3쀡@ G.5%&+ ''耣`@V`@&쀢 $@ 4@ & 5쀡@ @5& %+ '`@V`@mX@@ 5!@&) ' &&&` &` "` "`&@2@ &&5  -& & &'& 5 5 ! @'㿠;V`@ ҐG? @I ;V9V`7V@ @*@r @ @? @㿠@(@R@;Va 9VD?a?!: X?㿠;Va*y?m?{? @;Va$@)<ϒ?Ӓl㿠] @ c J `.@Ð    @  㿠@+@@? @-;V;Va\;Q@ ) `(ؔ  @m@)9@)C㿠@*ܒ@@v @  ;VZap??㿠b@ ?,@)@8㿠@*@- @Ձ;Vax@(㿠`@` @L@``  O?@@8 ;Va@:g@;V9V!'a@h;VaԐ@KՒ㿠l@@;Va@u㿠@ׁ㿠ے?@;Vb㿠_@ @i&㿠?@ @@ @K&܁㿠$@ В@ 㿠헒?@㿠@&`  Ĕ ``ﮐ$O`㽨'L 'P'T'X@LL @G㿠  @2@  z & `&  㿠 `@$  ?? %` @ H6H % O '& 㿠Ɛ@ѐ 㿠@& $ @ @` `& N``' /`2O 㿠@J㿠 `@`    @ k  & 㿠  풒? & d@?r? @JĔ & el@쉒?  & r"`` "`"`㿠.``(/`z  `& && @& & & & `  ! :   9` @`` !:!`  :  @  @|V!@#`@l   #@:  ` :@ @( `" 㿠 '@? =&`@.@& `@$`  & @ &$ $ & % 2O 㿠 $>=`@%`+`#``@ #` ###`#` #`#`2O`  @  & 㿠   & v & lƀ& & & l@ l`@ ;V'b$''@ l`@ `'''`֒㿠V` & H@"$ `@ ` &% O% @& `"``"$O`@* &#㿠 .' m%%@㿈``@@%y H* `8@ V",@9S& & '&& d @Vb4V` @ V͔V"<tV` @ x@ @ :@8& `&``&` @*O`+& $@)&  @@`&&`&@ ``@*O`&   &  @& & 4O&& @#t ``l㿘 `3T/`b&''@2H& 㿠``@`@4 ҁ@ ́㿘 \333 `K@ 2 '7`'4@ @)T@#) `#D@@  ` \%& \"H 㾈@V"D@H@ @JK@JK4 3p?`@+c@ -VH@J?@ /VL @;b$3ܒ &1@.c@@H㿠@ ?Zx@VbP@N``7` 3p? c㿠@ ?1㿠@H6㿠;VbT@ `@  % %  @    & e &r㿠@֐ @㿠 `@`'`4  @I@;VbdĐ @GX'D'H'L ' ' l'' '& @I@DH@LD$lD$`D#[DD%`  @  +`@@+`@(O+`  ` @  @ @"H `"@`&@"H`  3 3p?``  1` 0?` @3 2?` @ 2 10? 㿠  @@ J  `& &@& & ` 㿘@G֔ @2@O` -   @9!`'O` @ `'O` @O`"@&`  㾈'L'P'T'X@HϔL*㿠N`=@ `@H+@@`@G$ @"'V@G.+Vb@G*9V$ "@H4HL@@7V;V@G@Fb@H@G 9V"@G ``@ `@`"H``"H `@ `"H``  `0 `0 1   #` * *` 㿠Ӓ@ 2@```O;9V;"aX  #` @ * *`2@ 2H2OaX `#` * )``2@@ 2H2OaX`@ `@     Ӟ㿠`@ `!!X @#VcA`333` '@5 K 2 4@@*`` . `@``@&O` 㿠`@/@` @(4 g"<`K 2 <<`"laX@; 9c!X%@@ \2O &` &`㿠#@.`V(* 뿔`@0'``&`   @`@% `$`@$ `@# `"`"`O@`@$ `#`@# $O`` `((`  & `'``@% '` 㿠 w  " (" &(" " ` &`" А㿠` `/ @/`%& ` `T R `@ #`  `` @``@ $O` 㿠``=`>%@-[@ @ 5< N% G@%  `@  @  "  "  $O  㿠;Vc86Hc@LO``@+` @@#@@  @ 2O &`'``'``'`` '` `'`$``'`$`$`$``  `"@``@ % &`  O`j㿘 ''㿘 '' " " 㿠@-t D? 2@"  " Y" `" " 㿠@ @D㿠 @?` @F#!@" ?'`'``'` 2@"  "  " Ya$" " 㿠"@%  @ ?@  & %`& @  @D; @ '@& & O․ 㿠_;VcLs~ y?@ ;VcTfq l??V妐?@K嬁㿠;Vc\ 㿠@{;V+:H c@@> 7V3Y7Vc(7 㐲@㿠;VUck?! ?g? @?;VcT?  ?P?N㿠 @/  @. @/V@ @ ;V53V̒c@C7@c;W@'9W 某?#?`濐?q ? 泐h ђ? 㿠;WM` 㿠@ՐӒ;W`@;W昐?撒xM痒??撔 `H@H @戔 9W-Z9W恔  T@7/Z G㿠曒/? "@%?E;W9W``X>`? hP6X??B䒐?@<䗒?䕁㿠;W9W`p;W19?`x)1? !)?N@ -WH3?Ē?V@ ?@ U㿠@ ? ?7㿠@妒́?Ȓ噒ϒ?㿠w ??嶒?8?漒?㿠d 妒??%?㿠  ;@C` ؐ s ;W`T? @0/W偐6 @/# @5W@0`@@ <9W @B0<d磒 ;W`]眒    㿠㠐9W ;偐` @(?7W3WȮ`  ֔ 䓒@א@@C@C?O;W`@C~ 㿘 J @  @=Q ِ   '`"@'W @CV@@!/O`ᙘ `@9`!'O` @ `'O` @`O` @䥐 䑐 㿠  Ԗ i 㿠   岐 㿠   㿠 㽒 s 㿠 } M  O 㿠@[ 㿠  @J 㿠; ?@  M  忐 㿠 A I   㿠 4 < 9 j  㿠b  7   @   @3Wa֒ 9W!,@@ސ@;Wa0Ȑ@Ғ @ߔ 㿠;W1   @@ah@;Wal@ 㿠娐ɐ圐Đ 㿠  噐 㿠В ⪒ ⶐא 㿠  ( 嶒 @ ㇐ 㿠@"`@  㿔 ;l.`ax 㢐㿘 J `@;Wa7  ǔ㿠̐   㿠;Wb$ y  J w + ?@+W b()W㋐ᢐ "8Iᙐ -WH`@ $` 㽒 Oؔ?@ 7W\$@@@3 x@   @@& p@;Wbl\" Ll`9^˒  H  @;* @@Q ᣒ )W┒@?"'+W⊒@?b/Wk⨐@?7W 3Wbf⸐ 㿠    俒  @? Z s   5 a? 2@  O 㿠 g  c @e @?+ (%  3? 2@  ໒I O 㿠C   @ ;Wb 9WV "Д 㿠 ! N   㿠   =@3W3W? b6@⑔J%Oฒ> 㿠 ڔ    @ h@@ `b`@O`;Wbѐ&ᢐፐ 㿠  㿠  @j &`g&d F r??`7 3p?Ё㿠@@Ȧ&9WW"c ???? Ô@&͒&@@3`@; @߰֔@ߞ@w”Ẕp`ᰔn@@ǐw᝔[O%ᑔO@@%X~<O@+Cie&&@&&;@OF㿠  ֒ ߊ ?@     㿠;W?ct 㿠; a;`a ࣔ ፒ $O㿠;a;Xǔ !`9X zځ㿠 &`/`` $" & $2 "  `& `㿠  D" " " " " " " " 2 2 "2 $2 &" ," 0" 4" 8" <" @ " (&  4  +  *#@ * ) @  0+`+ *` `D㿠&` `@& `㿠``$@`ݐ `'@& `` ⨔ `8⤔ `⠔ `✔ `☔ `,└ ⒁R` `#`+` " " ` ⇞ 4 @ 8`@ @ ` 6@  `2H ) #@+ @  @ @@ $O 㿠 & $ a@ !  & & &  @"K& 㿠 @"D& (;X@e`@<~@㿠 @@Ё @ @㿠 @@   @ @ʒ@-;X@)a|@<@|@}㿠 `  @ @-`@H;9Xc#\!8  ɘ %   -``% &&`㿠 @ԁ㿠 7XPa7` 3p? f㿠 ā㿠 5X ``;c#\84 ᒘ 4&8-%-`"4 &4㿠 7XdW @`@ ȐܒW -%! @"` Q``+  0@ `!  8(`"@(` "2OP @"` Q #`1 * ; *`8 a ( @*  "`2OQ 㿠@$G   @! Q ` @)` 8 (` + @@" ` <`J 2p 9`>  (` @@`,OC> ?`K@30 >`> %- %@&@w㿠 ;!B@   ,@-5Xp/ > `;@#`}@!@ `C:`> I@10 8> #@Q-#@+ @%@v ,Oې`C> ?`K@30 => %@*% ,&@b㿠 `}@ `;@ `[H@aH &` &`ߐ =@ \&` &`&`&`㿀   @  ؒ {ʐ ;@'X┨@5 3p?ϐ@ } {ږ7XⰐ@ؒ /`,``?@%㿠 a @`{@ `%@K`(@AI7X@,aH.C7Xa@ a @a@997X@a"H 37X  Y@   @ ?O ѐI    A  @ &`?&`&`4@ )W@ 㿐@@ G ! "@   -@  !@ <@ -@  *"@C  +@4> "@<  /H/7 "@5  >"H2 ^H'- !@!@ !"@$ ! H "@ !H "@ !"H !H        㿐   @ @ N' @&%. O@@97"⸬@ bO@А@ m`@. O@O?!@"!`@   "@ !H  㿠 W @ݐW '@@ W &H㿀;Xb@ d `,@  p =`=+Xc  5 3p?gڐ`@@ 8   @  㿠  @ 㿈 @ F ,!@@ @ 0@ z!!8Ԑ㿈 @ !!"@ X㿠 @ ?@!\@ ?@ 9@@ 3㿠 В =~˒ ,yے ,@q @ ۔ ;XL c ;Xc$   , -㿠 ,  a@ ;X 5X@, 5 3p?`c0e<9X#@ .j     /㿐 +JՐ `=@`,@ ;X cH@!!w㿠' J!㿐? ' @@@ @A@ ې O@@@ @+@ u@ @@ f!! $㿠 Ѻ\ ` ,O =@ Zd㿠C:@.@: : 7` 3p?@ Ĕ :`@&`㿐ؐ@@㿐 ܐ`@@';Xc\@2  @ 㿠 e @  ;"@  W`@  V6㿠  (W @3Xcl@'E&@@.@'@@؁㿠 a @a@ `%@JaHPa"@) O;X@0a"H7 a "H F;Xa@ a @0a"H& aH39;X@ aH)3;X   !!?    W  ^ w  c@ 㿠 `)@%   ,a@a"@ 7XÐ Kx`@2O  l iВ44'`<Ȓ (`@ ;Xc k  )@!!і4t㿠  @E ;`@ O㿠@ @  @a א ;Xc@K 㿠@ @  @L Z@  ;Xc@3 㿠@ @ @4  @/  ;Xc@ 㿠@Ғ @ @  @ 挒 ;Y`@ 㿠@ @ @  @ 斒 ;Y`8@ 㿠@ @  @ @ ;Y`X@ʐ 㿠  @ @@} @ @Ĕ  @ @ ;Y`t@ 㿠@_ @  @  ;Y`@ 㿠+;Y9Y`;Y7i` Ȗ|g5Y3Y/iД`ؖ_-Y+Y)j` 0W'Y%Y#j`O!YYj!aGYYj!!t?Y Y j$a,!7YYja4<h/ 㿠;YaL㿠k˒?X?̐eYaTYahYa|㿠@,9Y!9Y@͒!C4?@U@_@ԓ?ח0㿠;Ya;Y$ՠԁӒ?a ?@+?㿠;Ya;YՄeַ?a?@?㿠;Yaզ e֛??㿠@2F@@24;Ya@㿠;YbȐՁ վ?c?@7ԭ?@2;Yo 9Yd?b 祖%ո?"0K՚?+?@ Q  @1ӏ?ӌ??Ӊ㿠;Yb8~ޒ?Ռ?ӥ?x㿠;YbHm0?x?ӑ?d㿠YJ?X?㿠;Y9YbX;Y4ؐbh7Y.Ґ"x5Y(@ 3YԴ/Y@ -YԪ+Y@ )YԠb'Y @ %YԖ#Y@ !YԌ@ Ԅb"@#$c8@#HYX@YchY#|@ YYc@YczY#@ Ycq !@@=Yh@@4@㿠Ҵr @Ӻ J `.H  q?ҥ? 㿠-;Z9Z`;Z87l`5Z7/Z-l<? $bޒ?̐1  Ŕ ,QВ4?c?Ҕ?f??̐  秔 Y㿠ǒ @_Z`TҫZҺ? @P@/Z<Iҩ? H/ ҍ ҉v9Z Lː2Ғ? @x'?҇? H  k gTӪn O`\㿠a @7;Z`\;Z`dӋR? @8?G? H,)   hϒѲ, Oђ 㿠  X  㿠    @    a? 㿠  ? @  Ӗ?? H  p    㿠   @;Z`l t?Ԓ? @ ш Z? 梔     ] @%’ Ѹ? @ΐ;Z`|7ї є??1?ы ш ? 㿠 a I 㿠;Z @ `Ҳ d a  L  㿠ސߒ?@U 㿠p     㿠;Z` F? @, ے?;? @   ( 㿠;Z`]Ē $? @  ҹ?? @       \  㿠;Z`1Ҙ  є  㿠;Z`#Ҋ ? @;Z`澐 ʒ  嵔  㿠;Z`V й P? 㿠;Z`F Щ Ц ? 㿠;nc;Z `9Zא!@ 7n5Z 3Zɐa(@ /n\-ZՔ 4+ZaH@ )n"'Zǔ P%Zd@ y#mc!Zѹ !p;ZZ9n@ imc$7Zѩ Z5Z!3nZ/Z@ Wm-Zї Z+na)Z{Z!'Z@ E n`%nх Z#Z!!ZiZ@ 4nu Za[a@ '!i P@ a^ E(@ aS ",:@@ H bD/"X@ n@< Zb\"Z"p@ n0. ZtZ"@ ߐo`<  Zb Z"@ ѐo| ZZb@ Á @   @  + ` 㿘 *@U? @  ?'@& 㿠 .` @  # `? $ `#&@/)c@'Z`Ē; c ?.@$  *`#` 2!@@?㿠   @  ?& @E & 㿠V .p0;0 @6 U`$.? @ .=@7Z  V 5`$   @㿠 @ """@ .  @@% &6O 7 #\ 1Z# $.$'@㿠;c@@  @͐ @ @ @  @㿠72  ?`7`6  3p?2? @㿠@5? ?.`` /` $v㿠``@ `@`"@ ` @`H @a  `@[   @Q   &`?&`&` 㿠Ԓ`@`@ ``@ `"H  `"H `  @'` @"   @PLT\dlt||q"  @+ @ @  !  % $ # " ' & 㿠@*? ʒ.` ?@@@ `(@`) &$  @ @'$ Oݐ  @  @!   ƞ㿠@ /` @ ?2@  ?2O  㿠`@&`s?@  m?2O @㿠@2 `` $`/  ? @*$H"  `` `%/  ?` @ `*@ J@&@P?8`?'`  '@  )  &@  (㿠@$㿠 @u  * ? @$*@?`@``H#S )@0L (@)???"`X(`@ ``?2@@> Z. )@ ' (@?? *?%  +    ) (?&`&㿠 @ }  @N  -` ?` @ `*@ $`z&@| &&` @` @       /  6@㿠 ` @ "@ &&// 9ش" ``@6㿠  $ $@(# c Z#\c( `,`0  '`, $ $ @ `0`` ` $+` $`,$ " ` ``,. %@ $& $  @6 @2d(DhT0ltlt㿠g;s&`b8/@-.` c56"@P%.`5c6"@ D@E'@ .#.`+c5#6' ?@#H ?14 #&$*` .`/;5c6 @ ?@"94 #$ #@+ .`/;5c6 @ ?@" "H ? ? .`c65" ?@  ?ڪ`.`'56"@ ? @" 4  ! @݄ ?.3?`? ª@.`!Ғ .`  ͒"@ ?.`!@ƒ "@?.`.' @ ??@.`"4 @)`@ ??@ .`"4 9?  ?@ +  ? @.`"4 `)`w D@ .`5#6$  $@  h? ?`@ `H.``"@&4 .`.`!&#5#6  $@ Qc)'#56%@`&@[#@9D#/;5c6'O$`@ .`'56% C$@  ?%& ? ? @ H.` "@l '.`.`#5c6$ @  @ )'#56%@4  @#@7y  (`' &  #5#6"@ @-d4O @  "@ H .@ H .  @#c )`@.@  7+Z#\c<    5  %   ,#@ & &`& '??㿠V &`@;  @6 &@   @     `@" `@&O   @     `@&O  4`@  8  `@ % 4&O 8㿠  @ @N   O㿠 T@  P `@ @9 T`@&O P㿠`@ W` 2@ ` '`& 㿠 L  @  H `@@ L $O H``O퀥``@ `@`@ `"H`@`"H `` @  `` @ "`" 㿘 D'''`v @`'W``G `W` G @! '  G   @`@@  G̶  `@ `@ `"@  @ `"H  ` `1 0? @ 2 2p? 㿠 T`@'` P  ?@`2@ ϐ"H%` $O P㿠 `@ R`&`"@`(2`&`( ' . `2OR`&㿠 $`@ $`@ "@`"`` ' = `2O`㿠 (`@ (`@ "@`"`` ' W `2O```8 ` ;  @ @09 @㿠 ,`@K@"  4 `@` & 0 `$ & 0``" & `̅ `2O`  ,``@&O 4 ,Ɂ 4 `@`@6@` "`` ` & 0 `&& 0`%@& `[ `2O` ,` @&O 4 , 8@S @'  @ @`@@`` *!  H@`;\`l"H#/\C@+`u"H#3\='[@-[)[#+[c$` 9\7\ rn `(l!?s?N`O`n @~ @ @;\`0 p @ @ E?  @Z @ ݐ@;\`Dؒ  I @ z  㿠Ւ ( e?ݒ? @ Ò  ĥ ?_]??Z㿠`;cہ㿠`;ƐcӁ㿠F   @   @;\`X Ì ߔ ???{?x ˁ㿠;c;~`p9Ȗ"l 㿠;c;~`9" `p 㿠; ``@`"  $O 8@@ ;\@LaD @P (`;\ P a` 㿐@O`@ `!@ *** `  @㿘;\@ a;\a㿠  &@ '   %  &   ŀ&  /\5Ḵ`& 㿠&` !&` &`&`&` &`$&`(%@ &` #   #`  #@&```$  @ $`` %   ` ŀ @&`?2O`㿠    @7 ᙖ`   @`  ,` #``@ # ` %` &   & `Gဢ _O`  . 㿠  ` @ `@    .*`  a @%. ` @`ϐ  ,` #``@ # ` %` &   @&  2O .@_e (` &@ %  ! .  @.@ &  +@` "@ " $ &   &  +\a-`ٔ! `@%e ` @`p  (` `%@ ` ` !` &   €& 2O e@E2@Z  ,` `#  @ #`  %  +  ŀ+@& -2H -`  '``@ '  ` `&   & `"@%  ` @ @`  +`  "@ #  $ &   @& 2O  .@ @9\"!J㿠  ` @ [ `.  `. $@ $ ` `&   @&   `@ [@ @ "@``@]"H>```\b*! `,  "@ #  `$ ` [   [G& `(@ '  @ &  &    @&  + "``@ " `# ` ]  @ ]G& @%`. $@ $  & &    &  `- $  @ $ `% `&   ƀ& `/`@&`([ * `!  @ !`  #  & K   & D 㿠#\ ` @  ,   $@ $  &   @& !       ` @ @`א @ @\"@ `5\0*`"! k ``@ "  #  &   & `8@!`4@`2@ ` @#`0`(@ #`2 (@ `6@#`4(@ #`6(@ڮ  `n@`b@ #`8 @π`a"H@.`f"HE`t@ `n@U`r"Hl@`v"H*@`  @ !  "&   @& +` #``@ %  & 쀦  @& 䀦*` "``@ & ``#``& Ԁ  & ̀)` #@  ``"` `&   €& (@` `"@ #` # &   & .` `!  @ !` " &   & (`  ``@ %  ! & r  @& j.`K b  - @#`0+"@ "    @@& @`O- @ \D*`!+` 0+` #``@ % ` `&    & *` `!``@ "` ` #` &   & O|` `/ `$@ $` `'`&   @& (@\'`         ,  ,                  ,            H                            t                                 㿠 `p'@-  $@ %  & & '  & '# ';\b` $ ٮ'  ``@  ` !` &   €& -2@v -  "@ #   $  `   Ā` G& G'   $@ %  &  [   [@&  [!V `'  @ '`   =  @ =@&  = `&``@ "`  #  &   & ! `$  @ $`  %   =  ŀ =@&  < &@ & ` '` &   & !  @ !  ``"`` =   =@&  > `#  @ #` ` $` &   & ! `%  @ %` & =   =@&  ~ `'``@ `  ! &   @& !! "``@ " ` #`  .   .@,&  $``@ $ ` %` &   ƀ& .2@_! &@ % `` ``&   & !a  @ . P! I!!!@ @!!@` @ $``@ $ ` %` &   @& @I   @ &`!㿠 I & 4 D  ` & @& ,`& 8& `& <& 0"  4&㿠 , 8 ` 4/`&& ` )  @&2``@ @ ) J 1 "@  @ @ O) 㿠. @&  @ ' %`@O%@@%`@$O%`` @6 ,@@  @"@ ` (@% @2O ``&O@ @ "@  4  +`% "2O ``&O@ ` `&* & `&`&``*@" `"`` "`@ c @(㿠q , 4'` ,@@ @72H  2O w " " " " " @- , `& `㿠`\ " `" " " @`& 8 ` 8& `&`6 㿠 86` @'`.``@ 2@``@!` `2O`  ˁ2@` `@` `2O`  @'`㿠@7t㿠 `@ &  K` @"H` 㿠;\bہ㿠`'  @&``&``@?@㿠ҫ@ف㿠@@ %'`ђ/`'`' O܁㿠@@&&@ .`&`&O%`OV㿘 㿘 㿘 㿠@ '  㿠Ȕ* M &` `/``"@ ?)\"!v㿠* &`4'/ ' `@&`8'`  ``8%`8%``8@ $O㿠w&`0*  &`, G㿠e* &`  `@&`'`  `r`@$OJ* &`Β &` 8* &` @&`$  `@ `@'O㿠ط5'`@'`< 7` 7`"7`$V$㿠;\Ob̀@b̐@ M@vM"OM @ ];\b@㿠`@ K\b-㿠ǒK @@7?`#\ \@#,8`(`'@ `@@#?` \#\ @ *`'@ :`cl @~@7\7 㬚 3p? 5\ /\Ȓ -\ܒ +\c )\# '] e @ ِ;]`ͺ 㿠㿠`&@&```&` ` ` @ ``%  @&``&``ƀ?H ;]`L͂ #\K\`㿠S@h@@C㿠F@[@@K㿠9@N@@~㿠,@A@@q㿠@3&H㿠@'@ @ 2 3p?㿠yl? @??㿠aܒT? @ޒ?ג?㿠IĒ<? @??㿠1$? @??㿠 ? @?㿠? @n?2  3p?z? @ў  @ƞ  @ @㿠Ē㿠’݁㿠Ēԁ㿠Ɣʁ㿠n㿠ƒ``@ `" " `" `" @``@ ``S 2 2p?   d#`d h#`h "#@9` @ 9 `@+`@ `@"` `+` ``@F`N` @?$n@ S@f"H$ lH @uH &  E ؐ& p&    @ǒ   & L OȀn '`G& @D\n@ S@f"H* lH @uH  &`&!`4&`@'@& h`Ē  @~  & `N`O€n  @""`*@"@ "!`!`2O" 8TD\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\㻸V " V `@`@k+ , )c5c6p#  `? `/@N-5`R5`N5` @ 5`B5`;5`"75` !"25` " -5`$ "+  #@%5`$ a"-``%5`!6@"4H"*$ !@ (`#@  " NO, ..`㿠 2@  &@ :  :`o ?`@ ` @` "H `"@`@2 2 #] &`Ա2  /]d&ܹ2 `?@&5] 㿠ؒ 2@`  J?2@ *  `?%@5` @  㿘`9!`/`@ -]Ȍ/]Ȅ `@ @ `ٞ+`*a`@JJ@]a<e]a``㿐 `% -L@-`0@]@a@ @&` `.`@ / `` @!u@/  /`$7.#@7"7/@"@;]a|P9]!@d@v@0!]@q!ܐ@+7Ȁ @%. @@#]a%]'])]"+]b -]/]1]"3]b㿠 ` @ &  &  @ 㿠.`㿠6`*00`30+`/p0300 6`㿠ؐ&`Ր`* &`ϐ`* &`ɐ`* &`P %] $.@-@ ( $@@ ĪŨƢǤ͐Đ @ B @Ȁ`("H](#63` @#  r nkhː&O'`8`@  (8``@8`(`2O(̪T@U@ @f̬ Д #\ #`#d#h@w2@ ɐ@h  @~']̠H  @r ##` @t&`$` `@儒ր @-   @g&`$ ` @]bhq @]& $  `@]b` TL@. @ /`L@$  @?` `L@9`  ??`L`@-'@+@ ] )̀ *OТ`@ *O@ @4 @/ @* 㿘#\@'c܀ @' \ `\`H`?? 2 2?  @&2 $` `$  $O\@V' \H@@??  2?` 2  2 @  \$  ``@@\`H??2?2  2    %\Y@\@X_@X@& %@$  @@%@ ` Oπ`\`H @ @{< @ ; #`?' ^?2 ?2$   2#d ` \`d@  @'`%\\\@&`$ @ @%%"`\`H `@?@ 2 ?  P2  ?Q@@ 2&@ S@ $  %$O\@@\\H@??2?2   2  @`\\\@ & @ $ % @$O`㿠@1&\-7 `` = s@``q@  ``s`*@ ` `(@  L*  `@$O`㺰#l#|dh\`#t#d#h#p#@  d@d"`#x@&`@g |#\'`xp t`#`dxd`hl#\#`$O#\@pt$ #\#`pd @4 ]#`%#d###&``########@Od@> @``@``` %O$@@```@` `%$``$O@@ pt#\#`d @apt#\#`dXd`@SȘ &@ `x $@#   ``TS@   ?TU@%S@R  O"4@" U@   U ` VU@% ` S@V "``$O |xhdl#`#\ #@   "##`#5@O<`pt#\#`d@C=.H' 4dY@]##%# ##@ d% #@@ % x#@ @`   ``V"`R"?SO!?4@``T```RS@""  !  $O``@@N##\pt#`d  x@  ` R @ P"? S@! O!?4@`P V@ "  S`  !``@ !  $O`@$O#\ @ pt#\#`d  x`@  Q@? ?R@ S@%O$@V  R@   R@ %@ $$Ox|#`#\dhl#5 $O @ @` $@@! #\pt`#`Zd@$O#\@ pt#\#`Kdx|#`#\ dhlK $O㿐` _< (`(` (.H) _@;`@@`,% ]Z :   @ ȑ9` #d#\#` #h`$@  `0 %䀈`@%3`@ %%5`%`"O`4%%@ %1 @ %`%0%"O`8%% @ %2`@ %`%2%"O쀤`@-@+   @  6H #ll`@ #\ #`#d@#h@@&O#\@&Olx'D-'H 'L'P,`'T ,M'X#l`(@TL@@XP"@ l` @LlPTX:lTL^? .H XP\=#t@,+ Y@[ : @ :`l t`$ #\#d#`#h@  LT#p@LTXXTLP@@PX XP @Nw`@K 3`@; @t  6H w @'`2`@ 9`l`H pLp $<@``$ @t&O`'`@ <@ ' @@&Owp㿠 㿠 0123456789ABCDEF ccccc2  }zxvtrpnljhgfedcba`_^]\[ZYXWVUTSRQPPP    |}~~~}~~}~  #(-27?DECt&?g*:JYft %+17=9INSY^chmrv{ !#%(*,/1358:<>@BDFHJLNPRTVXZ\^`bdegikmnprtuwyz|~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ?/|\"!$()_-=[]{},~0 3 2 1  76 2d,      ?dwsorgbuDWvyRGBU o o(o0$o8%&#oH" !(oX-o`FohKopPoxBoAo7oZo[ooo'Moppppp$p%&#p"p q!qq'q$(q4-q<yzz zz z(z0"z8!z@ zHzPzX#z`&zh%z|$z-z(z'zKzFzAz7zBz[zZzzzzP{M{{{{,abcdefghijklmnopqrstABCDEFGHIJKLMNOPQRST0123456789:;<=>?@%&*NCurses, for terminal console, subopts -b(ig screen)Basic X11, subopts -d -n -s(moothRescale) -b(Bigtile) -o(original) -a(AdamBolt) -g(David Gervais)X11 Athena Widget, subopts -d -n -s(moothRescale) -b(Bigtile) -o(original) -a(AdamBolt) -g(David Gervais) and standard X11 toolkit optionsla0koy k  X11 Projected View, subopts -d -n -s(moothRescale)  t     (  H | $Lua: Lua 4.0 Copyright (C) 1994-2000 TeCGraf, PUC-Rio $ $Authors: W. Celes, R. Ierusalimschy & L. H. de Figueiredo $W| W PW W W W 4W W W %W W ZZZZZZ]]]]]]_@ zP_L u_T r_d s_ m_ n _ v_ t_ rX_ vl_ u_ q@_ zP_ y` t` q` t`( r`0 r8`8 u`@ o`H r`P s`X r`d s`p ql`| q` s\` q` p` x`` t` {` {h` H` {` |  !"#$%dddddddk|kkkkkkkkkkkkkkkkkpl px p tp p |pppppppppppppppqqqqqq q$q(q,q0q4q8q<%s: %s core() failedOut of Memory!%dCopyright (c) 1997 Ben Harrison, James E. Wilson, Robert A. Keoneke This software may be copied and distributed for educational, research, and not for profit purposes provided that this copyright and statement are included in all such copies. Other copyrights may also apply. hitmissfleedropkillleveldeathstudyteleportshootquaffzapwalktpotherhitwalleatstore1store2store3store4digopendoorshutdoortplevelbellnothing_to_openlockpick_failstairshitpoint_warnxxxoldFemaleQueenMaleKingDarkWhiteSlateOrangeRedGreenBlueUmberLight DarkLight SlateVioletYellowLight RedLight GreenLight BlueLight UmberSTR: INT: WIS: DEX: CON: CHR: Str: Int: Wis: Dex: Con: Chr: strengthintelligencewisdomdexterityconstitutioncharismaDisplay inven/equipDisplay equip/invenDisplay player (basic)Display player (extra)Display messagesDisplay overhead viewDisplay monster recallDisplay object recallDisplay snap-shotDisplay script variablesDisplay script sourceDisplay borg messagesDisplay borg statusrogue_like_commandsquick_messagesfloor_query_flagcarry_query_flaguse_old_targetalways_pickupalways_repeatdepth_in_feetstack_force_notesstack_force_costsshow_labelsshow_weightsshow_choicesshow_detailsring_bellshow_flavorsrun_ignore_stairsrun_ignore_doorsrun_cut_cornersrun_use_cornersdisturb_movedisturb_neardisturb_paneldisturb_statedisturb_minorverify_destroyverify_specialallow_quantityauto_haggleauto_scumexpand_lookexpand_listview_perma_gridsview_torch_gridsdungeon_aligndungeon_stairflow_by_soundflow_by_smellsmart_learnsmart_cheatview_reduce_litehidden_playeravoid_abortavoid_otherflush_failureflush_disturbfresh_beforefresh_aftercompress_savefilehilite_playerview_yellow_liteview_bright_liteview_granite_liteview_special_liteeasy_openeasy_altereasy_floorshow_pilescenter_playerrun_avoid_centerscroll_targetauto_moresmart_monsterssmart_packsbirth_point_basedbirth_auto_rollerbirth_maximizebirth_preservebirth_ironmanbirth_no_storesbirth_no_artifactsbirth_rand_artifactsbirth_no_stackingcheat_peekcheat_hearcheat_roomcheat_xtracheat_knowcheat_liveadult_point_basedadult_auto_rolleradult_maximizeadult_preserveadult_ironmanadult_no_storesadult_no_artifactsadult_rand_artifactsadult_no_stackingscore_peekscore_hearscore_roomscore_xtrascore_knowscore_liveRogue-like commandsActivate quick messagesPrompt for floor item selectionPrompt before picking things upUse old target by defaultPick things up by defaultRepeat obvious commandsShow dungeon level in feetMerge inscriptions when stackingMerge discounts when stackingShow labels in equipment listingsShow weights in all object listingsShow choices in inven/equip windowsShow details in monster descriptionsAudible bell (on errors, etc)Show flavors in object descriptionsWhen running, ignore stairsWhen running, ignore doorsWhen running, cut cornersWhen running, use cornersDisturb whenever any monster movesDisturb whenever viewable monster movesDisturb whenever map panel changesDisturb whenever player state changesDisturb whenever boring things happenVerify destruction of objectsVerify use of special commandsAllow quantity specificationAuto-haggle in storesAuto-scum for good levelsExpand the power of the look commandExpand the power of the list commandsMap remembers all perma-lit gridsMap remembers all torch-lit gridsGenerate dungeons with aligned roomsGenerate dungeons with connected stairsMonsters chase current location (v.slow)Monsters chase recent locations (v.slow)Monsters learn from their mistakesMonsters exploit players weaknessesReduce lite-radius when runningHide player symbol when runningAvoid checking for user abortAvoid processing special colorsFlush input on various failuresFlush input whenever disturbedFlush output before every commandFlush output after various thingsCompress messages in savefilesHilite the player with the cursorUse special colors for torch liteUse special colors for field of viewUse special colors for wall gridsUse special colors for floor gridsOpen/Disarm/Close without directionOpen/Disarm doors/traps on movementDisplay floor stacks in a listShow stacks using special attr/charCenter map continuously (very slow)Avoid centering while runningScroll map while targettingAutomatically clear '-more-' promptsMonsters behave more intelligentlyMonsters act smarter in groups (v.slow)Birth: Allow purchase of stats using pointsBirth: Allow specification of minimal statsBirth: Maximize effect of race/class bonusesBirth: Preserve artifacts when leaving levelBirth: Restrict the use of stairs/recallBirth: Restrict the use of stores/homeBirth: Restrict creation of artifactsBirth: Randomize some of the artifacts (beta)Birth: Don't stack objects on the floorCheat: Peek into object creationCheat: Peek into monster creationCheat: Peek into dungeon creationCheat: Peek into something elseCheat: Know complete monster infoCheat: Allow player to avoid deathAdult: Allow purchase of stats using pointsAdult: Allow specification of minimal statsAdult: Maximize effect of race/class bonusesAdult: Preserve artifacts when leaving levelAdult: Restrict the use of stairs/recallAdult: Restrict the use of stores/homeAdult: Restrict creation of artifactsAdult: Randomize some of the artifacts (beta)Adult: Don't stack objects on the floorScore: Peek into object creationScore: Peek into monster creationScore: Peek into dungeon creationScore: Peek into something elseScore: Know complete monster infoScore: Allow player to avoid deathterribleworthlesscursedbrokenaveragegoodexcellentspecialuncursedindestructiblePLAYER/%s//%s%s%s%s%s/tmp/anXXXXXXw%s Too many macros!%s <%dx>-more-Illegal response to a 'more' prompt!Illegal edit key!Quantity (0-%d): %d%.70s[y/n] YyNnIllegal response to a 'yes/no' question![Press any key to continue]Count: Count: %dInvalid repeat count!Count: %dCount: %dCount: %dCommand: Command: Control: %sTBDoc+Are you sure? darkwhiteslateorangeredgreenblueumbervioletyellowlightdarklightwhitelightredlightgreenlightbluelightumberDarkWhiteSlateOrangeRedGreenBlueUmberL.DarkL.SlateVioletYellowL.RedL.GreenL.BlueL.UmberIckyoldHit any key to continuePlease wait...Too many slopes (%d)!Too many grids (%d >= %d)!Too few grids (%d < %d)!Too few slopes (%d < %d)!Incorrect bit masks!aabagaksalaanankhappargarzeashausbanbarbatbekbiebinbitbjorblubotbubytcompconcoscredalfdandenderdoedokeepelengerereerkeshevsfafidflitforfrifugangarglengopgrehahehydiingionipishititeivjokhokliklislalechmanmarmemimicmikmonmungmurnagnejnelgnepnernesnisnihninoodoodorgornoxoxypaypetpleplupopotprokrerearhovrirorogrokrolsasansatseesefsehshuskisnasnesniksnososolsristasuntatabtemthertitoxtroltuetursuulkumununiurvalvivvlyvomwahwedwergwexwhonwunxyergypzuntriblaaNot enough flavors for tval %d. graf.prffont.prf& Book~ of Magic Spells #& Holy Book~ of Prayers #(nothing)no more The an a no more The of (empty) (disarmed) (unlocked) (Locked) (Poison Needle) (Poison Needle) (Gas Trap) (Gas Trap) (Explosion Device) (Summoning Runes) (Multiple Traps) charge (charging) (with turns of light) to stealth to searching to infravision to speed attacks (charging)cursedemptytried% off WieldingShootingOn left handOn right handAround neckLight sourceOn bodyAbout bodyOn armOn headOn handsOn feetIn packJust liftingJust holdingattacking monsters withshooting missiles withwearing on your left handwearing on your right handwearing around your neckusing to light the waywearing on your bodywearing on your backwearing on your armwearing on your headwearing on your handswearing on your feetcarrying in your packjust liftingjust holding%3d.%1d lb<--%3d.%1d lb%c)%3d.%1d lb%c)%-14s: %3d.%d lb%c)%3d.%1d lb%s %s? Really tryInven: %c-%c, * to see, / for Equip, - for floor,Equip: %c-%c, * to see, / for Inven, - for floor,Floor: %c-%c, * to see, / for Inven, / for Equip, ESC(%s) %sCannot switch item selector!Cannot select floor!TryIllegal object choice (tag)!Illegal object choice (tag)!Illegal object choice (tag)!Illegal object choice (default)!Illegal object choice (default)!Illegal object choice (default)!Illegal object choice (default)!Illegal object choice (inven)!Illegal object choice (equip)!Illegal object choice (floor)!Illegal object choice (normal)!TryCompacting objects...Too many objects!No object (%d,%d)Artifact (%s)Ego-item (%s)Object (%s)The %s disappear%s.Breakage (breakage).The %s disappear%s.Breakage (no floor space).The %s disappear%s.Breakage (too many objects).You feel something roll beneath your feet.You have %d charge%s remaining.You no longer have the %s (%c).You have %s (%c).There are %d charge%s remaining.You see %s.You were wieldingYou were holdingYou were holdingYou were wearing%s %s (%c).You drop %s (%c).You combine some items in your pack.You reorder some items in your pack.ithesheitshisher shriek for helpdo somethingdo somethingdo somethingfire an arrowfire arrowsfire a missilefire missilesthrow boulders%^s may , or . acidlightningfirefrostpoisonnetherlightdarknessconfusionsoundchaosdisenchantmentnexustimeinertiagravityshardsplasmaforcemanasomethingsomethingsomething%^s may breathe , or produce acid ballsproduce lightning ballsproduce fire ballsproduce frost ballsproduce poison ballsproduce nether ballsproduce water ballsinvoke mana stormsinvoke darkness stormsdrain manacause mind blastingcause brain smashingcause light woundscause serious woundscause critical woundscause mortal woundsproduce acid boltsproduce lightning boltsproduce fire boltsproduce frost boltsproduce poison boltsproduce nether boltsproduce water boltsproduce mana boltsproduce plasma boltsproduce ice boltsproduce magic missilesterrifyblindconfuseslowparalyzehaste-selfdo somethingheal-selfdo somethingblink-selfteleport-selfdo somethingdo somethingteleport toteleport awayteleport leveldo somethingcreate darknesscreate trapscause amnesiado somethingsummon similar monsterssummon a monstersummon monsterssummon animalssummon spiderssummon houndssummon hydrassummon an angelsummon a demonsummon an undeadsummon a dragonsummon Greater Undeadsummon Ancient Dragonssummon Greater Demonssummon Ring Wraithssummon Unique Monsters, and is also%^s is magical, casting spells intelligently which , or ; 1 time in %d; about 1 time in %d. %^s may carry a one or two up to %d exceptional goodn objects orn treasures. hittouchpunchkickclawbitestingbuttcrushengulfcrawl on youdrool on youspitgazewailrelease sporesbeginsultmoanattackpoisondisenchantdrain chargessteal goldsteal itemseat your foodabsorb lightshoot acidelectrifyburnfreezeblindconfuseterrifyparalyzereduce strengthreduce intelligencereduce wisdomreduce dexterityreduce constitutionreduce charismareduce all statsshatterlower experiencelower experiencelower experiencelower experiencecause hallucinations%^s can , , and do something weird to with damage %dd%d. %^s has no physical attacks. Nothing is known about %s attack. open doorsbash down doorspass through wallsbore through wallspush past weaker monstersdestroy weaker monsterspick up objectsdestroy objects%^s can , and . %^s is invisible. %^s is cold blooded. %^s is not detected by telepathy. %^s is rarely detected by telepathy. %^s breeds explosively. %^s regenerates quickly. rock removerbright lightfirecold%^s is hurt by , and . acidlightningfirecoldpoison%^s resists , and . netherwaterplasmanexusdisenchantment%^s resists , and . stunnedfrightenedconfusedslept%^s cannot be , or . prefers to ignorepays very little attention topays little attention totends to overlooktakes quite a while to seetakes a while to seeis fairly observant ofis observant ofis very observant ofis vigilant foris ever vigilant for%^s %s intruders, which %s may notice from %d feet. %^s usually appears with escorts. %^s usually appears in groups. %^s has slain %d of your ancestors, but you have taken revenge! , who %s unavenged. You have slain this foe. %d of your ancestors %s been killed by this creature, and you have exterminated at least %d of the creatures. and %s have exterminated at least %d of the creatures. and %s is not ever known to have been defeated. You have killed at least %d of these creatures. Your ancestors have killed at least %d of these creatures. No battles to the death are recalled. %^s has an armor rating of %d and a life rating of %d. and a life rating of %dd%d. KillingA kill of this creature is worth %ld.%02ld point%sthstndrdn for a%s %lu%s level character. This natural evil undead dragon demon giant troll orc creature lives in the town is found is normally found at depths of %d feeton dungeon level %d, and moves extremely somewhat a bit erratically, and incredibly very quickly incredibly very slowly at normal speed, but does not deign to chase intruders. You feel an intense desire to kill this monster... The ('')/(''):Compacting monsters...Too many monsters!ititititsitselfsomethingsomethingsomething'sitselfhehimhishimselfsomeonesomeonesomeone'shimselfsheherherherselfsomeonesomeonesomeone'sherselfherselfhimselfitselfthe 's (offscreen)Deep Unique (%s).Deep Monster (%s).Unique (%s).Warning! Could not allocate a new monster.%^s is unharmed.jmvQ%^s barely notices.%^s flinches.%^s squelches.%^s quivers in pain.%^s writhes about.%^s writhes in agony.%^s jerks limply.CZ%^s shrugs off the attack.%^s snarls with pain.%^s yelps in pain.%^s howls in pain.%^s howls in agony.%^s writhes in agony.%^s yelps feebly.FIKMRSXabclqrst%^s ignores the attack.%^s grunts with pain.%^s squeals in pain.%^s shrieks in pain.%^s shrieks in agony.%^s writhes in agony.%^s cries out feebly.%^s shrugs off the attack.%^s grunts with pain.%^s cries out in pain.%^s screams in pain.%^s screams in agony.%^s writhes in agony.%^s cries out feebly.18/%03d 18/%02d %2d ![=-WIZARD-=]***WINNER***%6dLEVEL Level %8ldEXP Exp AU %9ldCur AC %5dMax HP %5dCur HP %5dMax SP %5dCur SP %5dTown%d ftLev %d%7sWeak Weak Hungry Full GorgedBlind Confused Afraid Poisoned Paralyzed!Rest Rep. %3d00Repeat %3dSearching Fast (+%d)Slow (-%d)%-14sStudy Mortal woundDeep gash Severe cut Nasty cut Bad cut Light cut Graze Knocked out Heavy stun Stun [----------][----------][----------][----------]**********You have forgotten the %s of %s.You have forgotten the %s of %s.You have remembered the %s of %s.You can learn %d more %s%s.Your covered hands feel unsuitable for spellcasting.Your hands feel more suitable for spellcasting.The weight of your armor encumbers your movement.You feel able to move more freely.You have trouble wielding such a heavy bow.You have no trouble wielding your bow.You feel relieved to put down your heavy bow.You have trouble wielding such a heavy weapon.You have no trouble wielding your weapon.You feel relieved to put down your heavy weapon.You do not feel comfortable with your weapon.You feel comfortable with your weapon.You feel more comfortable after removing your weapon.You are blind!You can see again.You are confused!You feel less confused now.You are poisoned!You are no longer poisoned.You are terrified!You feel bolder now.You are paralyzed!You can move again.You feel drugged!You can see clearly again.You feel yourself moving faster!You feel yourself slow down.You feel yourself moving slower!You feel yourself speed up.A mystic shield forms around your body!Your mystic shield crumbles away.You feel righteous!The prayer has expired.You feel like a hero!The heroism wears off.You feel like a killing machine!You feel less Berserk.You feel safe from evil!You no longer feel safe from evil.You feel invulnerable!You feel vulnerable once more.Your eyes feel very sensitive!Your eyes feel less sensitive.Your eyes begin to tingle!Your eyes stop tingling.You feel resistant to acid!You feel less resistant to acid.You feel resistant to electricity!You feel less resistant to electricity.You feel resistant to fire!You feel less resistant to fire.You feel resistant to cold!You feel less resistant to cold.You feel resistant to poison!You feel less resistant to poison.You have been stunned.You have been heavily stunned.You have been knocked out.You are no longer stunned.You have been given a graze.You have been given a light cut.You have been given a bad cut.You have been given a nasty cut.You have been given a severe cut.You have been given a deep gash.You have been given a mortal wound.You are no longer bleeding.You are still weak.You are still hungry.You are no longer hungry.You are full!You have gorged yourself!You are getting faint from hunger!You are getting weak from hunger!You are getting hungry.You are no longer full.You are no longer gorged.Welcome to level %d. copper silver gold mithril adamantite Copper Silver Gold Mithril Adamantite A magical staircase appears...*** CONGRATULATIONS ***You have won the game!You may retire (commit suicide) when you are ready.%^s%sYou have killed %s.EvgYou have destroyed %s.You have slain %s.Egv, asleep, confused, afraid, stunnedYou see You are on something strange%s%s%s%s [%s] (%d:%d)%s%s%s%s [%s] [r,%s]%s%s%s%s (%s) [r,%s] (%d:%d)%s%s%s%s (%s) [r,%s]It is She is He is carrying %s%s%s%s [%s] (%d:%d)%s%s%s%s [%s]also carrying on %s%s%sa pile of %d objects [r,%s] (%d:%d)%s%s%sa pile of %d objects [r,%s]It is on %s%s%s%s [%s] (%d:%d)%s%s%s%s [%s]It is They are on unknown gridin the entrance to the %s%s%s%s [%s] (%d:%d)%s%s%s%s [%s]q,t,p,o,+,-,q,p,o,+,-,Illegal target!Illegal command for target mode!q,t,p,m,+,-,Illegal command for target mode!Direction ('*' to choose a target, Escape to cancel)? Direction ('5' for target, '*' to re-target, Escape to cancel)? Illegal aim direction!You are confused.Direction (Escape to cancel)? Illegal repeatable direction!You are confused.Nothing happens.You sink through the floor.You rise up through the ceiling.You rise up through the ceiling.You sink through the floor.You die.Low hitpoint warning!*** LOW HITPOINT WARNING! ***%sour %s (%c) %s destroyed!Your %s is unaffected!Your %s is damaged!Your %s (%c) resist%s disenchantment!Your %s (%c) %s disenchanted!You resist the effects!You resist the effects!Your body starts to scramble...There is a bright flash of light!Click!There is a bright flash of light!The wall turns into mud!The vein turns into mud!You have found something!The vein turns into mud!The rubble turns into mud!There was something buried in the rubble!The door turns into mud!Click!The %s %s unaffected!The %s%s dies.Evg is destroyed. resists a lot. resists a lot. resists a lot. resists a lot. resists a lot. is hit hard.Plasma resists. is immune. resists. resists somewhat.W is immune. resists. resists. resists. resists. resists somewhat.Disen resists.Nexus resists. resists. resists. resists. resists. resists a lot.Egv is unaffected! is unaffected! spawns! looks healthier. starts moving faster. is unaffected! starts moving slower. is unaffected! falls asleep! is unaffected! cringes from the light! shrivels away in the light! resists. cringes from the light! shrivels away in the light! resists. loses some skin! dissolves! is unaffected! is unaffected! is unaffected! shudders. dissolves! shudders. dissolves! shudders. dissolves! is unaffected! changes! disappears! is more dazed. is dazed. looks more confused. looks confused.%^s%s%^s%s%^s%s%^s flees in terror!You are hit by acid!You are hit by fire!You are hit by cold!You are hit by lightning!You are hit by poison!You are hit by something!You are hit by something!You are hit by something sharp!You are hit by something!You are hit by something strange!You keep hold of your life force!You feel your life slipping away!You feel your life draining away!You are hit by something!You are hit by something strange!You keep hold of your life force!You feel your life slipping away!You feel your life draining away!You are hit by something sharp!You are hit by something!You are hit by something!You are hit by something strange!You are hit by something strange!You are hit by something!You are hit by something strange!You are hit by something!You are hit by something!You are hit by something strange!You feel life has clocked back.strongbrightwiseagilehalebeautifulYou're not as %s as you used to be...You're not as powerful as you used to be...You are hit by something strange!Gravity warps around you.You are hit by something!You are hit by something!You are hit by something sharp!You feel a little better.You feel better.You feel much better.You feel very good.The object resists the spell.strongsmartwisedextroushealthycuteweakstupidnaiveclumsysicklyuglyYou feel very %s for a moment, but the feeling passes.You feel very %s.You feel less %s.You feel very %s!You feel less %s.You feel your life energies returning.You cannot see.You are confused.You are terrified.You are bleeding.You are stunned.You are poisoned.You are hallucinating.You aggravate monsters.Your position is very uncertain.You feel righteous.You feel heroic.You are in a battle rage.You are protected from evil.You are protected by a mystic shield.You are temporarily invulnerable.Your hands are glowing dull red.You are looking around very carefully.You can learn some spells/prayers.You will soon be recalled.Your eyes are sensitive to infrared light.Your appetite is small.You land gently.You are glowing with light.You regenerate quickly.You have ESP.You can see invisible creatures.You have free action.You have a firm hold on your life force.You are completely immune to acid.You resist acid exceptionally well.You are resistant to acid.You are completely immune to lightning.You resist lightning exceptionally well.You are resistant to lightning.You are completely immune to fire.You resist fire exceptionally well.You are resistant to fire.You are completely immune to cold.You resist cold exceptionally well.You are resistant to cold.You resist poison exceptionally well.You are resistant to poison.You are completely fearless.You are resistant to bright light.You are resistant to darkness.Your eyes are resistant to blindness.You are resistant to confusion.You are resistant to sonic attacks.You are resistant to blasts of shards.You are resistant to nexus attacks.You are resistant to nether forces.You are resistant to chaos.You are resistant to disenchantment.Your strength is sustained.Your intelligence is sustained.Your wisdom is sustained.Your constitution is sustained.Your dexterity is sustained.Your charisma is sustained.Your strength is affected by your equipment.Your intelligence is affected by your equipment.Your wisdom is affected by your equipment.Your dexterity is affected by your equipment.Your constitution is affected by your equipment.Your charisma is affected by your equipment.Your stealth is affected by your equipment.Your searching ability is affected by your equipment.Your infravision is affected by your equipment.Your digging ability is affected by your equipment.Your speed is affected by your equipment.Your attack speed is affected by your equipment.Your shooting speed is affected by your equipment.Your shooting might is affected by your equipment.Your weapon melts your foes.Your weapon shocks your foes.Your weapon burns your foes.Your weapon freezes your foes.Your weapon poisons your foes.Your weapon strikes at animals with extra force.Your weapon strikes at evil with extra force.Your weapon strikes at undead with holy wrath.Your weapon strikes at demons with holy wrath.Your weapon is especially deadly against orcs.Your weapon is especially deadly against trolls.Your weapon is especially deadly against giants.Your weapon is especially deadly against dragons.Your weapon is a great bane of dragons.Your weapon is a great bane of demons.Your weapon is a great bane of undead.Your weapon has been blessed by the gods.Your weapon can induce earthquakes. Your Attributes:-- more -- Your Attributes:[Press any key to continue]Nothing happens.Reset recall depth? The air about you becomes charged...A tension leaves the air around you...You sense the presence of traps!You sense the presence of doors!You sense the presence of stairs!You sense the presence of buried treasure!You sense the presence of treasure!You sense the presence of objects!You sense the presence of magic objects!You sense the presence of monsters!You sense the presence of invisible creatures!You sense the presence of evil creatures!The object resists the spell.The curse is broken!The curse is broken!The curse is broken!Enchant which item? You have nothing to enchant.%s %s glow%s brightly!The enchantment failed.Identify which item? You have nothing to identify.%^s: %s (%c).In your pack: %s (%c).On the ground: %s.Identify which item? You have nothing to identify.%^s: %s (%c).In your pack: %s (%c).On the ground: %s.Recharge which item? You have nothing to recharge.The recharge backfires, draining the rod further!There is a bright flash of light.You feel a sudden stirring nearby!You hear a sudden stirring in the distance!Choose a monster race (by symbol) to banish: the strain of casting Banishmentthe strain of casting Mass BanishmentProbing...%^s has %d hit points.That's all.There is a searing blast of light!The cave ceiling collapses!The cave floor twists in an unnatural way!The cave quakes!You are pummeled with debris!You are severely crushed!You nimbly dodge the blast!You are bashed by rubble!You are crushed between the floor and ceiling!an earthquake%^s wails out in pain!%^s is embedded in the rock!%^s wakes up.You are surrounded by a white light.Darkness surrounds you.A %s tries to %s, but your %s resists the effects!A terrible black aura blasts your %s!A %s tries to %s, but your %s resists the effects!A terrible black aura blasts your %s!magicalfieryfrostysicklyA %s aura surrounds the %s.The Branding failed.Brand which kind of ammunition? You have nothing to brand.Brand which bolts? You have no bolts to brand.You are surrounded by a malignant aura.You are surrounded by a powerful aura.insults you!insults your mother!gives you the finger!humiliates you!defiles you!dances around you!makes obscene gestures!moons you!!!seems sad about something.asks if you have seen his dogs.tells you to get off his land.mumbles something about mushrooms.%^s is repelled.hits you.touches you.punches you.kicks you.claws you.bites you.stings you.XXX1's you.butts you.crushes you.engulfs you.XXX2's you.crawls on you.drools on you.spits on you.XXX3's on you.gazes at you.wails at you.releases spores at you.projects XXX4's at you.begs you for money.XXX5's you.%^s %sEnergy drains from your pack!You quickly protect your money pouch!Nothing was stolen.Your purse feels lighter.%ld coins were stolen!Your purse feels lighter.All of your coins were stolen!You grab hold of your backpack!%sour %s (%c) was stolen!%sour %s (%c) was eaten!Your light dims.You are covered in acid!You are struck by electricity!You are enveloped in flames!You are covered with frost!You stand your ground!You stand your ground!You are unaffected!You resist the effects!You keep hold of your life force!You feel your life slipping away!You feel your life draining away!You keep hold of your life force!You feel your life slipping away!You feel your life draining away!You keep hold of your life force!You feel your life slipping away!You feel your life draining away!You keep hold of your life force!You feel your life slipping away!You feel your life draining away!%^s misses you.There is a puff of smoke!%^s tries to cast a spell, but fails.%^s makes a high pitched shriek.%^s makes a strange noise.%^s fires an arrow.%^s makes a strange noise.%^s fires an arrow!%^s makes a strange noise.%^s fires a missile.%^s makes a strange noise.%^s fires a missile!%^s breathes.%^s breathes acid.%^s breathes.%^s breathes lightning.%^s breathes.%^s breathes fire.%^s breathes.%^s breathes frost.%^s breathes.%^s breathes gas.%^s breathes.%^s breathes nether.%^s breathes.%^s breathes light.%^s breathes.%^s breathes darkness.%^s breathes.%^s breathes confusion.%^s breathes.%^s breathes sound.%^s breathes.%^s breathes chaos.%^s breathes.%^s breathes disenchantment.%^s breathes.%^s breathes nexus.%^s breathes.%^s breathes time.%^s breathes.%^s breathes inertia.%^s breathes.%^s breathes gravity.%^s breathes.%^s breathes shards.%^s breathes.%^s breathes plasma.%^s breathes.%^s breathes force.You hear something grunt with exertion.%^s hurls a boulder at you!%^s mumbles.%^s casts an acid ball.%^s mumbles.%^s casts a lightning ball.%^s mumbles.%^s casts a fire ball.%^s mumbles.%^s casts a frost ball.%^s mumbles.%^s casts a stinking cloud.%^s mumbles.%^s casts a nether ball.%^s mumbles.%^s gestures fluidly.You are engulfed in a whirlpool.%^s mumbles powerfully.%^s invokes a mana storm.%^s mumbles powerfully.%^s invokes a darkness storm.%^s draws psychic energy from you!%^s appears healthier.You feel something focusing on your mind.%^s gazes deep into your eyes.You resist the effects!Your mind is blasted by psionic energy.You feel something focusing on your mind.%^s looks deep into your eyes.You resist the effects!Your mind is blasted by psionic energy.%^s mumbles.%^s points at you and curses.You resist the effects!%^s mumbles.%^s points at you and curses horribly.You resist the effects!%^s mumbles loudly.%^s points at you, incanting terribly!You resist the effects!%^s screams the word 'DIE!'%^s points at you, screaming the word DIE!You resist the effects!%^s mumbles.%^s casts a acid bolt.%^s mumbles.%^s casts a lightning bolt.%^s mumbles.%^s casts a fire bolt.%^s mumbles.%^s casts a frost bolt.%^s mumbles.%^s casts a nether bolt.%^s mumbles.%^s casts a water bolt.%^s mumbles.%^s casts a mana bolt.%^s mumbles.%^s casts a plasma bolt.%^s mumbles.%^s casts an ice bolt.%^s mumbles.%^s casts a magic missile.%^s mumbles, and you hear scary noises.%^s casts a fearful illusion.You refuse to be frightened.You refuse to be frightened.%^s mumbles.%^s casts a spell, burning your eyes!You are unaffected!You resist the effects!%^s mumbles, and you hear puzzling noises.%^s creates a mesmerising illusion.You disbelieve the feeble spell.You disbelieve the feeble spell.%^s drains power from your muscles!You are unaffected!You resist the effects!%^s mumbles.%^s stares deep into your eyes!You are unaffected!You resist the effects!%^s mumbles.%^s concentrates on %s body.%^s starts moving faster.%^s starts moving faster.%^s mumbles.%^s concentrates on %s wounds.%^s looks REALLY healthy!%^s sounds REALLY healthy!%^s looks healthier.%^s sounds healthier.%^s recovers %s courage.%^s blinks away.%^s teleports away.%^s commands you to return.%^s teleports you away.%^s mumbles strangely.%^s gestures at your feet.You are unaffected!You resist the effects!%^s mumbles.%^s gestures in shadow.%^s mumbles, and then cackles evilly.%^s casts a spell and cackles evilly.%^s tries to blank your mind.You resist the effects!Your memories fade away.%^s mumbles.%^s magically summons %s %s.You hear many things appear nearby.%^s mumbles.%^s magically summons greater demons!You hear many evil things appear nearby.%^s mumbles.%^s magically summons help!You hear something appear nearby.%^s mumbles.%^s magically summons monsters!You hear many things appear nearby.%^s mumbles.%^s magically summons animals.You hear many things appear nearby.%^s mumbles.%^s magically summons spiders.You hear many things appear nearby.%^s mumbles.%^s magically summons hounds.You hear many things appear nearby.%^s mumbles.%^s magically summons hydras.You hear many things appear nearby.%^s mumbles.%^s magically summons an angel!You hear something appear nearby.%^s mumbles.%^s magically summons a hellish adversary!You hear something appear nearby.%^s mumbles.%^s magically summons an undead adversary!You hear something appear nearby.%^s mumbles.%^s magically summons a dragon!You hear something appear nearby.%^s mumbles.%^s magically summons greater undead!You hear many creepy things appear nearby.%^s mumbles.%^s magically summons ancient dragons!You hear many powerful things appear nearby.%^s mumbles.%^s magically summons mighty undead opponents!You hear many creepy things appear nearby.%^s mumbles.%^s magically summons special opponents!You hear many powerful things appear nearby.%^s wakes up.%^s wakes up.%^s is no longer stunned.%^s is no longer confused.%^s recovers %s courage.You hear a door burst open!The rune of protection is broken!%^s tries to pick up %s, but fails.%^s picks up %s.%^s crushes %s.%^s turns to fight!Broken Ghostwb.new.oldsetegid(): cannot set permissions correctly!setegid(): cannot set permissions correctly!?o?o?IOR001AND100NOT100EQU10LEQ10GEQ10?x?x? []SYSGRAFRACECLASSPLAYERVERSION3.0.3r0Error %d in line %d of file '%s'.Parsing '%s'Very BadBadPoorFairGoodVery GoodExcellentSuperbHeroicLegendaryAge%4dHeight%4dWeight%4dStatus%4dMaximizePreserveLevel%10d%10dCur Exp%10ld%10ldMax Exp%10ldAdv Exp%10ld%10sGold%10ld%ld.%ld lbsBurden%10s[%d,%+d]Armor%13s(%+d,%+d)Fight%13s(%+d,%+d)Melee%13s(%+d,%+d)Shoot%13s%d/turnBlows%13s%d/turnShots%13s%d ftInfra%13sSaving Throw%9sStealth%9sFighting%9sShooting%9sDisarming%9sMagic Device%9sPerception%9sSearching%9s Acid: Elec: Fire: Cold: Pois: Fear: Lite: Dark:Blind:Confu:Sound:Shard:Nexus:Nethr:Chaos:Disen:S.Dig:Feath:PLite:Regen:Telep:Invis:FrAct:HLife:Stea.:Sear.:Infra:Tunn.:Speed:Blows:Shots:Might:abcdefghijkl@*+..*+abcdefghijkl@NameSexRaceClassTitle[=-WIZARD-=]***WINNER***HP%d/%dSP%d/%d Self RB CB EB Best!%+3d%+3d%+3dabcdefghijkl@abcdefghijkl@Level%dReplace existing file %s? w [%s %s Character Dump] %s [Last Messages] > %s [Character Equipment] %c) %s [Character Inventory] %c) %s [Home Inventory] %c) %s [Options] %-45s: %s (%s) rHelp file '%s'rInfo file '%s'rCannot open '%s'.***** r***** ***** Search string not found![%s %s, %s, Line %d/%d][Press a Number, or ESC to exit.][Press ESC to exit.][Press Space to advance, or ESC to exit.]Show: Find: Goto Line: 0Goto File: help.hlphelp.hlpIllegal control char (0x%02X) in player namePLAYER%d.%sEnter a name for your character: Do you want to retire? Do you really want to quit? Please verify QUITTING by typing the '@' sign: QuittingSaving game...(saved)Saving game... done.Saving game... failed!(alive and well)%*s%s%*sdead.txtrMagnificenttheLevel: %dExp: %ldAU: %ldKilled on Level %dby %s.%-.24sHit any key to see more information (ESC to abort): You are using: -more-You are carrying: -more-%c) Your home contains (page %d): -more-Examine which item? You have nothing to examine. %s Hall of Fame(from position %d)%.4s-%.2s-%.2s%3d.%9s %s the %s %s, Level %d (Max %d) Killed by %s on %s %d Killed by %s in the town (Max %d) (User %s, Date %s, Gold %s, Turn %s).[Press ESC to quit, any other key to continue.]scores.raw %s Hall of Fame[Press any key to quit.]Score not registered for wizards.Score not registered for borgs.Score not registered for cheaters.InterruptingScore not registered due to interruption.QuittingScore not registered due to quitting.%s%9lu%9lu%9lu@%Y%m%d%-.15s%7u%c%2d%2d%3d%3d%3d%3d%-.31sScore file unavailable.Score file unavailable.%s%9lu%9lu%9luTODAY%-.15s%7u%c%2d%2d%3d%3d%3d%3dnobody (yet!)Ripe Old Age#######,,, $$$ ,,,,,=$ "$$$$$" $=,,,$$ $$$ $$,*> <*> <*$$ $$$ $$"$$ $$$ $$""$$ $$$ $$"*#########*#########**#########*#########*Veni, Vidi, Vici!I came, I saw, I conquered!All Hail the Mighty %s![(i)nformation, (m)essages, (f)ile dump, (v)iew scores, e(x)amine item, ESC]death save failed!Do you want to quit? %s.txtFile name: Character dump failed!Character dump successful.scores.rawPress Return (or Escape).panic(panic save)panic save failed!panic save succeeded!AbortioninterruptInterruptinginterruptContemplating suicide!A gruesome software bug LEAPS out at you!Panic save...(panic save)Panic save succeeded!Panic save failed!software bugIt was a good hit!It was a great hit!It was a superb hit!It was a good hit!It was a great hit!It was a superb hit!It was a *GREAT* hit!It was a *SUPERB* hit!You have found a trap.You have found a secret door.You have discovered a trap on the chest!You have %s (%c).You have found %ld gold pieces worth of %s.You see %s.You have no room for %s.Pick up %s? You see %s.You see a pile of %d objects.You have no room for %s.You have no room for any of the objects on the floor.Get which item? a trapYou fall through a trap door!You float gently down to the next level.You fall into a pit!You float gently to the bottom of the pit.You fall into a spiked pit!You float gently to the floor of the pit.You carefully avoid touching the spikes.You are impaled!You fall into a spiked pit!You float gently to the floor of the pit.You carefully avoid touching the spikes.You are impaled on poisonous spikes!The poison does not affect you!You are enveloped in a cloud of smoke!You hit a teleport trap!You are enveloped in flames!a fire trapYou are splashed with acid!an acid trapA small dart hits you!A small dart barely misses you.A small dart hits you!A small dart barely misses you.A small dart hits you!A small dart barely misses you.A small dart hits you!A small dart barely misses you.You are surrounded by a black gas!You are surrounded by a gas of scintillating colors!You are surrounded by a pungent green gas!You are surrounded by a strange white mist!You are too afraid to attack %s!You hit %s.You do %d (out of %d) damage.Your hands stop glowing.%^s is unaffected.%^s is unaffected.%^s appears confused.You miss %s.%^s flees in terror!You feel a pile of rubble blocking your way.You feel a door blocking your way.You feel a wall blocking your way.There is a pile of rubble blocking your way.There is a door blocking your way.There is a wall blocking your way.You found a trap!I see no up staircase here.Nothing happens!You enter a maze of up staircases.I see no down staircase here.You enter a maze of down staircases.A small needle has pricked you!a poison needleA small needle has pricked you!a poison needleA puff of green gas surrounds you!A puff of yellow gas surrounds you!You are enveloped in a cloud of smoke!There is a sudden explosion!Everything inside the chest is destroyed!an exploding chestYou have picked the lock.You failed to pick the lock.I don't see any traps.The chest is not trapped.The chest is not trapped.You have disarmed the chest.You failed to disarm the chest.You set off a trap!You see nothing there.You see nothing there to open.The door appears to be stuck.You have picked the lock.You failed to pick the lock.There is a monster in the way!You see nothing there.You see nothing there to close.The door appears to be broken.There is a monster in the way!You see nothing there.You see nothing there to tunnel.This seems to be permanent rock.You have finished the tunnel.You tunnel into the granite wall.You have found something!You have finished the tunnel.You tunnel into the quartz vein.You tunnel into the magma vein.You have removed the rubble.You have found something!You dig in the rubble.You have finished the tunnel.You tunnel into the granite wall.You have finished the tunnel.You tunnel into the door.There is a monster in the way!You see nothing there.You see nothing there to disarm.You have disarmed the %s.You failed to disarm the %s.You set off the %s!There is a monster in the way!You see nothing there.You see nothing there to bash.You smash into the door!The door crashes open!The door holds firm.You are off-balance.There is a monster in the way!You spin around.You see nothing there.You see nothing there to spike.You have no spikes!There is a monster in the way!You jam the door with a spike.There is a pile of rubble in the way!There is a door in the way!There is a wall in the way!You are too confused!Rest (0-9999, '*' for HP/SP, '&' as needed): &You have nothing to fire with.Fire which item? You have nothing to fire. dies.Evg is destroyed.The %s finds a mark.The %s hits %s.You do %d (out of %d) damage.%^s flees in terror!Throw which item? You have nothing to throw. dies.Evg is destroyed.The %s finds a mark.The %s hits %s.You do %d (out of %d) damage.%^s flees in terror!(Inventory) Command: (Equipment) Command: Wear/Wield which item? You have nothing you can wear or wield.The %s you are %s appears to be cursed.You are wieldingYou are shooting withYour light source isYou are wearing%s %s (%c).Oops! It feels deathly cold!Take off which item? You are not wearing anything to take off.Hmmm, it seems to be cursed.Drop which item? You have nothing to drop.Hmmm, it seems to be cursed.Destroy which item? You have nothing to destroy.Really destroy %s? You cannot destroy %s.You destroy %s.Examine which item? You have nothing to examine.Un-inscribe which item? You have nothing to un-inscribe.That item had no inscription to remove.Inscription removed.Inscribe which item? You have nothing to inscribe.Inscribing %s.%sInscription: Refill with which source of oil? You have no sources of oil.You fuel your lamp.Your lamp is full.Refuel with which torch? You have no extra torches.You combine the torches.Your torch is fully fueled.Your torch glows more brightly.You are not wielding a light.Your light cannot be refilled.Target Selected.Target Aborted.Target Selected.%s%s ofMap sector [%d,%d], which is%s your sector. Direction?Map sector [%d(%02d),%d(%02d)], which is%s your sector. Direction?Illegal direction for locate! :A dark grid!:A potion (or oil)":An amulet (or necklace)#:A wall (or secret door)$:Treasure (gold or gems)%:A vein (magma or quartz)':An open door(:Soft armor):A shield*:A vein with treasure+:A closed door,:Food (or mushroom patch)-:A wand (or rod).:Floor/:A polearm (Axe/Pike/etc)1:Entrance to General Store2:Entrance to Armory3:Entrance to Weaponsmith4:Entrance to Temple5:Entrance to Alchemy shop6:Entrance to Magic store7:Entrance to Black Market8:Entrance to your home::Rubble;:A glyph of warding<:An up staircase=:A ring>:A down staircase?:A scroll@:YouA:AngelB:BirdC:CanineD:Ancient Dragon/WyrmE:ElementalF:Dragon FlyG:GhostH:HybridI:InsectJ:SnakeK:Killer BeetleL:LichM:Multi-Headed ReptileO:OgreP:Giant HumanoidQ:Quylthulg (Pulsing Flesh Mound)R:Reptile/AmphibianS:Spider/Scorpion/TickT:TrollU:Major DemonV:VampireW:Wight/Wraith/etcX:Xorn/Xaren/etcY:YetiZ:Zephyr Hound[:Hard armor\:A hafted weapon (mace/whip/etc)]:Misc. armor^:A trap_:A staffa:Antb:Batc:Centipeded:Dragone:Floating Eyef:Felineg:Golemh:Hobbit/Elf/Dwarfi:Icky Thingj:Jellyk:Koboldl:Lousem:Moldn:Nagao:Orcp:Person/Humanq:Quadrupedr:Rodents:Skeletont:Townspersonu:Minor Demonv:Vortexw:Worm/Worm-Massy:Yeekz:Zombie/Mummy{:A missile (arrow/bolt/shot)|:An edged weapon (sword/dagger/etc)}:A launcher (bow/crossbow/sling)~:A tool (or miscellaneous item)Enter character to be identified: Full monster list.Unique monster list.Non-unique monster list.%c - %s.%c - %s.Recall details? (k/p/y/n): [(r)ecall, ESC] [(r)ecall, ESC]['c' to change name, 'f' to file, 'h' to change mode, or ESC]%s.txtFile name: Character dump failed!Character dump successful.Illegal command for change name!> %sMessage Recall (%d-%d of %d), Offset %d[Press 'p' for older, 'n' for newer, ..., or ESCAPE]Show: Find: Pref: Command: Load a user pref fileFile: %s.prfFailed to load '%s'!Loaded '%s'.%s (RET to advance, y/n to set, ESC to accept) %-48s: %s (%s)option.txt#%sIllegal command for normal options!Window flags ( to move, 't' to toggle, or ESC)(Unused option)Cannot set main window flags!Illegal command for window options!a # Automatic option dump # Option '%s' Y:%s X:%s # Window '%s', Flag '%s' W:%d:%d:1 W:%d:%d:0 %s options(1) User Interface Options(2) Disturbance Options(3) Game-Play Options(4) Efficiency Options(5) Display Options(6) Birth Options(7) Cheat Options(W) Window flags(L) Load a user pref file(A) Append options to a file(D) Base Delay Factor(H) Hitpoint WarningCommand: User Interface OptionsDisturbance OptionsGame-Play OptionsEfficiency OptionsDisplay OptionsBirth OptionsCheat OptionsCommand: Append options to a fileFile: %s.prfFailed!Done.Command: Base Delay FactorCurrent base delay factor: %d (%d msec)New base delay factor (0-9 or ESC to accept): Illegal delay factor!Command: Hitpoint WarningCurrent hitpoint warning: %2d%%New hitpoint warning (0-9 or ESC to accept): Illegal hitpoint warning!Illegal command for options!a # Automatic macro dump # Macro '%d' A:%s P:%s a # Automatic keymap dump A:%s C:%d:%s Interact with MacrosCurrent action (if any) shown below:(1) Load a user pref file(2) Append macros to a file(3) Query a macro(4) Create a macro(5) Remove a macro(6) Append keymaps to a file(7) Query a keymap(8) Create a keymap(9) Remove a keymap(0) Enter a new actionCommand: Command: Append macros to a fileFile: %s.prfAppended macros.Command: Query a macroTrigger: Found no macro.Found a macro.Command: Create a macroTrigger: Action: Added a macro.Command: Remove a macroTrigger: Removed a macro.Command: Append keymaps to a fileFile: %s.prfAppended keymaps.Command: Query a keymapKeypress: Found no keymap.Found a keymap.Command: Create a keymapKeypress: Action: Added a keymap.Command: Remove a keymapKeypress: Removed a keymap.Command: Enter a new actionIllegal command for macros!Interact with Visuals(1) Load a user pref file(2) Dump monster attr/chars(3) Dump object attr/chars(4) Dump feature attr/chars(5) Dump flavor attr/chars(6) Change monster attr/chars(7) Change object attr/chars(8) Change feature attr/chars(9) Change flavor attr/chars(0) Reset visualsCommand: Command: Dump monster attr/charsFile: %s.prfa # Monster attr/char definitions # %s R:%d:0x%02X:0x%02X Dumped monster attr/chars.Command: Dump object attr/charsFile: %s.prfa # Object attr/char definitions # %s K:%d:0x%02X:0x%02X Dumped object attr/chars.Command: Dump feature attr/charsFile: %s.prfa # Feature attr/char definitions # %s F:%d:0x%02X:0x%02X Dumped feature attr/chars.Command: Dump flavor attr/charsFile: %s.prfa # Flavor attr/char definitions # %s L:%d:0x%02X:0x%02X Dumped flavor attr/chars.Command: Change monster attr/charsMonster = %d, Name = %-40.40sDefault attr/char = %3u / %3u<< ? >>Current attr/char = %3u / %3u<< ? >>Command (n/N/a/A/c/C): Command: Change object attr/charsObject = %d, Name = %-40.40sDefault attr/char = %3d / %3d<< ? >>Current attr/char = %3d / %3d<< ? >>Command (n/N/a/A/c/C): Command: Change feature attr/charsTerrain = %d, Name = %-40.40sDefault attr/char = %3d / %3d<< ? >>Current attr/char = %3d / %3d<< ? >>Command (n/N/a/A/c/C): Command: Change flavor attr/charsFlavor = %d, Text = %-40.40sDefault attr/char = %3d / %3d<< ? >>Current attr/char = %3d / %3d<< ? >>Command (n/N/a/A/c/C): Visual attr/char tables reset.Illegal command for visuals!Interact with Colors(1) Load a user pref file(2) Dump colors(3) Modify colorsCommand: Command: Dump colorsFile: %s.prfa # Color redefinitions unknown# Color '%s' V:%d:0x%02X:0x%02X:0x%02X:0x%02X Dumped color redefinitions.Command: Modify colors###%3dColor = %d, Name = %sK = 0x%02x / R,G,B = 0x%02x,0x%02x,0x%02xCommand (n/N/k/K/r/R/g/G/b/B): Illegal command for colors!Note: Note: %sYou are playing %s %s. Type '?' for more info.Looks like any other level.You feel there is something special about this level.You have a superb feeling about this level.You have an excellent feeling...You have a very good feeling...You have a good feeling...You feel strangely lucky...You feel your luck is turning...You like the look of this place...This level can't be all bad...What a boring place...Looks like a typical town.dump.txtrScreen dump loaded.dump.txtw%s %s Screen dump saved.Unknown Artifact The %s Known (or lost) artifacts %-30s is %s Uniques: %d known, %d killed %s Known ObjectsDisplay current knowledge(1) Display known artifacts(2) Display known uniques(3) Display known objectsCommand: Illegal command for knowledge!NameLv Mana Fail Info %c) %-30s forgotten unknown difficult untried %c) %-30s%2d %4d %3d%%%s(%^ss %c-%c, *=List, ESC=exit) %^s which %s? Illegal spell choice!Illegal spell choice!You may not %s that %s.%^s %s (%d mana, %d%% fail)? (Browsing) Command: You cannot read books!Browse which book? You have no books that you can read.You cannot read books!You cannot see!You are too confused!You cannot learn any new %ss!Study which book? You have no books that you can read.studyYou cannot learn any %ss in that book.You have learned the %s of %s.You can learn %d more %s%s.You cannot cast spells!You cannot see!You are too confused!Use which book? You have no spell books!castYou don't know any spells in that book.You do not have enough mana to cast this spell.Attempt it anyway? You failed to get the spell off!You faint from the effort!You have damaged your health!Pray hard enough and your prayers may be answered.You cannot see!You are too confused!Use which book? You have no prayer books!reciteYou don't know any prayers in that book.You do not have enough mana to recite this prayer.Attempt it anyway? You failed to concentrate hard enough!You faint from the effort!You have damaged your health!Eat which item? You have nothing to eat.Quaff which potion? You have no potions to quaff.You can't see anything.You have no light to read by.You are too confused!Read which scroll? You have no scrolls to read.Use which staff? You have no staff to use.You must first pick up the staffs.You failed to use the staff properly.The staff has no charges left.You unstack your staff.Aim which wand? You have no wand to aim.You must first pick up the wands.You unstack your wand.Zap which rod? You have no rod to zap.You must first pick up the rods.You unstack your rod.Activate which item? You have nothing to activate.You failed to activate it properly.Okay.Fine.Accepted!Agreed!Done!Taken!You try my patience. %s is final.My patience grows thin. %s is final.I can take no less than %s gold pieces.I will accept no less than %s gold pieces.Ha! No less than %s gold pieces.You knave! No less than %s gold pieces.That's a pittance! I want %s gold pieces.That's an insult! I want %s gold pieces.As if! How about %s gold pieces?My arse! How about %s gold pieces?May the fleas of 1000 orcs molest you! Try %s gold pieces.May your most favourite parts go moldy! Try %s gold pieces.May Morgoth find you tasty! Perhaps %s gold pieces?Your mother was an Ogre! Perhaps %s gold pieces?You try my patience. %s is final.My patience grows thin. %s is final.Perhaps %s gold pieces?How about %s gold pieces?I will pay no more than %s gold pieces.I can afford no more than %s gold pieces.Be reasonable. How about %s gold pieces?I'll buy it as scrap for %s gold pieces.That is too much! How about %s gold pieces?That looks war surplus! Say %s gold pieces?Never! %s is more like it.That's an insult! %s is more like it.%s gold pieces and be thankful for it!%s gold pieces and not a copper more!Enough! You have abused me once too often!Arghhh! I have had enough abuse for one day!That does it! You shall waste my time no more!This is getting nowhere! I'm going to Londis!Leave my store!Get out of my sight!Begone, you scoundrel!Out, out, out!Try again.Ridiculous!You will have to do better than that!Do you wish to do business or not?You've got to be kidding!You'd better be kidding!You try my patience.Hmmm, nice weather we're having.I must have heard you wrong.I'm sorry, I missed that.I'm sorry, what was that?Sorry, what was that again?%ld%ldArrgghh!You bastard!You hear someone sobbing...The shopkeeper howls in agony!Damn!You fiend!The shopkeeper curses at you.The shopkeeper glares at you.Cool!You've made my day!The shopkeeper giggles.The shopkeeper laughs loudly.Yipee!I think I'll retire!The shopkeeper jumps for joy.The shopkeeper smiles gleefully.%c) %3d.%d lb%3d.%d%9ld F%9ld %9ld -more-(Page %d)Gold Remaining: %9ldYour HomeItem DescriptionWeight%s (%s)%s (%ld)Item DescriptionWeightPrice(Items %c-%c, ESC to exit) %sIllegal store object choice!Try %s? %s [accept] %s [-%ld] %s [+%ld] %s Invalid response.AskingYou instantly agree upon the price.You eventually agree upon the price.You quickly agree upon the price.Final Offer%s : %ldWhat do you offer? Final OfferYour last offer: %ldOfferYou instantly agree upon the price.You eventually agree upon the price.You quickly agree upon the price.Final Offer%s : %ldWhat price do you ask? Final OfferYour last bid %ldYour home is empty.I am currently out of stock.Which item do you want to take? Which item are you interested in? You cannot carry that many items.Buying %s (%c).You bought %s (%c) for %ld gold.You have %s (%c).The shopkeeper retires.The shopkeeper brings out some new stock.You do not have enough gold.You have %s (%c).Drop which item? Sell which item? You have nothing that I want.Hmmm, it seems to be cursed.Your home is full.I have not the room in my store to keep it.Selling %s (%c).You sold %s (%c) for %ld gold.You drop %s (%c).Your home is empty.I am currently out of stock.Which item do you want to examine? Which item do you want to look at? Entire inventory is shown.That command does not work in stores.You see no store here.The doors are locked. ESC) Exit from Building. SPACE) Next page of stock. g) Get/Purchase an item. d) Drop/Sell an item. x) eXamine an item. l) Look at an item.You may: Your pack is so full that you flee the store...Your pack is so full that you flee your home...Your pack overflows!You drop %s (%c).Please answer the following questions. Most of the questionsdisplay a set of standard answers, and many will also acceptsome special responses, including 'Q' to quit, 'S' to restart,and '?' for help. Note that 'Q' and 'S' must be capitalized.Your 'sex' does not have any significant gameplay effects.%c%c %sChoose a sex (%c-%c, or * for random): Illegal sex!SexYour 'race' determines various intrinsic factors and bonuses.%c%c %sChoose a race (%c-%c, or * for random): Illegal race!RaceYour 'class' determines various intrinsic abilities and bonuses.Any entries with a (*) should only be used by advanced players. (*)%c%c %s%sChoose a class (%c-%c, or * for random): Illegal class!ClassYou can change your options at any time, but the 'Birth' optionsmust be changed now to affect the birth of this character.Modify options (y/n)? Illegal answer!Excessive stats!Cost%4dTotal Cost %2d/48. Use 2/8 to move, 4/6 to modify, 'Enter' to accept.The auto-roller will automatically ignore characters which donot meet the minimum values for any stats specified below.Note that stats are not independant, so it is not possible toget perfect (or even high) values for all your stats.Enter minimum value for: (Max of 18/%02d):(Max of %2d):%-5s%-20s/ Limit Freq RollRound:(Hit ESC to stop)%3d.%d%%(NONE)%10ld'r' to reroll, 'p' for prev, or 'Enter' to acceptIllegal auto-roller command!['Q' to suicide, 'S' to start over, or any other key to continue] ==================== Illegal store owner!Error reading itemToo many player spells (%d).Invalid player race (%d).Invalid player class (%d).Invalid player level (%d).Too many (%u) hitpoint entries!Incompatible random artifacts version!Too many (%u) random artifacts!Error reading itemToo many items in the inventory!Ignoring illegal dungeon depth (%d)Ignoring illegal dungeon size (%d,%d).Ignoring illegal player location (%d,%d).Cannot place player (%d,%d)!Too many (%d) object entries!Error reading itemCannot place object %d!Too many (%d) monster entries!Cannot place monster %dInvalid monster indexLoading a %d.%d.%d savefile...Loaded Randomizer InfoLoaded Option FlagsLoaded MessagesToo many (%u) monster races!Loaded Monster MemoryToo many (%u) object kinds!Loaded Object MemoryToo many (%u) quests!Loaded QuestsToo many (%u) artifacts!Loaded ArtifactsLoaded extra informationLoaded Random ArtifactsUnable to read inventoryRestoring Dungeon...Error reading dungeon dataInvalid checksumInvalid encoded checksumrbgenericSavefile does not exist.Cannot open savefileCannot read savefileSavefile is too oldSavefile is from the futureCannot parse savefileBroken savefileConverted a %d.%d.%d savefile.(alive and well)Error (%s) reading %d.%d.%d savefile. AmmoBowsWeaponsArmour (Body)Armour (Misc)AmuletsRingsScrollsPotionsFoodRodsWandsStaffsBooks (Mage)Books (Priest)ChestsVarious%dd%d%dd%d%d%3d.%d%-51s %7s%6s%4s%9s wCannot create spoiler file.Spoiler File -- Basic Items (%s) %-51s%7s%6s%4d%9ld %s Cannot close spoiler file.Successfully created a spoiler file.Edged WeaponsPolearmsHafted WeaponsBowsDiggersBody ArmorCloaksShieldsHelms/CrownsGlovesBootsLight SourcesAmuletsRingswCannot create spoiler file.Artifact Spoilers for %s %s Level %u, Rarity %u, %d.%d lbs, %ld AU Cannot close spoiler file.Successfully created a spoiler file.wCannot create spoiler file.Monster Spoilers for %s Version %s ------------------------------------------ %-40.40s%4s%4s%6s%8s%4s %11.11s %-40.40s%4s%4s%6s%8s%4s %11.11s [Q] %s[U] %sThe %s%d%d+%d-%d%d%d%dd%d%ld%s '%c'%-40.40s%4s%4s%6s%8s%4s %11.11s Cannot close spoiler file.Successfully created a spoiler file.wCannot create spoiler file.Monster Spoilers for %s Version %s ------------------------------------------ [Q] [U] The %s ( '%c') === Num:%d Lev:%d Rar:%d Spd:+%d Spd:-%d Hp:%d Hp:%dd%d Ac:%d Exp:%ld Cannot close spoiler file.Successfully created a spoiler file.Create a spoiler file.(1) Brief Object Info (obj-desc.spo)(2) Brief Artifact Info (artifact.spo)(3) Brief Monster Info (mon-desc.spo)(4) Full Monster Info (mon-info.spo)Command: obj-desc.spoartifact.spomon-desc.spomon-info.spoIllegal command for spoilers!Depth %d: %s (3-118): %d%ldGold: %ldExperience: %ldMax Exp: kind = %-5d level = %-4d tval = %-5d sval = %-5dnumber = %-3d wgt = %-6d ac = %-5d damage = %dd%dpval = %-5d toac = %-5d tohit = %-4d todam = %-4dname1 = %-4d name2 = %-4d cost = %ldident = %04x timeout = %-d+------------FLAGS1------------+AFFECT..........SLAY.......BRAND ae xxxpaefcsiwdcc ssidsasmnvudotgddduocliotnieoh trnipthgiinmrrnrrmniierlrtsxna..lcfgdkttmldncltggndsdced+------------FLAGS2------------+SUST........IMM.RESIST......... afecaefcpfldbc s n siwdcc cilocliooeialoshnecdtnieoh irelierliatrnnnrethirtsxna......decddcedsrekdfddxhss+------------FLAGS3------------+s ts h tadiiii aiehs hplf eefo egrgggg bcnaih vrwe lerl ilgannnn ltssdo ymda reied merirrrr eityew cccitlepnel ppanaefc svaktm uuughigavai aoveclio saanyo rrrseteticf craxierl etropd ssstrenhste tttpdced detwes eeeSwordPolearmHafted WeaponBowArrowsBoltsShotsShieldCrownHelmGlovesBootsCloakDragon Scale MailHard ArmorSoft ArmorRingAmuletLitePotionScrollWandStaffRodPriest BookMagic BookSpikesDiggerChestFoodFlaskSkeletonsEmpty bottleJunk[%c] %sGet what type of object? [%c] %sWhat Kind of %s? Enter new 'pval' setting: %dEnter new 'to_a' setting: %dEnter new 'to_h' setting: %dEnter new 'to_d' setting: %d[a]ccept, [n]ormal, [g]ood, [e]xcellent? Rolls: %ld, Matches: %ld, Better: %ld, Worse: %ld, Other: %ldRoll for [n]ormal, [g]ood, or [e]xcellent treasure? normalgoodexcellentCreating a lot of %s items. Base level = %d.%dQuantity: Play with which object? You have nothing to play with.[a]ccept [s]tatistics [r]eroll [t]weak [q]uantity? Changes accepted.Changes ignored.Allocated.Allocated.Jump to level (0-%d): %dYou jump to dungeon level %d.Current Life Rating is %d/100.Debug Command Query: Press any key.Debug Command: That is not a valid debug command.Failed to setup curses window.-bIgnoring option: %sAngband needs at least an 80x24 'curses' screenColor pair init failedcpy3xor6and1ior7nor8inv10clr0set15src3dst5+andReverse2+andInverted4+noop5+equiv9+orReverse11+copyInverted12+orInverted13+nand14%c%s%s%s%s_%lX%c%c%s%s%s%sK_%X%cANGBAND_X11_AT_X_%dANGBAND_X11_AT_Y_%dANGBAND_X11_COLS_%dANGBAND_X11_ROWS_%dANGBAND_X11_IBOX_%dANGBAND_X11_IBOY_%dCouldn't load the requested font. (%s)XAllocClassHint failedAngbandXAllocSizeHints failed-d-s-o-a-g-b-nIgnoring option: %sxorcpy16x16.bmpgraf/%snew8x8.bmpgraf/%sold32x32.bmpdavidgraf/%sCouldn't find the requested font!Size change denied!Can't find the font "%s", trying fixed fixedCan't fint the font "fixed"!, bailing out %c%s%s%s%s_%lX%c%c%s%s%s%sK_%X%cANGBAND_X11_COLS_%dANGBAND_X11_ROWS_%dANGBAND_X11_IBOX_%dANGBAND_X11_IBOY_%dredrawCallback9x15Couldn't find the requested font!Size change denied!-d-s-o-a-g-b-nIgnoring option: %sAngband16x16.bmpgraf/%snew8x8.bmpgraf/%sold32x32.bmpdavidgraf/%sxawx11xpjgcu~/.angbandAngband//Try '-d=' not '-d%s'Bad semantics in '-d%s'The gates to Angband are closed (bad time).The gates to Angband are closed (bad load).Usage: angband [options] [-- subopts] -n Start a new character -f Request fiddle (verbose) mode -w Request wizard mode -v Request sound mode -g Request graphics mode -o Request original keyset (default) -r Request rogue-like keyset -s Show high scores (default: 10) -u Use your savefile -d Define a 'lib' dir sub-path -m use Module , where can be: %s %s Unable to prepare any 'display module'!cpy3xor6and1ior7nor8inv10clr0set15src3dst5+andReverse2+andInverted4+noop5+equiv9+orReverse11+copyInverted12+orInverted13+nand14%c%s%s%s%s_%lX%c%c%s%s%s%sK_%X%crIncorrect font file format on line %dIncorrect font file numbering on line %dIncorrect font file numbering on line %dIncorrect font size on line %dIncorrect font size length on line %dIncorrect font size width on line %dANGBAND_X11_AT_X_%dANGBAND_X11_AT_Y_%dANGBAND_X11_COLS_%dANGBAND_X11_ROWS_%dANGBAND_X11_IBOX_%dANGBAND_X11_IBOY_%dCouldn't load the requested font. (%s)XAllocClassHint failedAngbandXAllocSizeHints failedNeed to compile with P_TILE_SIZE as a multiple of four.-d-s-nIgnoring option: %sxorcpygraf/16x16.bmpnewnoneCould not initialise graphics!Unsupported bytes per pixel format of screenfont/16x16.txtCould not allocate font metrics!Could not initialise font metrics!Destroyed Levelijm,oTPDdUjellyanimalundeadMonster nest (%s)orctrollgiantacid dragonelectric dragonfire dragoncold dragonpoison dragonmulti-hued dragondemonMonster pit (%s)Lesser vault (%s)Greater vault (%s)too many objectstoo many monstersboring levelGeneration restarted (%s)You feel the %s (%c) you are %s %s %s...You feel the %s (%c) in your pack %s %s...The gates to ANGBAND are closing...Please finish up and/or save your game.The gates to ANGBAND are now closed.The sun has risen.The sun has fallen.Updating Shops...Shuffling a Shopkeeper...Done.poisona fatal woundstarvationYou faint from the lack of food.Your light has gone out!Your light is growing faint.You feel yourself yanked upwards!You feel yourself yanked downwards!You are about to enter 'wizard' mode for the very first time!This is a form of cheating, and your game will not be scored!Are you sure you want to enter wizard mode? You are about to use the dangerous, unsupported, debug commands!Your machine may crash, and your savefile may become corrupted!Are you sure you want to use the debug commands? Wizard mode off.Wizard mode on.Type '?' for help.Cancelled.Your pack overflows!You drop %s (%c).user.prf%s.prfmain window does not existmain window is too smallbroken savefilePLAYERPlease wait...Die? You invoke wizard mode and cheat death.A tension leaves the air around you...Cheating deathHITTOUCHPUNCHKICKCLAWBITESTINGXXX1BUTTCRUSHENGULFXXX2CRAWLDROOLSPITXXX3GAZEWAILSPOREXXX4BEGINSULTMOANXXX5HURTPOISONUN_BONUSUN_POWEREAT_GOLDEAT_ITEMEAT_FOODEAT_LITEACIDELECFIRECOLDBLINDCONFUSETERRIFYPARALYZELOSE_STRLOSE_INTLOSE_WISLOSE_DEXLOSE_CONLOSE_CHRLOSE_ALLSHATTEREXP_10EXP_20EXP_40EXP_80HALLUUNIQUEQUESTORMALEFEMALECHAR_CLEARCHAR_MULTIATTR_CLEARATTR_MULTIFORCE_DEPTHFORCE_MAXHPFORCE_SLEEPFORCE_EXTRAFRIENDFRIENDSESCORTESCORTSNEVER_BLOWNEVER_MOVERAND_25RAND_50ONLY_GOLDONLY_ITEMDROP_60DROP_90DROP_1D2DROP_2D2DROP_3D2DROP_4D2DROP_GOODDROP_GREATDROP_USEFULDROP_CHOSENSTUPIDSMARTXXX1X2XXX2X2INVISIBLECOLD_BLOODEMPTY_MINDWEIRD_MINDMULTIPLYREGENERATEXXX3X2XXX4X2POWERFULXXX5X2XXX7X2XXX6X2OPEN_DOORBASH_DOORPASS_WALLKILL_WALLMOVE_BODYKILL_BODYTAKE_ITEMKILL_ITEMBRAIN_1BRAIN_2BRAIN_3BRAIN_4BRAIN_5BRAIN_6BRAIN_7BRAIN_8ORCTROLLGIANTDRAGONDEMONUNDEADEVILANIMALXXX1X3XXX2X3XXX3X3XXX4X3HURT_LITEHURT_ROCKHURT_FIREHURT_COLDIM_ACIDIM_ELECIM_FIREIM_COLDIM_POISXXX5X3RES_NETHRES_WATERES_PLASRES_NEXURES_DISEXXX6X3NO_FEARNO_STUNNO_CONFNO_SLEEPSHRIEKXXX2X4XXX3X4XXX4X4ARROW_1ARROW_2ARROW_3ARROW_4BR_ACIDBR_ELECBR_FIREBR_COLDBR_POISBR_NETHBR_LITEBR_DARKBR_CONFBR_SOUNBR_CHAOBR_DISEBR_NEXUBR_TIMEBR_INERBR_GRAVBR_SHARBR_PLASBR_WALLBR_MANAXXX5X4XXX6X4XXX7X4BOULDERBA_ACIDBA_ELECBA_FIREBA_COLDBA_POISBA_NETHBA_WATEBA_MANABA_DARKDRAIN_MANAMIND_BLASTBRAIN_SMASHCAUSE_1CAUSE_2CAUSE_3CAUSE_4BO_ACIDBO_ELECBO_FIREBO_COLDBO_POISBO_NETHBO_WATEBO_MANABO_PLASBO_ICEEMISSILESCAREBLINDCONFSLOWHOLDHASTEXXX1X6HEALXXX2X6BLINKTPORTXXX3X6XXX4X6TELE_TOTELE_AWAYTELE_LEVELXXX5DARKNESSTRAPSFORGETXXX6X6S_KINS_HI_DEMONS_MONSTERS_MONSTERSS_ANIMALS_SPIDERS_HOUNDS_HYDRAS_ANGELS_DEMONS_UNDEADS_DRAGONS_HI_UNDEADS_HI_DRAGONS_WRAITHS_UNIQUESTRINTWISDEXCONCHRXXX1XXX2STEALTHSEARCHINFRATUNNELSPEEDBLOWSSHOTSMIGHTSLAY_ANIMALSLAY_EVILSLAY_UNDEADSLAY_DEMONSLAY_ORCSLAY_TROLLSLAY_GIANTSLAY_DRAGONKILL_DRAGONKILL_DEMONKILL_UNDEADBRAND_POISBRAND_ACIDBRAND_ELECBRAND_FIREBRAND_COLDSUST_STRSUST_INTSUST_WISSUST_DEXSUST_CONSUST_CHRXXX1XXX2XXX3XXX4XXX5XXX6IM_ACIDIM_ELECIM_FIREIM_COLDRES_ACIDRES_ELECRES_FIRERES_COLDRES_POISRES_FEARRES_LITERES_DARKRES_BLINDRES_CONFURES_SOUNDRES_SHARDRES_NEXUSRES_NETHRRES_CHAOSRES_DISENSLOW_DIGESTFEATHERLITEREGENTELEPATHYSEE_INVISFREE_ACTHOLD_LIFEXXX1XXX2XXX3XXX4IMPACTTELEPORTAGGRAVATEDRAIN_EXPIGNORE_ACIDIGNORE_ELECIGNORE_FIREIGNORE_COLDXXX5XXX6BLESSEDACTIVATEINSTA_ARTEASY_KNOWHIDE_TYPESHOW_MODSXXX7LIGHT_CURSEHEAVY_CURSEPERMA_CURSEILLUMINATIONMAGIC_MAPCLAIRVOYANCEPROT_EVILDISP_EVILHEAL1HEAL2CURE_WOUNDSHASTE1HASTE2FIRE1FIRE2FIRE3FROST1FROST2FROST3FROST4FROST5ACID1RECHARGE1SLEEPLIGHTNING_BOLTELEC2BANISHMENTMASS_BANISHMENTIDENTIFYDRAIN_LIFE1DRAIN_LIFE2BIZZARESTAR_BALLRAGE_BLESS_RESISTPHASETRAP_DOOR_DESTDETECTRESISTTELEPORTRESTORE_LIFEMISSILEARROWREM_FEAR_POISSTINKING_CLOUDSTONE_TO_MUDTELE_AWAYWORCONFUSEPROBEFIREBRANDSTARLIGHTMANA_BOLTBERSERKEREXTRA_SHOTBRAVERY_30BLESS_WEAPONCUMBER_GLOVEZERO_FAILBEAMCHOOSE_SPELLSPSEUDO_ID_HEAVYPSEUDO_ID_IMPROVXXX10XXX11XXX12XXX13XXX14XXX15XXX16XXX17XXX18XXX19XXX20XXX21XXX22XXX23XXX24XXX25XXX26XXX27XXX28XXX29XXX30XXX31XXX32%d.%d.%d%d%d%d%d%d%d%d%d%d%d%d%d%d%ld%ld%d:%d:%d:%d%dUnknown object flag '%s'.%d:%d:%d%d:%d:%d:%ld%d:%dd%d:%d:%d:%dUnknown artifact flag '%s'.Unknown artifact activation '%s'.%d:%d:%d%d:%d:%d:%ld%d:%dd%d:%d:%d:%d%d:%dUnknown ego-item flag '%s'.%d:%d:%d:%ld%d:%d%d:%d:%d%d:%d:%d:%dUnknown monster flag '%s'.Unknown monster flag '%s'.%d:%dd%d:%d:%d:%d%d:%d:%d:%ld1_IN_%dUnknown player flag '%s'.%d:%d:%d:%d:%d:%d:%d:%d%d:%d:%d%d:%d:%d%d:%d:%d:%d%d:%d:%d:%dUnknown player class flag '%s'.%d:%d:%d:%d:%d:%d:%d:%d%d:%d:%d:%d:%d:%d:%d:%d%d:%d:%ld:%d%d:%d:%d%d:%d:%d:%d%d:%d:%d:%d:%d%d:%d:%d:%dN:%d:%d:%d:%d%d:%d:%d:%d:%d:%dN:%d:%d:%dapexbonedataeditfilehelpinfosavepref~/.angbandAngbandxtrascriptparse errorobsolete filemissing record headernon-sequential recordsinvalid flag specificationundefined directiveout of memoryvalue out of boundstoo few argumentstoo many argumentstoo many allocation entriesinvalid spell frequencyinvalid number of items (0-99)too many entriesvault too bigError at line %d of '%s.txt'.Record %d contains a '%s' error.Parsing '%s'.Error in '%s.txt' file.%s.raw%s.txt%s.txtrCannot open '%s.txt' file.%s.rawCannot create the '%s' file!%s.rawCannot load '%s.raw' file.Cannot parse '%s.raw' file.limitsterrainobjectartifactego_itemmonstervaultp_racep_classp_histshop_owncost_adjflavor%sNo town objects!No town monsters!%s %snews.txtCannot access the '%s' file!news.txtrscores.rawCannot create the '%s' file![Initializing array sizes...]Cannot initialize sizes[Initializing arrays... (features)]Cannot initialize features[Initializing arrays... (objects)]Cannot initialize objects[Initializing arrays... (artifacts)]Cannot initialize artifacts[Initializing arrays... (ego-items)]Cannot initialize ego-items[Initializing arrays... (monsters)]Cannot initialize monsters[Initializing arrays... (vaults)]Cannot initialize vaults[Initializing arrays... (histories)]Cannot initialize histories[Initializing arrays... (races)]Cannot initialize races[Initializing arrays... (classes)]Cannot initialize classes[Initializing arrays... (owners)]Cannot initialize owners[Initializing arrays... (prices)]Cannot initialize prices[Initializing arrays... (flavors)]Cannot initialize flavors[Initializing arrays... (other)]Cannot initialize other stuff[Initializing arrays... (alloc)]Cannot initialize alloc stuff[Initializing scripts... (scripts)]Cannot initialize scripts[Loading basic user pref file...]pref.prf[Initialization complete]adanedhel adurant aeglos aegnor aelin aeluin aerandir aerin agarwaen aglareb aglarond aglon ainulindale ainur alcarinque aldaron aldudenie almaren alqualonde aman amandil amarie amarth amlach amon amras amrod anach anar anarion ancalagon ancalimon anarrima andor andram androth anduin andunie anfauglir anfauglith angainor angband anghabar anglachel angrenost angrim angrist angrod anguirel annael annatar annon annuminas apanonar aradan aragorn araman aranel aranruth aranwe aras aratan aratar arathorn arda ard-galen aredhel ar-feiniel argonath arien armenelos arminas arnor aros arossiach arthad arvernien arwen ascar astaldo atalante atanamir atanatari atani aule avallone avari avathar balan balar balrog barad baragund barahir baran baranduin bar bauglir beleg belegaer belegost belegund beleriand belfalas belthil belthronding beor beraid bereg beren boromir boron bragollach brandir bregolas bregor brethil brilthor brithiach brithombar brithon cabed calacirya calaquendi calenardhon calion camlost caragdur caranthir carcharoth cardolan carnil celeborn celebrant celebrimbor celebrindal celebros celegorm celon cirdan cirith cirth ciryatan ciryon coimas corollaire crissaegrim cuarthal cuivienen culurien curufin curufinwe curunir cuthalion daedeloth daeron dagnir dagor dagorlad dairuin danwedh delduwath denethor dimbar dimrost dinen dior dirnen dolmed doriath dorlas dorthonion draugluin drengist duath duinath duilwen dunedain dungortheb earendil earendur earnil earnur earrame earwen echor echoriath ecthelion edain edrahil eglador eglarest eglath eilinel eithel ekkaia elbereth eldalie eldalieva eldamar eldar eledhwen elemmire elende elendil elendur elenna elentari elenwe elerrina elleth elmoth elostirion elrond elros elu eluchil elured elurin elwe elwing emeldir endor engrin engwar eol eonwe ephel erchamion ereb ered erech eregion ereinion erellont eressea eriador eru esgalduin este estel estolad ethir ezellohar faelivrin falas falathar falathrim falmari faroth fauglith feanor feanturi felagund finarfin finduilas fingolfin fingon finwe firimar formenos fornost frodo fuin fuinur gabilgathol galad galadriel galathilion galdor galen galvorn gandalf gaurhoth gelion gelmir gelydh gil gildor giliath ginglith girith glaurung glingal glirhuin gloredhel glorfindel golodhrim gondolin gondor gonnhirrim gorgoroth gorlim gorthaur gorthol gothmog guilin guinar guldur gundor gurthang gwaith gwareth gwindor hadhodrond hador haladin haldad haldan haldar haldir haleth halmir handir harad hareth hathaldir hathol haudh helcar helcaraxe helevorn helluin herumor herunumen hildorien himlad himring hirilorn hisilome hithaeglir hithlum hollin huan hunthor huor hurin hyarmendacil hyarmentir iant iaur ibun idril illuin ilmare ilmen iluvatar imlach imladris indis ingwe irmo isil isildur istari ithil ivrin kelvar kementari ladros laiquendi lalaith lamath lammoth lanthir laurelin leithian legolin lembas lenwe linaewen lindon lindorie loeg lomelindi lomin lomion lorellin lorien lorindol losgar lothlann lothlorien luin luinil lumbar luthien mablung maedhros maeglin maglor magor mahanaxar mahtan maiar malduin malinalda mandos manwe mardil melian melkor menegroth meneldil menelmacar meneltarma minas minastir mindeb mindolluin mindon minyatur mirdain miriel mithlond mithrandir mithrim mordor morgoth morgul moria moriquendi mormegil morwen nahar naeramarth namo nandor nargothrond narog narsil narsilion narya nauglamir naugrim ndengin neithan neldoreth nenar nenning nenuial nenya nerdanel nessa nevrast nibin nienna nienor nimbrethil nimloth nimphelos nimrais nimras ningloron niniel ninniach ninquelote niphredil nirnaeth nivrim noegyth nogrod noldolante noldor numenor nurtale obel ohtar oiolosse oiomure olorin olvar olwe ondolinde orfalch ormal orocarni orodreth orodruin orome oromet orthanc osgiliath osse ossiriand palantir pelargir pelori periannath quendi quenta quenya radagast radhruin ragnor ramdal rana rathloriel rauros region rerir rhovanion rhudaur rhun rhunen rian ringil ringwil romenna rudh rumil saeros salmar saruman sauron serech seregon serinde shelob silmarien silmaril silpion sindar singollo sirion soronume sul sulimo talath taniquetil tar taras tarn tathren taur tauron teiglin telchar telemnar teleri telperion telumendil thalion thalos thangorodrim thargelion thingol thoronath thorondor thranduil thuringwethil tilion tintalle tinuviel tirion tirith tol tulkas tumhalad tumladen tuna tuor turambar turgon turin uial uilos uinen ulairi ulmo ulumuri umanyar umarth umbar ungoliant urthel uruloki utumno vaire valacirca valandil valaquenta valar valaraukar valaroma valier valimar valinor valinoreva valmar vana vanyar varda vasa vilya vingilot vinyamar voronwe wethrin wilwarin yavanna '%s'of %sof Power (The One Ring)'Grond'of MorgothIllegal bow sval %sIllegal tval/sval value for artifact %d!Artifact %d: power = %d%s%s%s%s%s%s%s%s%s%sRestarting generation process: not enough%s#vinvalid type in variable assignment.object_type#ferror in function 'object_desc'.build_script_pathobject_descbNotiModbAndbOrbXorlshiftrshiftarshiftnotify_event_hookobject_typeobject_typeuse_object(O)bbget_spell_index(O,d)dget_spell_name(d,d)sget_spell_info(d,d)scast_spell(d,d)bdescribe_item_activation(O)sget_store_choice(d)dstore_will_buy(d,O)bplayer_birth_doneplayer_calc_bonusstart_gameenter_levelleave_levelprocess_command(d)dgenerate_level(d)dinit.luasize_tmonster_typemonster_blowobject_typemonster_racemonster_loreinvalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment..selfinvalid type in array indexing.array indexing out of range.monster_blow.selfinvalid type in array indexing.array indexing out of range.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.#vinvalid type in variable assignment.#vinvalid type in variable assignment.#ferror in function 'make_attack_normal'.#ferror in function 'make_attack_spell'.#ferror in function 'process_monsters'.#ferror in function 'roff_top'.#ferror in function 'screen_roff'.#ferror in function 'display_roff'.#ferror in function 'delete_monster_idx'.#ferror in function 'delete_monster'.#ferror in function 'compact_monsters'.#ferror in function 'wipe_mon_list'.#ferror in function 'mon_pop'.#ferror in function 'get_mon_num_prep'.#ferror in function 'get_mon_num'.size_tconst monster_type#ferror in function 'monster_desc'.#ferror in function 'lore_do_probe'.#ferror in function 'lore_treasure'.bool#ferror in function 'update_mon'.bool#ferror in function 'update_monsters'.object_type#ferror in function 'monster_carry'.#ferror in function 'monster_swap'.#ferror in function 'player_place'.monster_type#ferror in function 'monster_place'.boolbool#ferror in function 'place_monster_aux'.boolbool#ferror in function 'place_monster'.bool#ferror in function 'alloc_monster'.#ferror in function 'summon_specific'.#ferror in function 'multiply_monster'.#ferror in function 'message_pain'.#ferror in function 'update_smart_learn'.#ferror in function 'monster_death'.bool#ferror in function 'mon_take_hit'.RBM_HITRBM_TOUCHRBM_PUNCHRBM_KICKRBM_CLAWRBM_BITERBM_STINGRBM_XXX1RBM_BUTTRBM_CRUSHRBM_ENGULFRBM_XXX2RBM_CRAWLRBM_DROOLRBM_SPITRBM_XXX3RBM_GAZERBM_WAILRBM_SPORERBM_XXX4RBM_BEGRBM_INSULTRBM_MOANRBM_XXX5RBE_HURTRBE_POISONRBE_UN_BONUSRBE_UN_POWERRBE_EAT_GOLDRBE_EAT_ITEMRBE_EAT_FOODRBE_EAT_LITERBE_ACIDRBE_ELECRBE_FIRERBE_COLDRBE_BLINDRBE_CONFUSERBE_TERRIFYRBE_PARALYZERBE_LOSE_STRRBE_LOSE_INTRBE_LOSE_WISRBE_LOSE_DEXRBE_LOSE_CONRBE_LOSE_CHRRBE_LOSE_ALLRBE_SHATTERRBE_EXP_10RBE_EXP_20RBE_EXP_40RBE_EXP_80RBE_HALLUSM_OPP_ACIDSM_OPP_ELECSM_OPP_FIRESM_OPP_COLDSM_OPP_POISSM_OPP_XXX1SM_OPP_XXX2SM_OPP_XXX3SM_IMM_XXX5SM_IMM_XXX6SM_IMM_FREESM_IMM_MANASM_IMM_ACIDSM_IMM_ELECSM_IMM_FIRESM_IMM_COLDSM_RES_ACIDSM_RES_ELECSM_RES_FIRESM_RES_COLDSM_RES_POISSM_RES_FEARSM_RES_LITESM_RES_DARKSM_RES_BLINDSM_RES_CONFUSM_RES_SOUNDSM_RES_SHARDSM_RES_NEXUSSM_RES_NETHRSM_RES_CHAOSSM_RES_DISENMFLAG_VIEWMFLAG_NICEMFLAG_SHOWMFLAG_MARKRF1_UNIQUERF1_QUESTORRF1_MALERF1_FEMALERF1_CHAR_CLEARRF1_CHAR_MULTIRF1_ATTR_CLEARRF1_ATTR_MULTIRF1_FORCE_DEPTHRF1_FORCE_MAXHPRF1_FORCE_SLEEPRF1_FORCE_EXTRARF1_FRIENDRF1_FRIENDSRF1_ESCORTRF1_ESCORTSRF1_NEVER_BLOWRF1_NEVER_MOVERF1_RAND_25RF1_RAND_50RF1_ONLY_GOLDRF1_ONLY_ITEMRF1_DROP_60RF1_DROP_90RF1_DROP_1D2RF1_DROP_2D2RF1_DROP_3D2RF1_DROP_4D2RF1_DROP_GOODRF1_DROP_GREATRF1_DROP_USEFULRF1_DROP_CHOSENRF2_STUPIDRF2_SMARTRF2_XXX1RF2_XXX2RF2_INVISIBLERF2_COLD_BLOODRF2_EMPTY_MINDRF2_WEIRD_MINDRF2_MULTIPLYRF2_REGENERATERF2_XXX3RF2_XXX4RF2_POWERFULRF2_XXX5RF2_XXX7RF2_XXX6RF2_OPEN_DOORRF2_BASH_DOORRF2_PASS_WALLRF2_KILL_WALLRF2_MOVE_BODYRF2_KILL_BODYRF2_TAKE_ITEMRF2_KILL_ITEMRF2_BRAIN_1RF2_BRAIN_2RF2_BRAIN_3RF2_BRAIN_4RF2_BRAIN_5RF2_BRAIN_6RF2_BRAIN_7RF2_BRAIN_8RF3_ORCRF3_TROLLRF3_GIANTRF3_DRAGONRF3_DEMONRF3_UNDEADRF3_EVILRF3_ANIMALRF3_XXX1RF3_XXX2RF3_XXX3RF3_XXX4RF3_HURT_LITERF3_HURT_ROCKRF3_HURT_FIRERF3_HURT_COLDRF3_IM_ACIDRF3_IM_ELECRF3_IM_FIRERF3_IM_COLDRF3_IM_POISRF3_XXX5RF3_RES_NETHRF3_RES_WATERF3_RES_PLASRF3_RES_NEXURF3_RES_DISERF3_XXX6RF3_NO_FEARRF3_NO_STUNRF3_NO_CONFRF3_NO_SLEEPRF4_SHRIEKRF4_XXX2RF4_XXX3RF4_XXX4RF4_ARROW_1RF4_ARROW_2RF4_ARROW_3RF4_ARROW_4RF4_BR_ACIDRF4_BR_ELECRF4_BR_FIRERF4_BR_COLDRF4_BR_POISRF4_BR_NETHRF4_BR_LITERF4_BR_DARKRF4_BR_CONFRF4_BR_SOUNRF4_BR_CHAORF4_BR_DISERF4_BR_NEXURF4_BR_TIMERF4_BR_INERRF4_BR_GRAVRF4_BR_SHARRF4_BR_PLASRF4_BR_WALLRF4_BR_MANARF4_XXX5RF4_XXX6RF4_XXX7RF4_BOULDERRF5_BA_ACIDRF5_BA_ELECRF5_BA_FIRERF5_BA_COLDRF5_BA_POISRF5_BA_NETHRF5_BA_WATERF5_BA_MANARF5_BA_DARKRF5_DRAIN_MANARF5_MIND_BLASTRF5_BRAIN_SMASHRF5_CAUSE_1RF5_CAUSE_2RF5_CAUSE_3RF5_CAUSE_4RF5_BO_ACIDRF5_BO_ELECRF5_BO_FIRERF5_BO_COLDRF5_BO_POISRF5_BO_NETHRF5_BO_WATERF5_BO_MANARF5_BO_PLASRF5_BO_ICEERF5_MISSILERF5_SCARERF5_BLINDRF5_CONFRF5_SLOWRF5_HOLDRF6_HASTERF6_XXX1RF6_HEALRF6_XXX2RF6_BLINKRF6_TPORTRF6_XXX3RF6_XXX4RF6_TELE_TORF6_TELE_AWAYRF6_TELE_LEVELRF6_XXX5RF6_DARKNESSRF6_TRAPSRF6_FORGETRF6_XXX6RF6_S_KINRF6_S_HI_DEMONRF6_S_MONSTERRF6_S_MONSTERSRF6_S_ANIMALRF6_S_SPIDERRF6_S_HOUNDRF6_S_HYDRARF6_S_ANGELRF6_S_DEMONRF6_S_UNDEADRF6_S_DRAGONRF6_S_HI_UNDEADRF6_S_HI_DRAGONRF6_S_WRAITHRF6_S_UNIQUEmonster_blowmonster_blowmethodmonster_bloweffectmonster_blowd_dicemonster_blowd_sidemonster_racemonster_racenamemonster_racetextmonster_racehdicemonster_racehsidemonster_raceacmonster_racesleepmonster_raceaafmonster_racespeedmonster_racemexpmonster_racefreq_innatemonster_racefreq_spellmonster_raceflags1monster_raceflags2monster_raceflags3monster_raceflags4monster_raceflags5monster_raceflags6monster_raceblowmonster_racelevelmonster_raceraritymonster_raced_attrmonster_raced_charmonster_racex_attrmonster_racex_charmonster_racemax_nummonster_racecur_nummonster_loremonster_loresightsmonster_loredeathsmonster_lorepkillsmonster_loretkillsmonster_lorewakemonster_loreignoremonster_loredrop_goldmonster_loredrop_itemmonster_lorecast_innatemonster_lorecast_spellmonster_loreblowsmonster_loreflags1monster_loreflags2monster_loreflags3monster_loreflags4monster_loreflags5monster_loreflags6monster_typemonster_typer_idxmonster_typefymonster_typefxmonster_typehpmonster_typemaxhpmonster_typecsleepmonster_typemspeedmonster_typeenergymonster_typestunnedmonster_typeconfusedmonster_typemonfearmonster_typecdismonster_typemflagmonster_typemlmonster_typehold_o_idxmon_maxmon_cntmake_attack_normalmake_attack_spellprocess_monstersroff_topscreen_roffdisplay_roffdelete_monster_idxdelete_monstercompact_monsterswipe_mon_listmon_popget_mon_num_prepget_mon_nummonster_desclore_do_probelore_treasureupdate_monupdate_monstersmonster_carrymonster_swapplayer_placemonster_placeplace_monster_auxplace_monsteralloc_monstersummon_specificmultiply_monstermessage_painupdate_smart_learnmonster_deathmon_take_hitRBM_HITRBM_TOUCHRBM_PUNCHRBM_KICKRBM_CLAWRBM_BITERBM_STINGRBM_XXX1RBM_BUTTRBM_CRUSHRBM_ENGULFRBM_XXX2RBM_CRAWLRBM_DROOLRBM_SPITRBM_XXX3RBM_GAZERBM_WAILRBM_SPORERBM_XXX4RBM_BEGRBM_INSULTRBM_MOANRBM_XXX5RBE_HURTRBE_POISONRBE_UN_BONUSRBE_UN_POWERRBE_EAT_GOLDRBE_EAT_ITEMRBE_EAT_FOODRBE_EAT_LITERBE_ACIDRBE_ELECRBE_FIRERBE_COLDRBE_BLINDRBE_CONFUSERBE_TERRIFYRBE_PARALYZERBE_LOSE_STRRBE_LOSE_INTRBE_LOSE_WISRBE_LOSE_DEXRBE_LOSE_CONRBE_LOSE_CHRRBE_LOSE_ALLRBE_SHATTERRBE_EXP_10RBE_EXP_20RBE_EXP_40RBE_EXP_80RBE_HALLUSM_OPP_ACIDSM_OPP_ELECSM_OPP_FIRESM_OPP_COLDSM_OPP_POISSM_OPP_XXX1SM_OPP_XXX2SM_OPP_XXX3SM_IMM_XXX5SM_IMM_XXX6SM_IMM_FREESM_IMM_MANASM_IMM_ACIDSM_IMM_ELECSM_IMM_FIRESM_IMM_COLDSM_RES_ACIDSM_RES_ELECSM_RES_FIRESM_RES_COLDSM_RES_POISSM_RES_FEARSM_RES_LITESM_RES_DARKSM_RES_BLINDSM_RES_CONFUSM_RES_SOUNDSM_RES_SHARDSM_RES_NEXUSSM_RES_NETHRSM_RES_CHAOSSM_RES_DISENMFLAG_VIEWMFLAG_NICEMFLAG_SHOWMFLAG_MARKRF1_UNIQUERF1_QUESTORRF1_MALERF1_FEMALERF1_CHAR_CLEARRF1_CHAR_MULTIRF1_ATTR_CLEARRF1_ATTR_MULTIRF1_FORCE_DEPTHRF1_FORCE_MAXHPRF1_FORCE_SLEEPRF1_FORCE_EXTRARF1_FRIENDRF1_FRIENDSRF1_ESCORTRF1_ESCORTSRF1_NEVER_BLOWRF1_NEVER_MOVERF1_RAND_25RF1_RAND_50RF1_ONLY_GOLDRF1_ONLY_ITEMRF1_DROP_60RF1_DROP_90RF1_DROP_1D2RF1_DROP_2D2RF1_DROP_3D2RF1_DROP_4D2RF1_DROP_GOODRF1_DROP_GREATRF1_DROP_USEFULRF1_DROP_CHOSENRF2_STUPIDRF2_SMARTRF2_XXX1RF2_XXX2RF2_INVISIBLERF2_COLD_BLOODRF2_EMPTY_MINDRF2_WEIRD_MINDRF2_MULTIPLYRF2_REGENERATERF2_XXX3RF2_XXX4RF2_POWERFULRF2_XXX5RF2_XXX7RF2_XXX6RF2_OPEN_DOORRF2_BASH_DOORRF2_PASS_WALLRF2_KILL_WALLRF2_MOVE_BODYRF2_KILL_BODYRF2_TAKE_ITEMRF2_KILL_ITEMRF2_BRAIN_1RF2_BRAIN_2RF2_BRAIN_3RF2_BRAIN_4RF2_BRAIN_5RF2_BRAIN_6RF2_BRAIN_7RF2_BRAIN_8RF3_ORCRF3_TROLLRF3_GIANTRF3_DRAGONRF3_DEMONRF3_UNDEADRF3_EVILRF3_ANIMALRF3_XXX1RF3_XXX2RF3_XXX3RF3_XXX4RF3_HURT_LITERF3_HURT_ROCKRF3_HURT_FIRERF3_HURT_COLDRF3_IM_ACIDRF3_IM_ELECRF3_IM_FIRERF3_IM_COLDRF3_IM_POISRF3_XXX5RF3_RES_NETHRF3_RES_WATERF3_RES_PLASRF3_RES_NEXURF3_RES_DISERF3_XXX6RF3_NO_FEARRF3_NO_STUNRF3_NO_CONFRF3_NO_SLEEPRF4_SHRIEKRF4_XXX2RF4_XXX3RF4_XXX4RF4_ARROW_1RF4_ARROW_2RF4_ARROW_3RF4_ARROW_4RF4_BR_ACIDRF4_BR_ELECRF4_BR_FIRERF4_BR_COLDRF4_BR_POISRF4_BR_NETHRF4_BR_LITERF4_BR_DARKRF4_BR_CONFRF4_BR_SOUNRF4_BR_CHAORF4_BR_DISERF4_BR_NEXURF4_BR_TIMERF4_BR_INERRF4_BR_GRAVRF4_BR_SHARRF4_BR_PLASRF4_BR_WALLRF4_BR_MANARF4_XXX5RF4_XXX6RF4_XXX7RF4_BOULDERRF5_BA_ACIDRF5_BA_ELECRF5_BA_FIRERF5_BA_COLDRF5_BA_POISRF5_BA_NETHRF5_BA_WATERF5_BA_MANARF5_BA_DARKRF5_DRAIN_MANARF5_MIND_BLASTRF5_BRAIN_SMASHRF5_CAUSE_1RF5_CAUSE_2RF5_CAUSE_3RF5_CAUSE_4RF5_BO_ACIDRF5_BO_ELECRF5_BO_FIRERF5_BO_COLDRF5_BO_POISRF5_BO_NETHRF5_BO_WATERF5_BO_MANARF5_BO_PLASRF5_BO_ICEERF5_MISSILERF5_SCARERF5_BLINDRF5_CONFRF5_SLOWRF5_HOLDRF6_HASTERF6_XXX1RF6_HEALRF6_XXX2RF6_BLINKRF6_TPORTRF6_XXX3RF6_XXX4RF6_TELE_TORF6_TELE_AWAYRF6_TELE_LEVELRF6_XXX5RF6_DARKNESSRF6_TRAPSRF6_FORGETRF6_XXX6RF6_S_KINRF6_S_HI_DEMONRF6_S_MONSTERRF6_S_MONSTERSRF6_S_ANIMALRF6_S_SPIDERRF6_S_HOUNDRF6_S_HYDRARF6_S_ANGELRF6_S_DEMONRF6_S_UNDEADRF6_S_DRAGONRF6_S_HI_UNDEADRF6_S_HI_DRAGONRF6_S_WRAITHRF6_S_UNIQUEmonster_blowmonster_racemonster_loremonster_typemon_maxmon_cntmake_attack_normalmake_attack_spellprocess_monstersroff_topscreen_roffdisplay_roffdelete_monster_idxdelete_monstercompact_monsterswipe_mon_listmon_popget_mon_num_prepget_mon_nummonster_desclore_do_probelore_treasureupdate_monupdate_monstersmonster_carrymonster_swapplayer_placemonster_placeplace_monster_auxplace_monsteralloc_monstersummon_specificmultiply_monstermessage_painupdate_smart_learnmonster_deathmon_take_hitflavor_typeartifact_typeego_item_typeobject_typeobject_kindinvalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.#vinvalid type in variable assignment.#vinvalid type in variable assignment.invalid type in array indexing.array indexing out of range.object_typeinvalid type in array indexing.array indexing out of range.invalid type in array indexing.array indexing out of range.object_kindinvalid type in array indexing.array indexing out of range.#vinvalid type in variable assignment.#vinvalid type in variable assignment.invalid type in array indexing.array indexing out of range.artifact_typeinvalid type in array indexing.array indexing out of range.#vinvalid type in variable assignment.#vinvalid type in variable assignment.invalid type in array indexing.array indexing out of range.ego_item_typeinvalid type in array indexing.array indexing out of range.#vinvalid type in variable assignment.#vinvalid type in variable assignment.invalid type in array indexing.array indexing out of range.flavor_typeinvalid type in array indexing.array indexing out of range.#vinvalid type in variable assignment.#vinvalid type in variable assignment.#ferror in function 'flavor_init'.bool#ferror in function 'reset_visuals'.const object_type#ferror in function 'identify_random_gen'.#ferror in function 'index_to_label'.#ferror in function 'label_to_inven'.#ferror in function 'label_to_equip'.const object_type#ferror in function 'wield_slot'.#ferror in function 'mention_use'.#ferror in function 'describe_use'.const object_type#ferror in function 'item_tester_okay'.#ferror in function 'scan_floor'.#ferror in function 'display_inven'.#ferror in function 'display_equip'.#ferror in function 'show_inven'.#ferror in function 'show_equip'.#ferror in function 'toggle_inven_equip'.#ferror in function 'get_item'.#ferror in function 'excise_object_idx'.#ferror in function 'delete_object_idx'.#ferror in function 'delete_object'.#ferror in function 'compact_objects'.#ferror in function 'wipe_o_list'.#ferror in function 'o_pop'.#ferror in function 'get_obj_num_prep'.#ferror in function 'get_obj_num'.object_type#ferror in function 'object_known'.object_type#ferror in function 'object_aware'.object_type#ferror in function 'object_tried'.const object_type#ferror in function 'is_blessed'.const object_type#ferror in function 'object_value'.const object_typeconst object_type#ferror in function 'object_similar'.object_typeconst object_type#ferror in function 'object_absorb'.#ferror in function 'lookup_kind'.object_type#ferror in function 'object_wipe'.object_typeconst object_type#ferror in function 'object_copy'.object_type#ferror in function 'object_prep'.object_typeboolboolbool#ferror in function 'apply_magic'.object_typeboolbool#ferror in function 'make_object'.object_type#ferror in function 'make_gold'.object_type#ferror in function 'floor_carry'.object_type#ferror in function 'drop_near'.bool#ferror in function 'acquirement'.boolbool#ferror in function 'place_object'.#ferror in function 'place_gold'.#ferror in function 'pick_trap'.#ferror in function 'place_trap'.#ferror in function 'place_secret_door'.#ferror in function 'place_closed_door'.#ferror in function 'place_random_door'.#ferror in function 'inven_item_charges'.#ferror in function 'inven_item_describe'.#ferror in function 'inven_item_increase'.#ferror in function 'inven_item_optimize'.#ferror in function 'floor_item_charges'.#ferror in function 'floor_item_describe'.#ferror in function 'floor_item_increase'.#ferror in function 'floor_item_optimize'.const object_type#ferror in function 'inven_carry_okay'.object_type#ferror in function 'inven_carry'.#ferror in function 'inven_takeoff'.#ferror in function 'inven_drop'.#ferror in function 'combine_pack'.#ferror in function 'reorder_pack'.const object_type#ferror in function 'object_aware_p'.const object_type#ferror in function 'object_tried_p'.const object_type#ferror in function 'object_known_p'.const object_type#ferror in function 'object_attr'.const object_type#ferror in function 'object_char'.const object_type#ferror in function 'artifact_p'.const object_type#ferror in function 'ego_item_p'.const object_type#ferror in function 'broken_p'.const object_type#ferror in function 'cursed_p'.const object_type#ferror in function 'object_info_out'.const object_type#ferror in function 'object_info_screen'.ART_POWERART_MORGOTHART_GRONDART_MIN_NORMALEGO_TVALS_MAXEGO_RESIST_ACIDEGO_RESIST_ELECEGO_RESIST_FIREEGO_RESIST_COLDEGO_RESISTANCEEGO_ELVENKINDEGO_ARMR_VULNEGO_PERMANENCEEGO_ARMR_DWARVENEGO_ENDURE_ACIDEGO_ENDURE_ELECEGO_ENDURE_FIREEGO_ENDURE_COLDEGO_ENDURANCEEGO_SHIELD_ELVENKINDEGO_SHIELD_PRESERVATIONEGO_SHIELD_VULNEGO_INTELLIGENCEEGO_WISDOMEGO_BEAUTYEGO_MAGIEGO_MIGHTEGO_LORDLINESSEGO_SEEINGEGO_INFRAVISIONEGO_LITEEGO_TELEPATHYEGO_REGENERATIONEGO_TELEPORTATIONEGO_STUPIDITYEGO_NAIVETYEGO_UGLINESSEGO_SICKLINESSEGO_PROTECTIONEGO_STEALTHEGO_AMANEGO_CLOAK_MAGIEGO_ENVELOPINGEGO_VULNERABILITYEGO_IRRITATIONEGO_FREE_ACTIONEGO_SLAYINGEGO_AGILITYEGO_POWEREGO_GLOVES_THIEVERYEGO_GAUNTLETS_COMBATEGO_WEAKNESSEGO_CLUMSINESSEGO_SLOW_DESCENTEGO_QUIETEGO_MOTIONEGO_SPEEDEGO_STABILITYEGO_NOISEEGO_SLOWNESSEGO_ANNOYANCEEGO_HAEGO_DFEGO_BLESS_BLADEEGO_GONDOLINEGO_WESTEGO_ATTACKSEGO_FURYEGO_BRAND_ACIDEGO_BRAND_ELECEGO_BRAND_FIREEGO_BRAND_COLDEGO_BRAND_POISEGO_SLAY_ANIMALEGO_SLAY_EVILEGO_SLAY_UNDEADEGO_SLAY_DEMONEGO_SLAY_ORCEGO_SLAY_TROLLEGO_SLAY_GIANTEGO_SLAY_DRAGONEGO_KILL_ANIMALEGO_KILL_EVILEGO_KILL_UNDEADEGO_KILL_DEMONEGO_KILL_ORCEGO_KILL_TROLLEGO_KILL_GIANTEGO_KILL_DRAGONEGO_DIGGINGEGO_DIGGER_EARTHQUAKEEGO_MORGULEGO_ACCURACYEGO_VELOCITYEGO_BOW_LORIENEGO_CROSSBOW_HARADEGO_EXTRA_MIGHTEGO_EXTRA_SHOTSEGO_SLING_BUCKLANDEGO_NAZGULEGO_HURT_ANIMALEGO_HURT_EVILEGO_HURT_UNDEADEGO_HURT_DEMONEGO_HURT_ORCEGO_HURT_TROLLEGO_HURT_GIANTEGO_HURT_DRAGONEGO_AMMO_HOLYEGO_AMMO_VENOMEGO_FLAMEEGO_FROSTEGO_WOUNDINGEGO_BACKBITINGEGO_SHATTEREDEGO_BLASTEDTV_SKELETONTV_BOTTLETV_JUNKTV_SPIKETV_CHESTTV_SHOTTV_ARROWTV_BOLTTV_BOWTV_DIGGINGTV_HAFTEDTV_POLEARMTV_SWORDTV_BOOTSTV_GLOVESTV_HELMTV_CROWNTV_SHIELDTV_CLOAKTV_SOFT_ARMORTV_HARD_ARMORTV_DRAG_ARMORTV_LITETV_AMULETTV_RINGTV_STAFFTV_WANDTV_RODTV_SCROLLTV_POTIONTV_FLASKTV_FOODTV_MAGIC_BOOKTV_PRAYER_BOOKTV_GOLDSV_AMMO_LIGHTSV_AMMO_NORMALSV_AMMO_HEAVYSV_AMMO_SILVERSV_SLINGSV_SHORT_BOWSV_LONG_BOWSV_LIGHT_XBOWSV_HEAVY_XBOWSV_SHOVELSV_GNOMISH_SHOVELSV_DWARVEN_SHOVELSV_PICKSV_ORCISH_PICKSV_DWARVEN_PICKSV_MATTOCKSV_WHIPSV_QUARTERSTAFFSV_MACESV_BALL_AND_CHAINSV_WAR_HAMMERSV_LUCERN_HAMMERSV_MORNING_STARSV_FLAILSV_LEAD_FILLED_MACESV_TWO_HANDED_FLAILSV_MACE_OF_DISRUPTIONSV_GRONDSV_SPEARSV_AWL_PIKESV_TRIDENTSV_PIKESV_BEAKED_AXESV_BROAD_AXESV_GLAIVESV_HALBERDSV_SCYTHESV_LANCESV_BATTLE_AXESV_GREAT_AXESV_LOCHABER_AXESV_SCYTHE_OF_SLICINGSV_BROKEN_DAGGERSV_BROKEN_SWORDSV_DAGGERSV_MAIN_GAUCHESV_RAPIERSV_SMALL_SWORDSV_SHORT_SWORDSV_SABRESV_CUTLASSSV_TULWARSV_BROAD_SWORDSV_LONG_SWORDSV_SCIMITARSV_KATANASV_BASTARD_SWORDSV_TWO_HANDED_SWORDSV_EXECUTIONERS_SWORDSV_BLADE_OF_CHAOSSV_SMALL_LEATHER_SHIELDSV_SMALL_METAL_SHIELDSV_LARGE_LEATHER_SHIELDSV_LARGE_METAL_SHIELDSV_SHIELD_OF_DEFLECTIONSV_HARD_LEATHER_CAPSV_METAL_CAPSV_IRON_HELMSV_STEEL_HELMSV_IRON_CROWNSV_GOLDEN_CROWNSV_JEWELED_CROWNSV_MORGOTHSV_PAIR_OF_SOFT_LEATHER_BOOTSSV_PAIR_OF_HARD_LEATHER_BOOTSSV_PAIR_OF_METAL_SHOD_BOOTSSV_CLOAKSV_SHADOW_CLOAKSV_SET_OF_LEATHER_GLOVESSV_SET_OF_GAUNTLETSSV_SET_OF_CESTISV_FILTHY_RAGSV_ROBESV_SOFT_LEATHER_ARMORSV_SOFT_STUDDED_LEATHERSV_HARD_LEATHER_ARMORSV_HARD_STUDDED_LEATHERSV_LEATHER_SCALE_MAILSV_RUSTY_CHAIN_MAILSV_METAL_SCALE_MAILSV_CHAIN_MAILSV_AUGMENTED_CHAIN_MAILSV_DOUBLE_CHAIN_MAILSV_BAR_CHAIN_MAILSV_METAL_BRIGANDINE_ARMOURSV_PARTIAL_PLATE_ARMOURSV_METAL_LAMELLAR_ARMOURSV_FULL_PLATE_ARMOURSV_RIBBED_PLATE_ARMOURSV_MITHRIL_CHAIN_MAILSV_MITHRIL_PLATE_MAILSV_ADAMANTITE_PLATE_MAILSV_DRAGON_BLACKSV_DRAGON_BLUESV_DRAGON_WHITESV_DRAGON_REDSV_DRAGON_GREENSV_DRAGON_MULTIHUEDSV_DRAGON_SHININGSV_DRAGON_LAWSV_DRAGON_BRONZESV_DRAGON_GOLDSV_DRAGON_CHAOSSV_DRAGON_BALANCESV_DRAGON_POWERSV_LITE_TORCHSV_LITE_LANTERNSV_LITE_GALADRIELSV_LITE_ELENDILSV_LITE_THRAINSV_LITE_PALANTIRSV_AMULET_DOOMSV_AMULET_TELEPORTSV_AMULET_ADORNMENTSV_AMULET_SLOW_DIGESTSV_AMULET_RESIST_ACIDSV_AMULET_SEARCHINGSV_AMULET_WISDOMSV_AMULET_CHARISMASV_AMULET_THE_MAGISV_AMULET_SUSTENANCESV_AMULET_CARLAMMASSV_AMULET_INGWESV_AMULET_DWARVESSV_AMULET_ESPSV_AMULET_RESISTSV_AMULET_REGENSV_AMULET_ELESSARSV_AMULET_EVENSTARSV_AMULET_DEVOTIONSV_AMULET_WEAPONMASTERYSV_AMULET_TRICKERYSV_AMULET_INFRAVISIONSV_AMULET_RESIST_LIGHTNINGSV_RING_WOESV_RING_AGGRAVATIONSV_RING_WEAKNESSSV_RING_STUPIDITYSV_RING_TELEPORTATIONSV_RING_SLOW_DIGESTIONSV_RING_FEATHER_FALLSV_RING_RESIST_FIRESV_RING_RESIST_COLDSV_RING_SUSTAIN_STRSV_RING_SUSTAIN_INTSV_RING_SUSTAIN_WISSV_RING_SUSTAIN_DEXSV_RING_SUSTAIN_CONSV_RING_SUSTAIN_CHRSV_RING_PROTECTIONSV_RING_ACIDSV_RING_FLAMESSV_RING_ICESV_RING_RESIST_POISSV_RING_FREE_ACTIONSV_RING_SEE_INVISSV_RING_SEARCHINGSV_RING_STRSV_RING_INTSV_RING_DEXSV_RING_CONSV_RING_ACCURACYSV_RING_DAMAGESV_RING_SLAYINGSV_RING_SPEEDSV_RING_BARAHIRSV_RING_TULKASSV_RING_NARYASV_RING_NENYASV_RING_VILYASV_RING_POWERSV_RING_LIGHTNINGSV_STAFF_DARKNESSSV_STAFF_SLOWNESSSV_STAFF_HASTE_MONSTERSSV_STAFF_SUMMONINGSV_STAFF_TELEPORTATIONSV_STAFF_IDENTIFYSV_STAFF_REMOVE_CURSESV_STAFF_STARLITESV_STAFF_LITESV_STAFF_MAPPINGSV_STAFF_DETECT_GOLDSV_STAFF_DETECT_ITEMSV_STAFF_DETECT_TRAPSV_STAFF_DETECT_DOORSV_STAFF_DETECT_INVISSV_STAFF_DETECT_EVILSV_STAFF_CURE_LIGHTSV_STAFF_CURINGSV_STAFF_HEALINGSV_STAFF_THE_MAGISV_STAFF_SLEEP_MONSTERSSV_STAFF_SLOW_MONSTERSSV_STAFF_SPEEDSV_STAFF_PROBINGSV_STAFF_DISPEL_EVILSV_STAFF_POWERSV_STAFF_HOLINESSSV_STAFF_BANISHMENTSV_STAFF_EARTHQUAKESSV_STAFF_DESTRUCTIONSV_WAND_HEAL_MONSTERSV_WAND_HASTE_MONSTERSV_WAND_CLONE_MONSTERSV_WAND_TELEPORT_AWAYSV_WAND_DISARMINGSV_WAND_TRAP_DOOR_DESTSV_WAND_STONE_TO_MUDSV_WAND_LITESV_WAND_SLEEP_MONSTERSV_WAND_SLOW_MONSTERSV_WAND_CONFUSE_MONSTERSV_WAND_FEAR_MONSTERSV_WAND_DRAIN_LIFESV_WAND_POLYMORPHSV_WAND_STINKING_CLOUDSV_WAND_MAGIC_MISSILESV_WAND_ACID_BOLTSV_WAND_ELEC_BOLTSV_WAND_FIRE_BOLTSV_WAND_COLD_BOLTSV_WAND_ACID_BALLSV_WAND_ELEC_BALLSV_WAND_FIRE_BALLSV_WAND_COLD_BALLSV_WAND_WONDERSV_WAND_ANNIHILATIONSV_WAND_DRAGON_FIRESV_WAND_DRAGON_COLDSV_WAND_DRAGON_BREATHSV_ROD_DETECT_TRAPSV_ROD_DETECT_DOORSV_ROD_IDENTIFYSV_ROD_RECALLSV_ROD_ILLUMINATIONSV_ROD_MAPPINGSV_ROD_DETECTIONSV_ROD_PROBINGSV_ROD_CURINGSV_ROD_HEALINGSV_ROD_RESTORATIONSV_ROD_SPEEDSV_ROD_TELEPORT_AWAYSV_ROD_DISARMINGSV_ROD_LITESV_ROD_SLEEP_MONSTERSV_ROD_SLOW_MONSTERSV_ROD_DRAIN_LIFESV_ROD_POLYMORPHSV_ROD_ACID_BOLTSV_ROD_ELEC_BOLTSV_ROD_FIRE_BOLTSV_ROD_COLD_BOLTSV_ROD_ACID_BALLSV_ROD_ELEC_BALLSV_ROD_FIRE_BALLSV_ROD_COLD_BALLSV_SCROLL_DARKNESSSV_SCROLL_AGGRAVATE_MONSTERSV_SCROLL_CURSE_ARMORSV_SCROLL_CURSE_WEAPONSV_SCROLL_SUMMON_MONSTERSV_SCROLL_SUMMON_UNDEADSV_SCROLL_TRAP_CREATIONSV_SCROLL_PHASE_DOORSV_SCROLL_TELEPORTSV_SCROLL_TELEPORT_LEVELSV_SCROLL_WORD_OF_RECALLSV_SCROLL_IDENTIFYSV_SCROLL_STAR_IDENTIFYSV_SCROLL_REMOVE_CURSESV_SCROLL_STAR_REMOVE_CURSESV_SCROLL_ENCHANT_ARMORSV_SCROLL_ENCHANT_WEAPON_TO_HITSV_SCROLL_ENCHANT_WEAPON_TO_DAMSV_SCROLL_STAR_ENCHANT_ARMORSV_SCROLL_STAR_ENCHANT_WEAPONSV_SCROLL_RECHARGINGSV_SCROLL_LIGHTSV_SCROLL_MAPPINGSV_SCROLL_DETECT_GOLDSV_SCROLL_DETECT_ITEMSV_SCROLL_DETECT_TRAPSV_SCROLL_DETECT_DOORSV_SCROLL_DETECT_INVISSV_SCROLL_SATISFY_HUNGERSV_SCROLL_BLESSINGSV_SCROLL_HOLY_CHANTSV_SCROLL_HOLY_PRAYERSV_SCROLL_MONSTER_CONFUSIONSV_SCROLL_PROTECTION_FROM_EVILSV_SCROLL_RUNE_OF_PROTECTIONSV_SCROLL_TRAP_DOOR_DESTRUCTIONSV_SCROLL_STAR_DESTRUCTIONSV_SCROLL_DISPEL_UNDEADSV_SCROLL_BANISHMENTSV_SCROLL_MASS_BANISHMENTSV_SCROLL_ACQUIREMENTSV_SCROLL_STAR_ACQUIREMENTSV_POTION_WATERSV_POTION_APPLE_JUICESV_POTION_SLIME_MOLDSV_POTION_SLOWNESSSV_POTION_SALT_WATERSV_POTION_POISONSV_POTION_BLINDNESSSV_POTION_CONFUSIONSV_POTION_SLEEPSV_POTION_LOSE_MEMORIESSV_POTION_RUINATIONSV_POTION_DEC_STRSV_POTION_DEC_INTSV_POTION_DEC_WISSV_POTION_DEC_DEXSV_POTION_DEC_CONSV_POTION_DEC_CHRSV_POTION_DETONATIONSSV_POTION_DEATHSV_POTION_INFRAVISIONSV_POTION_DETECT_INVISSV_POTION_SLOW_POISONSV_POTION_CURE_POISONSV_POTION_BOLDNESSSV_POTION_SPEEDSV_POTION_RESIST_HEATSV_POTION_RESIST_COLDSV_POTION_HEROISMSV_POTION_BERSERK_STRENGTHSV_POTION_CURE_LIGHTSV_POTION_CURE_SERIOUSSV_POTION_CURE_CRITICALSV_POTION_HEALINGSV_POTION_STAR_HEALINGSV_POTION_LIFESV_POTION_RESTORE_MANASV_POTION_RESTORE_EXPSV_POTION_RES_STRSV_POTION_RES_INTSV_POTION_RES_WISSV_POTION_RES_DEXSV_POTION_RES_CONSV_POTION_RES_CHRSV_POTION_INC_STRSV_POTION_INC_INTSV_POTION_INC_WISSV_POTION_INC_DEXSV_POTION_INC_CONSV_POTION_INC_CHRSV_POTION_AUGMENTATIONSV_POTION_ENLIGHTENMENTSV_POTION_STAR_ENLIGHTENMENTSV_POTION_SELF_KNOWLEDGESV_POTION_EXPERIENCESV_FOOD_POISONSV_FOOD_BLINDNESSSV_FOOD_PARANOIASV_FOOD_CONFUSIONSV_FOOD_HALLUCINATIONSV_FOOD_PARALYSISSV_FOOD_WEAKNESSSV_FOOD_SICKNESSSV_FOOD_STUPIDITYSV_FOOD_NAIVETYSV_FOOD_UNHEALTHSV_FOOD_DISEASESV_FOOD_CURE_POISONSV_FOOD_CURE_BLINDNESSSV_FOOD_CURE_PARANOIASV_FOOD_CURE_CONFUSIONSV_FOOD_CURE_SERIOUSSV_FOOD_RESTORE_STRSV_FOOD_RESTORE_CONSV_FOOD_RESTORINGSV_FOOD_BISCUITSV_FOOD_JERKYSV_FOOD_RATIONSV_FOOD_SLIME_MOLDSV_FOOD_WAYBREADSV_FOOD_PINT_OF_ALESV_FOOD_PINT_OF_WINESV_FOOD_MIN_FOODSV_ROD_MIN_DIRECTIONSV_CHEST_MIN_LARGESV_BOOK_MIN_GOODCHEST_LOSE_STRCHEST_LOSE_CONCHEST_POISONCHEST_PARALYZECHEST_EXPLODECHEST_SUMMONIDENT_SENSEIDENT_FIXEDIDENT_EMPTYIDENT_KNOWNIDENT_STOREIDENT_MENTALIDENT_CURSEDIDENT_BROKENINSCRIP_NULLINSCRIP_TERRIBLEINSCRIP_WORTHLESSINSCRIP_CURSEDINSCRIP_BROKENINSCRIP_AVERAGEINSCRIP_GOODINSCRIP_EXCELLENTINSCRIP_SPECIALINSCRIP_UNCURSEDINSCRIP_INDESTRUCTIBLEMAX_INSCRIPTR1_STRTR1_INTTR1_WISTR1_DEXTR1_CONTR1_CHRTR1_XXX1TR1_XXX2TR1_STEALTHTR1_SEARCHTR1_INFRATR1_TUNNELTR1_SPEEDTR1_BLOWSTR1_SHOTSTR1_MIGHTTR1_SLAY_ANIMALTR1_SLAY_EVILTR1_SLAY_UNDEADTR1_SLAY_DEMONTR1_SLAY_ORCTR1_SLAY_TROLLTR1_SLAY_GIANTTR1_SLAY_DRAGONTR1_KILL_DRAGONTR1_KILL_DEMONTR1_KILL_UNDEADTR1_BRAND_POISTR1_BRAND_ACIDTR1_BRAND_ELECTR1_BRAND_FIRETR1_BRAND_COLDTR2_SUST_STRTR2_SUST_INTTR2_SUST_WISTR2_SUST_DEXTR2_SUST_CONTR2_SUST_CHRTR2_XXX1TR2_XXX2TR2_XXX3TR2_XXX4TR2_XXX5TR2_XXX6TR2_IM_ACIDTR2_IM_ELECTR2_IM_FIRETR2_IM_COLDTR2_RES_ACIDTR2_RES_ELECTR2_RES_FIRETR2_RES_COLDTR2_RES_POISTR2_RES_FEARTR2_RES_LITETR2_RES_DARKTR2_RES_BLINDTR2_RES_CONFUTR2_RES_SOUNDTR2_RES_SHARDTR2_RES_NEXUSTR2_RES_NETHRTR2_RES_CHAOSTR2_RES_DISENTR3_SLOW_DIGESTTR3_FEATHERTR3_LITETR3_REGENTR3_TELEPATHYTR3_SEE_INVISTR3_FREE_ACTTR3_HOLD_LIFETR3_XXX1TR3_XXX2TR3_XXX3TR3_XXX4TR3_IMPACTTR3_TELEPORTTR3_AGGRAVATETR3_DRAIN_EXPTR3_IGNORE_ACIDTR3_IGNORE_ELECTR3_IGNORE_FIRETR3_IGNORE_COLDTR3_XXX5TR3_XXX6TR3_BLESSEDTR3_ACTIVATETR3_INSTA_ARTTR3_EASY_KNOWTR3_HIDE_TYPETR3_SHOW_MODSTR3_XXX7TR3_LIGHT_CURSETR3_HEAVY_CURSETR3_PERMA_CURSEOBJECT_XTRA_TYPE_SUSTAINOBJECT_XTRA_TYPE_RESISTOBJECT_XTRA_TYPE_POWEROBJECT_XTRA_WHAT_SUSTAINOBJECT_XTRA_WHAT_RESISTOBJECT_XTRA_WHAT_POWEROBJECT_XTRA_BASE_SUSTAINOBJECT_XTRA_BASE_RESISTOBJECT_XTRA_BASE_POWEROBJECT_XTRA_SIZE_SUSTAINOBJECT_XTRA_SIZE_RESISTOBJECT_XTRA_SIZE_POWERACT_ILLUMINATIONACT_MAGIC_MAPACT_CLAIRVOYANCEACT_PROT_EVILACT_DISP_EVILACT_HEAL1ACT_HEAL2ACT_CURE_WOUNDSACT_HASTE1ACT_HASTE2ACT_FIRE1ACT_FIRE2ACT_FIRE3ACT_FROST1ACT_FROST2ACT_FROST3ACT_FROST4ACT_FROST5ACT_ACID1ACT_RECHARGE1ACT_SLEEPACT_LIGHTNING_BOLTACT_ELEC2ACT_BANISHMENTACT_MASS_BANISHMENTACT_IDENTIFYACT_DRAIN_LIFE1ACT_DRAIN_LIFE2ACT_BIZZAREACT_STAR_BALLACT_RAGE_BLESS_RESISTACT_PHASEACT_TRAP_DOOR_DESTACT_DETECTACT_RESISTACT_TELEPORTACT_RESTORE_LIFEACT_MISSILEACT_ARROWACT_REM_FEAR_POISACT_STINKING_CLOUDACT_STONE_TO_MUDACT_TELE_AWAYACT_WORACT_CONFUSEACT_PROBEACT_FIREBRANDACT_STARLIGHTACT_MANA_BOLTACT_BERSERKERACT_MAXobject_typeobject_typek_idxobject_typeiyobject_typeixobject_typetvalobject_typesvalobject_typepvalobject_typediscountobject_typenumberobject_typeweightobject_typename1object_typename2object_typextra1object_typextra2object_typeto_hobject_typeto_dobject_typeto_aobject_typeacobject_typeddobject_typedsobject_typetimeoutobject_typeidentobject_typemarkedobject_typenoteobject_typenext_o_idxobject_typeheld_m_idxobject_kindobject_kindnameobject_kindtextobject_kindtvalobject_kindsvalobject_kindpvalobject_kindto_hobject_kindto_dobject_kindto_aobject_kindacobject_kindddobject_kinddsobject_kindweightobject_kindcostobject_kindflags1object_kindflags2object_kindflags3object_kindlocaleobject_kindchanceobject_kindlevelobject_kindextraobject_kindd_attrobject_kindd_charobject_kindx_attrobject_kindx_charobject_kindflavorobject_kindawareobject_kindtriedartifact_typeartifact_typenameartifact_typetextartifact_typetvalartifact_typesvalartifact_typepvalartifact_typeto_hartifact_typeto_dartifact_typeto_aartifact_typeacartifact_typeddartifact_typedsartifact_typeweightartifact_typecostartifact_typeflags1artifact_typeflags2artifact_typeflags3artifact_typelevelartifact_typerarityartifact_typecur_numartifact_typemax_numartifact_typeactivationartifact_typetimeartifact_typerandtimeego_item_typeego_item_typenameego_item_typetextego_item_typecostego_item_typeflags1ego_item_typeflags2ego_item_typeflags3ego_item_typelevelego_item_typerarityego_item_typeratingego_item_typetvalego_item_typemin_svalego_item_typemax_svalego_item_typemax_to_hego_item_typemax_to_dego_item_typemax_to_aego_item_typemax_pvalego_item_typextraflavor_typeflavor_typetextflavor_typetvalflavor_typesvalflavor_typed_attrflavor_typed_charflavor_typex_attrflavor_typex_charo_maxo_cnto_listk_infok_namek_texta_infoa_namea_texte_infoe_namee_textflavor_infoflavor_nameflavor_textflavor_initreset_visualsidentify_random_genindex_to_labellabel_to_invenlabel_to_equipwield_slotmention_usedescribe_useitem_tester_okayscan_floordisplay_invendisplay_equipshow_invenshow_equiptoggle_inven_equipget_itemexcise_object_idxdelete_object_idxdelete_objectcompact_objectswipe_o_listo_popget_obj_num_prepget_obj_numobject_knownobject_awareobject_triedis_blessedobject_valueobject_similarobject_absorblookup_kindobject_wipeobject_copyobject_prepapply_magicmake_objectmake_goldfloor_carrydrop_nearacquirementplace_objectplace_goldpick_trapplace_trapplace_secret_doorplace_closed_doorplace_random_doorinven_item_chargesinven_item_describeinven_item_increaseinven_item_optimizefloor_item_chargesfloor_item_describefloor_item_increasefloor_item_optimizeinven_carry_okayinven_carryinven_takeoffinven_dropcombine_packreorder_packobject_aware_pobject_tried_pobject_known_pobject_attrobject_charartifact_pego_item_pbroken_pcursed_pobject_info_outobject_info_screenART_POWERART_MORGOTHART_GRONDART_MIN_NORMALEGO_TVALS_MAXEGO_RESIST_ACIDEGO_RESIST_ELECEGO_RESIST_FIREEGO_RESIST_COLDEGO_RESISTANCEEGO_ELVENKINDEGO_ARMR_VULNEGO_PERMANENCEEGO_ARMR_DWARVENEGO_ENDURE_ACIDEGO_ENDURE_ELECEGO_ENDURE_FIREEGO_ENDURE_COLDEGO_ENDURANCEEGO_SHIELD_ELVENKINDEGO_SHIELD_PRESERVATIONEGO_SHIELD_VULNEGO_INTELLIGENCEEGO_WISDOMEGO_BEAUTYEGO_MAGIEGO_MIGHTEGO_LORDLINESSEGO_SEEINGEGO_INFRAVISIONEGO_LITEEGO_TELEPATHYEGO_REGENERATIONEGO_TELEPORTATIONEGO_STUPIDITYEGO_NAIVETYEGO_UGLINESSEGO_SICKLINESSEGO_PROTECTIONEGO_STEALTHEGO_AMANEGO_CLOAK_MAGIEGO_ENVELOPINGEGO_VULNERABILITYEGO_IRRITATIONEGO_FREE_ACTIONEGO_SLAYINGEGO_AGILITYEGO_POWEREGO_GLOVES_THIEVERYEGO_GAUNTLETS_COMBATEGO_WEAKNESSEGO_CLUMSINESSEGO_SLOW_DESCENTEGO_QUIETEGO_MOTIONEGO_SPEEDEGO_STABILITYEGO_NOISEEGO_SLOWNESSEGO_ANNOYANCEEGO_HAEGO_DFEGO_BLESS_BLADEEGO_GONDOLINEGO_WESTEGO_ATTACKSEGO_FURYEGO_BRAND_ACIDEGO_BRAND_ELECEGO_BRAND_FIREEGO_BRAND_COLDEGO_BRAND_POISEGO_SLAY_ANIMALEGO_SLAY_EVILEGO_SLAY_UNDEADEGO_SLAY_DEMONEGO_SLAY_ORCEGO_SLAY_TROLLEGO_SLAY_GIANTEGO_SLAY_DRAGONEGO_KILL_ANIMALEGO_KILL_EVILEGO_KILL_UNDEADEGO_KILL_DEMONEGO_KILL_ORCEGO_KILL_TROLLEGO_KILL_GIANTEGO_KILL_DRAGONEGO_DIGGINGEGO_DIGGER_EARTHQUAKEEGO_MORGULEGO_ACCURACYEGO_VELOCITYEGO_BOW_LORIENEGO_CROSSBOW_HARADEGO_EXTRA_MIGHTEGO_EXTRA_SHOTSEGO_SLING_BUCKLANDEGO_NAZGULEGO_HURT_ANIMALEGO_HURT_EVILEGO_HURT_UNDEADEGO_HURT_DEMONEGO_HURT_ORCEGO_HURT_TROLLEGO_HURT_GIANTEGO_HURT_DRAGONEGO_AMMO_HOLYEGO_AMMO_VENOMEGO_FLAMEEGO_FROSTEGO_WOUNDINGEGO_BACKBITINGEGO_SHATTEREDEGO_BLASTEDTV_SKELETONTV_BOTTLETV_JUNKTV_SPIKETV_CHESTTV_SHOTTV_ARROWTV_BOLTTV_BOWTV_DIGGINGTV_HAFTEDTV_POLEARMTV_SWORDTV_BOOTSTV_GLOVESTV_HELMTV_CROWNTV_SHIELDTV_CLOAKTV_SOFT_ARMORTV_HARD_ARMORTV_DRAG_ARMORTV_LITETV_AMULETTV_RINGTV_STAFFTV_WANDTV_RODTV_SCROLLTV_POTIONTV_FLASKTV_FOODTV_MAGIC_BOOKTV_PRAYER_BOOKTV_GOLDSV_AMMO_LIGHTSV_AMMO_NORMALSV_AMMO_HEAVYSV_AMMO_SILVERSV_SLINGSV_SHORT_BOWSV_LONG_BOWSV_LIGHT_XBOWSV_HEAVY_XBOWSV_SHOVELSV_GNOMISH_SHOVELSV_DWARVEN_SHOVELSV_PICKSV_ORCISH_PICKSV_DWARVEN_PICKSV_MATTOCKSV_WHIPSV_QUARTERSTAFFSV_MACESV_BALL_AND_CHAINSV_WAR_HAMMERSV_LUCERN_HAMMERSV_MORNING_STARSV_FLAILSV_LEAD_FILLED_MACESV_TWO_HANDED_FLAILSV_MACE_OF_DISRUPTIONSV_GRONDSV_SPEARSV_AWL_PIKESV_TRIDENTSV_PIKESV_BEAKED_AXESV_BROAD_AXESV_GLAIVESV_HALBERDSV_SCYTHESV_LANCESV_BATTLE_AXESV_GREAT_AXESV_LOCHABER_AXESV_SCYTHE_OF_SLICINGSV_BROKEN_DAGGERSV_BROKEN_SWORDSV_DAGGERSV_MAIN_GAUCHESV_RAPIERSV_SMALL_SWORDSV_SHORT_SWORDSV_SABRESV_CUTLASSSV_TULWARSV_BROAD_SWORDSV_LONG_SWORDSV_SCIMITARSV_KATANASV_BASTARD_SWORDSV_TWO_HANDED_SWORDSV_EXECUTIONERS_SWORDSV_BLADE_OF_CHAOSSV_SMALL_LEATHER_SHIELDSV_SMALL_METAL_SHIELDSV_LARGE_LEATHER_SHIELDSV_LARGE_METAL_SHIELDSV_SHIELD_OF_DEFLECTIONSV_HARD_LEATHER_CAPSV_METAL_CAPSV_IRON_HELMSV_STEEL_HELMSV_IRON_CROWNSV_GOLDEN_CROWNSV_JEWELED_CROWNSV_MORGOTHSV_PAIR_OF_SOFT_LEATHER_BOOTSSV_PAIR_OF_HARD_LEATHER_BOOTSSV_PAIR_OF_METAL_SHOD_BOOTSSV_CLOAKSV_SHADOW_CLOAKSV_SET_OF_LEATHER_GLOVESSV_SET_OF_GAUNTLETSSV_SET_OF_CESTISV_FILTHY_RAGSV_ROBESV_SOFT_LEATHER_ARMORSV_SOFT_STUDDED_LEATHERSV_HARD_LEATHER_ARMORSV_HARD_STUDDED_LEATHERSV_LEATHER_SCALE_MAILSV_RUSTY_CHAIN_MAILSV_METAL_SCALE_MAILSV_CHAIN_MAILSV_AUGMENTED_CHAIN_MAILSV_DOUBLE_CHAIN_MAILSV_BAR_CHAIN_MAILSV_METAL_BRIGANDINE_ARMOURSV_PARTIAL_PLATE_ARMOURSV_METAL_LAMELLAR_ARMOURSV_FULL_PLATE_ARMOURSV_RIBBED_PLATE_ARMOURSV_MITHRIL_CHAIN_MAILSV_MITHRIL_PLATE_MAILSV_ADAMANTITE_PLATE_MAILSV_DRAGON_BLACKSV_DRAGON_BLUESV_DRAGON_WHITESV_DRAGON_REDSV_DRAGON_GREENSV_DRAGON_MULTIHUEDSV_DRAGON_SHININGSV_DRAGON_LAWSV_DRAGON_BRONZESV_DRAGON_GOLDSV_DRAGON_CHAOSSV_DRAGON_BALANCESV_DRAGON_POWERSV_LITE_TORCHSV_LITE_LANTERNSV_LITE_GALADRIELSV_LITE_ELENDILSV_LITE_THRAINSV_LITE_PALANTIRSV_AMULET_DOOMSV_AMULET_TELEPORTSV_AMULET_ADORNMENTSV_AMULET_SLOW_DIGESTSV_AMULET_RESIST_ACIDSV_AMULET_SEARCHINGSV_AMULET_WISDOMSV_AMULET_CHARISMASV_AMULET_THE_MAGISV_AMULET_SUSTENANCESV_AMULET_CARLAMMASSV_AMULET_INGWESV_AMULET_DWARVESSV_AMULET_ESPSV_AMULET_RESISTSV_AMULET_REGENSV_AMULET_ELESSARSV_AMULET_EVENSTARSV_AMULET_DEVOTIONSV_AMULET_WEAPONMASTERYSV_AMULET_TRICKERYSV_AMULET_INFRAVISIONSV_AMULET_RESIST_LIGHTNINGSV_RING_WOESV_RING_AGGRAVATIONSV_RING_WEAKNESSSV_RING_STUPIDITYSV_RING_TELEPORTATIONSV_RING_SLOW_DIGESTIONSV_RING_FEATHER_FALLSV_RING_RESIST_FIRESV_RING_RESIST_COLDSV_RING_SUSTAIN_STRSV_RING_SUSTAIN_INTSV_RING_SUSTAIN_WISSV_RING_SUSTAIN_DEXSV_RING_SUSTAIN_CONSV_RING_SUSTAIN_CHRSV_RING_PROTECTIONSV_RING_ACIDSV_RING_FLAMESSV_RING_ICESV_RING_RESIST_POISSV_RING_FREE_ACTIONSV_RING_SEE_INVISSV_RING_SEARCHINGSV_RING_STRSV_RING_INTSV_RING_DEXSV_RING_CONSV_RING_ACCURACYSV_RING_DAMAGESV_RING_SLAYINGSV_RING_SPEEDSV_RING_BARAHIRSV_RING_TULKASSV_RING_NARYASV_RING_NENYASV_RING_VILYASV_RING_POWERSV_RING_LIGHTNINGSV_STAFF_DARKNESSSV_STAFF_SLOWNESSSV_STAFF_HASTE_MONSTERSSV_STAFF_SUMMONINGSV_STAFF_TELEPORTATIONSV_STAFF_IDENTIFYSV_STAFF_REMOVE_CURSESV_STAFF_STARLITESV_STAFF_LITESV_STAFF_MAPPINGSV_STAFF_DETECT_GOLDSV_STAFF_DETECT_ITEMSV_STAFF_DETECT_TRAPSV_STAFF_DETECT_DOORSV_STAFF_DETECT_INVISSV_STAFF_DETECT_EVILSV_STAFF_CURE_LIGHTSV_STAFF_CURINGSV_STAFF_HEALINGSV_STAFF_THE_MAGISV_STAFF_SLEEP_MONSTERSSV_STAFF_SLOW_MONSTERSSV_STAFF_SPEEDSV_STAFF_PROBINGSV_STAFF_DISPEL_EVILSV_STAFF_POWERSV_STAFF_HOLINESSSV_STAFF_BANISHMENTSV_STAFF_EARTHQUAKESSV_STAFF_DESTRUCTIONSV_WAND_HEAL_MONSTERSV_WAND_HASTE_MONSTERSV_WAND_CLONE_MONSTERSV_WAND_TELEPORT_AWAYSV_WAND_DISARMINGSV_WAND_TRAP_DOOR_DESTSV_WAND_STONE_TO_MUDSV_WAND_LITESV_WAND_SLEEP_MONSTERSV_WAND_SLOW_MONSTERSV_WAND_CONFUSE_MONSTERSV_WAND_FEAR_MONSTERSV_WAND_DRAIN_LIFESV_WAND_POLYMORPHSV_WAND_STINKING_CLOUDSV_WAND_MAGIC_MISSILESV_WAND_ACID_BOLTSV_WAND_ELEC_BOLTSV_WAND_FIRE_BOLTSV_WAND_COLD_BOLTSV_WAND_ACID_BALLSV_WAND_ELEC_BALLSV_WAND_FIRE_BALLSV_WAND_COLD_BALLSV_WAND_WONDERSV_WAND_ANNIHILATIONSV_WAND_DRAGON_FIRESV_WAND_DRAGON_COLDSV_WAND_DRAGON_BREATHSV_ROD_DETECT_TRAPSV_ROD_DETECT_DOORSV_ROD_IDENTIFYSV_ROD_RECALLSV_ROD_ILLUMINATIONSV_ROD_MAPPINGSV_ROD_DETECTIONSV_ROD_PROBINGSV_ROD_CURINGSV_ROD_HEALINGSV_ROD_RESTORATIONSV_ROD_SPEEDSV_ROD_TELEPORT_AWAYSV_ROD_DISARMINGSV_ROD_LITESV_ROD_SLEEP_MONSTERSV_ROD_SLOW_MONSTERSV_ROD_DRAIN_LIFESV_ROD_POLYMORPHSV_ROD_ACID_BOLTSV_ROD_ELEC_BOLTSV_ROD_FIRE_BOLTSV_ROD_COLD_BOLTSV_ROD_ACID_BALLSV_ROD_ELEC_BALLSV_ROD_FIRE_BALLSV_ROD_COLD_BALLSV_SCROLL_DARKNESSSV_SCROLL_AGGRAVATE_MONSTERSV_SCROLL_CURSE_ARMORSV_SCROLL_CURSE_WEAPONSV_SCROLL_SUMMON_MONSTERSV_SCROLL_SUMMON_UNDEADSV_SCROLL_TRAP_CREATIONSV_SCROLL_PHASE_DOORSV_SCROLL_TELEPORTSV_SCROLL_TELEPORT_LEVELSV_SCROLL_WORD_OF_RECALLSV_SCROLL_IDENTIFYSV_SCROLL_STAR_IDENTIFYSV_SCROLL_REMOVE_CURSESV_SCROLL_STAR_REMOVE_CURSESV_SCROLL_ENCHANT_ARMORSV_SCROLL_ENCHANT_WEAPON_TO_HITSV_SCROLL_ENCHANT_WEAPON_TO_DAMSV_SCROLL_STAR_ENCHANT_ARMORSV_SCROLL_STAR_ENCHANT_WEAPONSV_SCROLL_RECHARGINGSV_SCROLL_LIGHTSV_SCROLL_MAPPINGSV_SCROLL_DETECT_GOLDSV_SCROLL_DETECT_ITEMSV_SCROLL_DETECT_TRAPSV_SCROLL_DETECT_DOORSV_SCROLL_DETECT_INVISSV_SCROLL_SATISFY_HUNGERSV_SCROLL_BLESSINGSV_SCROLL_HOLY_CHANTSV_SCROLL_HOLY_PRAYERSV_SCROLL_MONSTER_CONFUSIONSV_SCROLL_PROTECTION_FROM_EVILSV_SCROLL_RUNE_OF_PROTECTIONSV_SCROLL_TRAP_DOOR_DESTRUCTIONSV_SCROLL_STAR_DESTRUCTIONSV_SCROLL_DISPEL_UNDEADSV_SCROLL_BANISHMENTSV_SCROLL_MASS_BANISHMENTSV_SCROLL_ACQUIREMENTSV_SCROLL_STAR_ACQUIREMENTSV_POTION_WATERSV_POTION_APPLE_JUICESV_POTION_SLIME_MOLDSV_POTION_SLOWNESSSV_POTION_SALT_WATERSV_POTION_POISONSV_POTION_BLINDNESSSV_POTION_CONFUSIONSV_POTION_SLEEPSV_POTION_LOSE_MEMORIESSV_POTION_RUINATIONSV_POTION_DEC_STRSV_POTION_DEC_INTSV_POTION_DEC_WISSV_POTION_DEC_DEXSV_POTION_DEC_CONSV_POTION_DEC_CHRSV_POTION_DETONATIONSSV_POTION_DEATHSV_POTION_INFRAVISIONSV_POTION_DETECT_INVISSV_POTION_SLOW_POISONSV_POTION_CURE_POISONSV_POTION_BOLDNESSSV_POTION_SPEEDSV_POTION_RESIST_HEATSV_POTION_RESIST_COLDSV_POTION_HEROISMSV_POTION_BERSERK_STRENGTHSV_POTION_CURE_LIGHTSV_POTION_CURE_SERIOUSSV_POTION_CURE_CRITICALSV_POTION_HEALINGSV_POTION_STAR_HEALINGSV_POTION_LIFESV_POTION_RESTORE_MANASV_POTION_RESTORE_EXPSV_POTION_RES_STRSV_POTION_RES_INTSV_POTION_RES_WISSV_POTION_RES_DEXSV_POTION_RES_CONSV_POTION_RES_CHRSV_POTION_INC_STRSV_POTION_INC_INTSV_POTION_INC_WISSV_POTION_INC_DEXSV_POTION_INC_CONSV_POTION_INC_CHRSV_POTION_AUGMENTATIONSV_POTION_ENLIGHTENMENTSV_POTION_STAR_ENLIGHTENMENTSV_POTION_SELF_KNOWLEDGESV_POTION_EXPERIENCESV_FOOD_POISONSV_FOOD_BLINDNESSSV_FOOD_PARANOIASV_FOOD_CONFUSIONSV_FOOD_HALLUCINATIONSV_FOOD_PARALYSISSV_FOOD_WEAKNESSSV_FOOD_SICKNESSSV_FOOD_STUPIDITYSV_FOOD_NAIVETYSV_FOOD_UNHEALTHSV_FOOD_DISEASESV_FOOD_CURE_POISONSV_FOOD_CURE_BLINDNESSSV_FOOD_CURE_PARANOIASV_FOOD_CURE_CONFUSIONSV_FOOD_CURE_SERIOUSSV_FOOD_RESTORE_STRSV_FOOD_RESTORE_CONSV_FOOD_RESTORINGSV_FOOD_BISCUITSV_FOOD_JERKYSV_FOOD_RATIONSV_FOOD_SLIME_MOLDSV_FOOD_WAYBREADSV_FOOD_PINT_OF_ALESV_FOOD_PINT_OF_WINESV_FOOD_MIN_FOODSV_ROD_MIN_DIRECTIONSV_CHEST_MIN_LARGESV_BOOK_MIN_GOODCHEST_LOSE_STRCHEST_LOSE_CONCHEST_POISONCHEST_PARALYZECHEST_EXPLODECHEST_SUMMONIDENT_SENSEIDENT_FIXEDIDENT_EMPTYIDENT_KNOWNIDENT_STOREIDENT_MENTALIDENT_CURSEDIDENT_BROKENINSCRIP_NULLINSCRIP_TERRIBLEINSCRIP_WORTHLESSINSCRIP_CURSEDINSCRIP_BROKENINSCRIP_AVERAGEINSCRIP_GOODINSCRIP_EXCELLENTINSCRIP_SPECIALINSCRIP_UNCURSEDINSCRIP_INDESTRUCTIBLEMAX_INSCRIPTR1_STRTR1_INTTR1_WISTR1_DEXTR1_CONTR1_CHRTR1_XXX1TR1_XXX2TR1_STEALTHTR1_SEARCHTR1_INFRATR1_TUNNELTR1_SPEEDTR1_BLOWSTR1_SHOTSTR1_MIGHTTR1_SLAY_ANIMALTR1_SLAY_EVILTR1_SLAY_UNDEADTR1_SLAY_DEMONTR1_SLAY_ORCTR1_SLAY_TROLLTR1_SLAY_GIANTTR1_SLAY_DRAGONTR1_KILL_DRAGONTR1_KILL_DEMONTR1_KILL_UNDEADTR1_BRAND_POISTR1_BRAND_ACIDTR1_BRAND_ELECTR1_BRAND_FIRETR1_BRAND_COLDTR2_SUST_STRTR2_SUST_INTTR2_SUST_WISTR2_SUST_DEXTR2_SUST_CONTR2_SUST_CHRTR2_XXX1TR2_XXX2TR2_XXX3TR2_XXX4TR2_XXX5TR2_XXX6TR2_IM_ACIDTR2_IM_ELECTR2_IM_FIRETR2_IM_COLDTR2_RES_ACIDTR2_RES_ELECTR2_RES_FIRETR2_RES_COLDTR2_RES_POISTR2_RES_FEARTR2_RES_LITETR2_RES_DARKTR2_RES_BLINDTR2_RES_CONFUTR2_RES_SOUNDTR2_RES_SHARDTR2_RES_NEXUSTR2_RES_NETHRTR2_RES_CHAOSTR2_RES_DISENTR3_SLOW_DIGESTTR3_FEATHERTR3_LITETR3_REGENTR3_TELEPATHYTR3_SEE_INVISTR3_FREE_ACTTR3_HOLD_LIFETR3_XXX1TR3_XXX2TR3_XXX3TR3_XXX4TR3_IMPACTTR3_TELEPORTTR3_AGGRAVATETR3_DRAIN_EXPTR3_IGNORE_ACIDTR3_IGNORE_ELECTR3_IGNORE_FIRETR3_IGNORE_COLDTR3_XXX5TR3_XXX6TR3_BLESSEDTR3_ACTIVATETR3_INSTA_ARTTR3_EASY_KNOWTR3_HIDE_TYPETR3_SHOW_MODSTR3_XXX7TR3_LIGHT_CURSETR3_HEAVY_CURSETR3_PERMA_CURSEOBJECT_XTRA_TYPE_SUSTAINOBJECT_XTRA_TYPE_RESISTOBJECT_XTRA_TYPE_POWEROBJECT_XTRA_WHAT_SUSTAINOBJECT_XTRA_WHAT_RESISTOBJECT_XTRA_WHAT_POWEROBJECT_XTRA_BASE_SUSTAINOBJECT_XTRA_BASE_RESISTOBJECT_XTRA_BASE_POWEROBJECT_XTRA_SIZE_SUSTAINOBJECT_XTRA_SIZE_RESISTOBJECT_XTRA_SIZE_POWERACT_ILLUMINATIONACT_MAGIC_MAPACT_CLAIRVOYANCEACT_PROT_EVILACT_DISP_EVILACT_HEAL1ACT_HEAL2ACT_CURE_WOUNDSACT_HASTE1ACT_HASTE2ACT_FIRE1ACT_FIRE2ACT_FIRE3ACT_FROST1ACT_FROST2ACT_FROST3ACT_FROST4ACT_FROST5ACT_ACID1ACT_RECHARGE1ACT_SLEEPACT_LIGHTNING_BOLTACT_ELEC2ACT_BANISHMENTACT_MASS_BANISHMENTACT_IDENTIFYACT_DRAIN_LIFE1ACT_DRAIN_LIFE2ACT_BIZZAREACT_STAR_BALLACT_RAGE_BLESS_RESISTACT_PHASEACT_TRAP_DOOR_DESTACT_DETECTACT_RESISTACT_TELEPORTACT_RESTORE_LIFEACT_MISSILEACT_ARROWACT_REM_FEAR_POISACT_STINKING_CLOUDACT_STONE_TO_MUDACT_TELE_AWAYACT_WORACT_CONFUSEACT_PROBEACT_FIREBRANDACT_STARLIGHTACT_MANA_BOLTACT_BERSERKERACT_MAXobject_typeobject_kindartifact_typeego_item_typeflavor_typeo_maxo_cnto_listk_infok_namek_texta_infoa_namea_texte_infoe_namee_textflavor_infoflavor_nameflavor_textflavor_initreset_visualsidentify_random_genindex_to_labellabel_to_invenlabel_to_equipwield_slotmention_usedescribe_useitem_tester_okayscan_floordisplay_invendisplay_equipshow_invenshow_equiptoggle_inven_equipget_itemexcise_object_idxdelete_object_idxdelete_objectcompact_objectswipe_o_listo_popget_obj_num_prepget_obj_numobject_knownobject_awareobject_triedis_blessedobject_valueobject_similarobject_absorblookup_kindobject_wipeobject_copyobject_prepapply_magicmake_objectmake_goldfloor_carrydrop_nearacquirementplace_objectplace_goldpick_trapplace_trapplace_secret_doorplace_closed_doorplace_random_doorinven_item_chargesinven_item_describeinven_item_increaseinven_item_optimizefloor_item_chargesfloor_item_describefloor_item_increasefloor_item_optimizeinven_carry_okayinven_carryinven_takeoffinven_dropcombine_packreorder_packobject_aware_pobject_tried_pobject_known_pobject_attrobject_charartifact_pego_item_pbroken_pcursed_pobject_info_outobject_info_screenplayer_magicplayer_classstart_itemplayer_typeplayer_sexplayer_raceplayer_otherhist_typeinvalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'bool#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment..selfinvalid type in array indexing.array indexing out of range.start_item.selfinvalid type in array indexing.array indexing out of range.invalid 'self'player_magicinvalid 'self'player_magic#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range..selfinvalid type in array indexing.array indexing out of range.invalid 'self'invalid 'self'#vinvalid type in variable assignment.invalid 'self'invalid 'self'#vinvalid type in variable assignment.const player_sexconst player_raceconst player_classconst player_magicplayer_otherplayer_other#vinvalid type in variable assignment.player_typeplayer_type#vinvalid type in variable assignment.#ferror in function 'set_blind'.#ferror in function 'set_confused'.#ferror in function 'set_poisoned'.#ferror in function 'set_afraid'.#ferror in function 'set_paralyzed'.#ferror in function 'set_image'.#ferror in function 'set_fast'.#ferror in function 'set_slow'.#ferror in function 'set_shield'.#ferror in function 'set_blessed'.#ferror in function 'set_hero'.#ferror in function 'set_shero'.#ferror in function 'set_protevil'.#ferror in function 'set_invuln'.#ferror in function 'set_tim_invis'.#ferror in function 'set_tim_infra'.#ferror in function 'set_oppose_acid'.#ferror in function 'set_oppose_elec'.#ferror in function 'set_oppose_fire'.#ferror in function 'set_oppose_cold'.#ferror in function 'set_oppose_pois'.#ferror in function 'set_stun'.#ferror in function 'set_cut'.#ferror in function 'set_food'.#ferror in function 'check_experience'.#ferror in function 'gain_exp'.#ferror in function 'lose_exp'.#ferror in function 'hp_player'.#ferror in function 'do_dec_stat'.#ferror in function 'do_res_stat'.#ferror in function 'do_inc_stat'.#ferror in function 'take_hit'.#ferror in function 'inc_stat'.#ferror in function 'dec_stat'.#ferror in function 'res_stat'.#ferror in function 'restore_level'.A_STRA_INTA_WISA_DEXA_CONA_CHRA_MAXSEX_FEMALESEX_MALEPY_MAX_EXPPY_MAX_GOLDPY_MAX_LEVELPY_FOOD_MAXPY_FOOD_FULLPY_FOOD_ALERTPY_FOOD_WEAKPY_FOOD_FAINTPY_FOOD_STARVEPY_MAX_SPELLSPY_SPELL_LEARNEDPY_SPELL_WORKEDPY_SPELL_FORGOTTENPY_REGEN_NORMALPY_REGEN_WEAKPY_REGEN_FAINTPY_REGEN_HPBASEPY_REGEN_MNBASECF_EXTRA_SHOTCF_BRAVERY_30CF_BLESS_WEAPONCF_CUMBER_GLOVECF_ZERO_FAILCF_BEAMCF_CHOOSE_SPELLSCF_PSEUDO_ID_HEAVYCF_PSEUDO_ID_IMPROVplayer_typeplayer_typepyplayer_typepxplayer_typepsexplayer_typepraceplayer_typepclassplayer_typehitdieplayer_typeexpfactplayer_typeageplayer_typehtplayer_typewtplayer_typescplayer_typeauplayer_typemax_depthplayer_typedepthplayer_typemax_levplayer_typelevplayer_typemax_expplayer_typeexpplayer_typeexp_fracplayer_typemhpplayer_typechpplayer_typechp_fracplayer_typemspplayer_typecspplayer_typecsp_fracplayer_typestat_maxplayer_typestat_curplayer_typefastplayer_typeslowplayer_typeblindplayer_typeparalyzedplayer_typeconfusedplayer_typeafraidplayer_typeimageplayer_typepoisonedplayer_typecutplayer_typestunplayer_typeprotevilplayer_typeinvulnplayer_typeheroplayer_typesheroplayer_typeshieldplayer_typeblessedplayer_typetim_invisplayer_typetim_infraplayer_typeoppose_acidplayer_typeoppose_elecplayer_typeoppose_fireplayer_typeoppose_coldplayer_typeoppose_poisplayer_typeword_recallplayer_typeenergyplayer_typefoodplayer_typeconfusingplayer_typesearchingplayer_typespell_flagsplayer_typespell_orderplayer_typeplayer_hpplayer_typedied_fromplayer_typetotal_winnerplayer_typepanic_saveplayer_typenoscoreplayer_typeis_deadplayer_typewizardplayer_typeplayingplayer_typeleavingplayer_typecreate_up_stairplayer_typecreate_down_stairplayer_typewyplayer_typewxplayer_typetotal_weightplayer_typeinven_cntplayer_typeequip_cntplayer_typetarget_setplayer_typetarget_whoplayer_typetarget_rowplayer_typetarget_colplayer_typehealth_whoplayer_typemonster_race_idxplayer_typeobject_kind_idxplayer_typeenergy_useplayer_typerestingplayer_typerunningplayer_typerun_cur_dirplayer_typerun_old_dirplayer_typerun_unusedplayer_typerun_open_areaplayer_typerun_break_rightplayer_typerun_break_leftplayer_typecommand_cmdplayer_typecommand_argplayer_typecommand_repplayer_typecommand_dirplayer_typecommand_seeplayer_typecommand_wrkplayer_typecommand_newplayer_typenew_spellsplayer_typecumber_armorplayer_typecumber_gloveplayer_typeheavy_wieldplayer_typeheavy_shootplayer_typeicky_wieldplayer_typecur_liteplayer_typenoticeplayer_typeupdateplayer_typeredrawplayer_typewindowplayer_typestat_useplayer_typestat_topplayer_typestat_addplayer_typestat_indplayer_typeimmune_acidplayer_typeimmune_elecplayer_typeimmune_fireplayer_typeimmune_coldplayer_typeresist_acidplayer_typeresist_elecplayer_typeresist_fireplayer_typeresist_coldplayer_typeresist_poisplayer_typeresist_fearplayer_typeresist_liteplayer_typeresist_darkplayer_typeresist_blindplayer_typeresist_confuplayer_typeresist_soundplayer_typeresist_shardplayer_typeresist_nexusplayer_typeresist_nethrplayer_typeresist_chaosplayer_typeresist_disenplayer_typesustain_strplayer_typesustain_intplayer_typesustain_wisplayer_typesustain_dexplayer_typesustain_conplayer_typesustain_chrplayer_typeslow_digestplayer_typeffallplayer_typeliteplayer_typeregenerateplayer_typetelepathyplayer_typesee_invplayer_typefree_actplayer_typehold_lifeplayer_typeimpactplayer_typeaggravateplayer_typeteleportplayer_typeexp_drainplayer_typebless_bladeplayer_typedis_to_hplayer_typedis_to_dplayer_typedis_to_aplayer_typedis_acplayer_typeto_hplayer_typeto_dplayer_typeto_aplayer_typeacplayer_typesee_infraplayer_typeskill_displayer_typeskill_devplayer_typeskill_savplayer_typeskill_stlplayer_typeskill_srhplayer_typeskill_fosplayer_typeskill_thnplayer_typeskill_thbplayer_typeskill_thtplayer_typeskill_digplayer_typenoiseplayer_typenum_blowplayer_typenum_fireplayer_typeammo_multplayer_typeammo_tvalplayer_typepspeedplayer_sexplayer_sextitleplayer_sexwinnerplayer_raceplayer_racenameplayer_racetextplayer_racer_adjplayer_racer_displayer_racer_devplayer_racer_savplayer_racer_stlplayer_racer_srhplayer_racer_fosplayer_racer_thnplayer_racer_thbplayer_racer_mhpplayer_racer_expplayer_raceb_ageplayer_racem_ageplayer_racem_b_htplayer_racem_m_htplayer_racem_b_wtplayer_racem_m_wtplayer_racef_b_htplayer_racef_m_htplayer_racef_b_wtplayer_racef_m_wtplayer_raceinfraplayer_racechoiceplayer_racehistplayer_raceflags1player_raceflags2player_raceflags3start_itemstart_itemtvalstart_itemsvalstart_itemminstart_itemmaxplayer_classplayer_classnameplayer_classtitleplayer_classc_adjplayer_classc_displayer_classc_devplayer_classc_savplayer_classc_stlplayer_classc_srhplayer_classc_fosplayer_classc_thnplayer_classc_thbplayer_classx_displayer_classx_devplayer_classx_savplayer_classx_stlplayer_classx_srhplayer_classx_fosplayer_classx_thnplayer_classx_thbplayer_classc_mhpplayer_classc_expplayer_classflagsplayer_classmax_attacksplayer_classmin_weightplayer_classatt_multiplyplayer_classspell_bookplayer_classspell_statplayer_classspell_firstplayer_classspell_weightplayer_classsense_baseplayer_classsense_divplayer_classstart_itemsplayer_classspellshist_typehist_typetexthist_typerollhist_typecharthist_typenexthist_typebonusplayer_otherplayer_otherfull_nameplayer_otherbase_nameplayer_otheroptplayer_otherwindow_flagplayer_otherhitpoint_warnplayer_otherdelay_factorsp_ptrrp_ptrcp_ptrmp_ptrop_ptrplayerset_blindset_confusedset_poisonedset_afraidset_paralyzedset_imageset_fastset_slowset_shieldset_blessedset_heroset_sheroset_protevilset_invulnset_tim_invisset_tim_infraset_oppose_acidset_oppose_elecset_oppose_fireset_oppose_coldset_oppose_poisset_stunset_cutset_foodcheck_experiencegain_explose_exphp_playerdo_dec_statdo_res_statdo_inc_stattake_hitinc_statdec_statres_statrestore_levelA_STRA_INTA_WISA_DEXA_CONA_CHRA_MAXSEX_FEMALESEX_MALEPY_MAX_EXPPY_MAX_GOLDPY_MAX_LEVELPY_FOOD_MAXPY_FOOD_FULLPY_FOOD_ALERTPY_FOOD_WEAKPY_FOOD_FAINTPY_FOOD_STARVEPY_MAX_SPELLSPY_SPELL_LEARNEDPY_SPELL_WORKEDPY_SPELL_FORGOTTENPY_REGEN_NORMALPY_REGEN_WEAKPY_REGEN_FAINTPY_REGEN_HPBASEPY_REGEN_MNBASECF_EXTRA_SHOTCF_BRAVERY_30CF_BLESS_WEAPONCF_CUMBER_GLOVECF_ZERO_FAILCF_BEAMCF_CHOOSE_SPELLSCF_PSEUDO_ID_HEAVYCF_PSEUDO_ID_IMPROVplayer_typeplayer_sexplayer_racestart_itemplayer_classhist_typeplayer_othersp_ptrrp_ptrcp_ptrmp_ptrop_ptrplayerset_blindset_confusedset_poisonedset_afraidset_paralyzedset_imageset_fastset_slowset_shieldset_blessedset_heroset_sheroset_protevilset_invulnset_tim_invisset_tim_infraset_oppose_acidset_oppose_elecset_oppose_fireset_oppose_coldset_oppose_poisset_stunset_cutset_foodcheck_experiencegain_explose_exphp_playerdo_dec_statdo_res_statdo_inc_stattake_hitinc_statdec_statres_statrestore_levelbool#vinvalid type in variable assignment.#ferror in function 'rand_int'.#ferror in function 'randint'.#ferror in function 'rand_die'.#ferror in function 'rand_range'.#ferror in function 'rand_spread'.#ferror in function 'damroll'.#ferror in function 'maxroll'.#ferror in function 'Rand_state_init'.#ferror in function 'Rand_div'.#ferror in function 'Rand_normal'.#ferror in function 'Rand_simple'.Rand_quickrand_intrandintrand_dierand_rangerand_spreaddamrollmaxrollRand_state_initRand_divRand_normalRand_simpleRand_quickrand_intrandintrand_dierand_rangerand_spreaddamrollmaxrollRand_state_initRand_divRand_normalRand_simple#ferror in function 'notice_stuff'.#ferror in function 'update_stuff'.#ferror in function 'redraw_stuff'.#ferror in function 'window_stuff'.#ferror in function 'handle_stuff'.#ferror in function 'inkey'.#ferror in function 'bell'.#ferror in function 'sound'.#ferror in function 'msg_print'.#ferror in function 'message'.#ferror in function 'message_flush'.#ferror in function 'screen_save'.#ferror in function 'screen_load'.#ferror in function 'c_put_str'.#ferror in function 'put_str'.#ferror in function 'c_prt'.#ferror in function 'prt'.#ferror in function 'clear_from'.#ferror in function 'pause_line'.bool#ferror in function 'request_command'.#ferror in function 'get_aim_dir'.#ferror in function 'text_out'.#ferror in function 'Term_clear'.#ferror in function 'flush'.#ferror in function 'flush_fail'.TERM_DARKTERM_WHITETERM_SLATETERM_ORANGETERM_REDTERM_GREENTERM_BLUETERM_UMBERTERM_L_DARKTERM_L_WHITETERM_VIOLETTERM_YELLOWTERM_L_REDTERM_L_GREENTERM_L_BLUETERM_L_UMBERMSG_GENERICMSG_HITMSG_MISSMSG_FLEEMSG_DROPMSG_KILLMSG_LEVELMSG_DEATHMSG_STUDYMSG_TELEPORTMSG_SHOOTMSG_QUAFFMSG_ZAPMSG_WALKMSG_TPOTHERMSG_HITWALLMSG_EATMSG_STORE1MSG_STORE2MSG_STORE3MSG_STORE4MSG_DIGMSG_OPENDOORMSG_SHUTDOORMSG_TPLEVELMSG_BELLMSG_NOTHING_TO_OPENMSG_LOCKPICK_FAILMSG_STAIRSMSG_HITPOINT_WARNMSG_MAXPN_COMBINEPN_REORDERPU_BONUSPU_TORCHPU_HPPU_MANAPU_SPELLSPU_FORGET_VIEWPU_UPDATE_VIEWPU_FORGET_FLOWPU_UPDATE_FLOWPU_MONSTERSPU_DISTANCEPU_PANELPR_MISCPR_TITLEPR_LEVPR_EXPPR_STATSPR_ARMORPR_HPPR_MANAPR_GOLDPR_DEPTHPR_EQUIPPYPR_HEALTHPR_CUTPR_STUNPR_HUNGERPR_BLINDPR_CONFUSEDPR_AFRAIDPR_POISONEDPR_STATEPR_SPEEDPR_STUDYPR_EXTRAPR_BASICPR_MAPPW_INVENPW_EQUIPPW_PLAYER_0PW_PLAYER_1PW_MESSAGEPW_OVERHEADPW_MONSTERPW_OBJECTPW_SNAPSHOTPW_SCRIPT_VARSPW_SCRIPT_SOURCEPW_BORG_1PW_BORG_2notice_stuffupdate_stuffredraw_stuffwindow_stuffhandle_stuffinkeybellsoundmsg_printmessagemessage_flushscreen_savescreen_loadc_put_strput_strc_prtprtclear_frompause_linerequest_commandget_aim_dirtext_outTerm_clearflushflush_failTERM_DARKTERM_WHITETERM_SLATETERM_ORANGETERM_REDTERM_GREENTERM_BLUETERM_UMBERTERM_L_DARKTERM_L_WHITETERM_VIOLETTERM_YELLOWTERM_L_REDTERM_L_GREENTERM_L_BLUETERM_L_UMBERMSG_GENERICMSG_HITMSG_MISSMSG_FLEEMSG_DROPMSG_KILLMSG_LEVELMSG_DEATHMSG_STUDYMSG_TELEPORTMSG_SHOOTMSG_QUAFFMSG_ZAPMSG_WALKMSG_TPOTHERMSG_HITWALLMSG_EATMSG_STORE1MSG_STORE2MSG_STORE3MSG_STORE4MSG_DIGMSG_OPENDOORMSG_SHUTDOORMSG_TPLEVELMSG_BELLMSG_NOTHING_TO_OPENMSG_LOCKPICK_FAILMSG_STAIRSMSG_HITPOINT_WARNMSG_MAXPN_COMBINEPN_REORDERPU_BONUSPU_TORCHPU_HPPU_MANAPU_SPELLSPU_FORGET_VIEWPU_UPDATE_VIEWPU_FORGET_FLOWPU_UPDATE_FLOWPU_MONSTERSPU_DISTANCEPU_PANELPR_MISCPR_TITLEPR_LEVPR_EXPPR_STATSPR_ARMORPR_HPPR_MANAPR_GOLDPR_DEPTHPR_EQUIPPYPR_HEALTHPR_CUTPR_STUNPR_HUNGERPR_BLINDPR_CONFUSEDPR_AFRAIDPR_POISONEDPR_STATEPR_SPEEDPR_STUDYPR_EXTRAPR_BASICPR_MAPPW_INVENPW_EQUIPPW_PLAYER_0PW_PLAYER_1PW_MESSAGEPW_OVERHEADPW_MONSTERPW_OBJECTPW_SNAPSHOTPW_SCRIPT_VARSPW_SCRIPT_SOURCEPW_BORG_1PW_BORG_2notice_stuffupdate_stuffredraw_stuffwindow_stuffhandle_stuffinkeybellsoundmsg_printmessagemessage_flushscreen_savescreen_loadc_put_strput_strc_prtprtclear_frompause_linerequest_commandget_aim_dirtext_outTerm_clearflushflush_failinvalid type in array indexing.array indexing out of range.invalid type in array indexing.array indexing out of range.invalid type in array indexing.array indexing out of range.invalid type in array indexing.array indexing out of range.invalid type in array indexing.array indexing out of range.#ferror in function 'script_do_file'.TRUEFALSEdddddxddyddx_dddddy_dddscript_do_fileTRUEFALSEdddddxddyddx_dddddy_dddscript_do_fileobject_type#ferror in function 'poly_r_idx'.#ferror in function 'teleport_away'.#ferror in function 'teleport_player'.#ferror in function 'teleport_player_to'.#ferror in function 'teleport_player_level'.#ferror in function 'take_hit'.#ferror in function 'acid_dam'.#ferror in function 'elec_dam'.#ferror in function 'fire_dam'.#ferror in function 'cold_dam'.#ferror in function 'inc_stat'.#ferror in function 'dec_stat'.#ferror in function 'res_stat'.#ferror in function 'apply_disenchant'.#ferror in function 'project'.#ferror in function 'warding_glyph'.#ferror in function 'identify_pack'.#ferror in function 'remove_curse'.#ferror in function 'remove_all_curse'.#ferror in function 'self_knowledge'.#ferror in function 'lose_all_info'.#ferror in function 'set_recall'.#ferror in function 'detect_traps'.#ferror in function 'detect_doors'.#ferror in function 'detect_stairs'.#ferror in function 'detect_treasure'.#ferror in function 'detect_objects_gold'.#ferror in function 'detect_objects_normal'.#ferror in function 'detect_objects_magic'.#ferror in function 'detect_monsters_normal'.#ferror in function 'detect_monsters_invis'.#ferror in function 'detect_monsters_evil'.#ferror in function 'detect_all'.#ferror in function 'stair_creation'.object_type#ferror in function 'enchant'.#ferror in function 'enchant_spell'.#ferror in function 'ident_spell'.#ferror in function 'identify_fully'.#ferror in function 'recharge'.#ferror in function 'speed_monsters'.#ferror in function 'slow_monsters'.#ferror in function 'sleep_monsters'.#ferror in function 'banish_evil'.#ferror in function 'turn_undead'.#ferror in function 'dispel_undead'.#ferror in function 'dispel_evil'.#ferror in function 'dispel_monsters'.#ferror in function 'aggravate_monsters'.#ferror in function 'banishment'.#ferror in function 'mass_banishment'.#ferror in function 'probing'.bool#ferror in function 'destroy_area'.#ferror in function 'earthquake'.#ferror in function 'lite_room'.#ferror in function 'unlite_room'.#ferror in function 'lite_area'.#ferror in function 'unlite_area'.#ferror in function 'fire_ball'.#ferror in function 'fire_swarm'.#ferror in function 'fire_bolt'.#ferror in function 'fire_beam'.#ferror in function 'fire_bolt_or_beam'.#ferror in function 'project_los'.#ferror in function 'lite_line'.#ferror in function 'strong_lite_line'.#ferror in function 'drain_life'.#ferror in function 'wall_to_mud'.#ferror in function 'destroy_door'.#ferror in function 'disarm_trap'.#ferror in function 'heal_monster'.#ferror in function 'speed_monster'.#ferror in function 'slow_monster'.#ferror in function 'sleep_monster'.#ferror in function 'confuse_monster'.#ferror in function 'poly_monster'.#ferror in function 'clone_monster'.#ferror in function 'fear_monster'.#ferror in function 'teleport_monster'.#ferror in function 'door_creation'.#ferror in function 'trap_creation'.#ferror in function 'destroy_doors_touch'.#ferror in function 'sleep_monsters_touch'.#ferror in function 'curse_armor'.#ferror in function 'curse_weapon'.object_type#ferror in function 'brand_object'.#ferror in function 'brand_weapon'.#ferror in function 'brand_ammo'.#ferror in function 'brand_bolts'.#ferror in function 'ring_of_power'.#ferror in function 'map_area'.#ferror in function 'wiz_lite'.#ferror in function 'wiz_dark'.SUMMON_ANIMALSUMMON_SPIDERSUMMON_HOUNDSUMMON_HYDRASUMMON_ANGELSUMMON_DEMONSUMMON_UNDEADSUMMON_DRAGONSUMMON_HI_DEMONSUMMON_HI_UNDEADSUMMON_HI_DRAGONSUMMON_WRAITHSUMMON_UNIQUESUMMON_KINGF_XXX1GF_ARROWGF_MISSILEGF_MANAGF_HOLY_ORBGF_LITE_WEAKGF_DARK_WEAKGF_WATERGF_PLASMAGF_METEORGF_ICEGF_GRAVITYGF_INERTIAGF_FORCEGF_TIMEGF_ACIDGF_ELECGF_FIREGF_COLDGF_POISGF_XXX2GF_LITEGF_DARKGF_XXX3GF_CONFUSIONGF_SOUNDGF_SHARDGF_NEXUSGF_NETHERGF_CHAOSGF_DISENCHANTGF_XXX4GF_KILL_WALLGF_KILL_DOORGF_KILL_TRAPGF_MAKE_WALLGF_MAKE_DOORGF_MAKE_TRAPGF_XXX5GF_XXX6GF_AWAY_UNDEADGF_AWAY_EVILGF_AWAY_ALLGF_TURN_UNDEADGF_TURN_EVILGF_TURN_ALLGF_DISP_UNDEADGF_DISP_EVILGF_DISP_ALLGF_XXX7GF_OLD_CLONEGF_OLD_POLYGF_OLD_HEALGF_OLD_SPEEDGF_OLD_SLOWGF_OLD_CONFGF_OLD_SLEEPGF_OLD_DRAINGF_XXX8poly_r_idxteleport_awayteleport_playerteleport_player_toteleport_player_leveltake_hitacid_damelec_damfire_damcold_daminc_statdec_statres_statapply_disenchantprojectwarding_glyphidentify_packremove_curseremove_all_curseself_knowledgelose_all_infoset_recalldetect_trapsdetect_doorsdetect_stairsdetect_treasuredetect_objects_golddetect_objects_normaldetect_objects_magicdetect_monsters_normaldetect_monsters_invisdetect_monsters_evildetect_allstair_creationenchantenchant_spellident_spellidentify_fullyrechargespeed_monstersslow_monsterssleep_monstersbanish_evilturn_undeaddispel_undeaddispel_evildispel_monstersaggravate_monstersbanishmentmass_banishmentprobingdestroy_areaearthquakelite_roomunlite_roomlite_areaunlite_areafire_ballfire_swarmfire_boltfire_beamfire_bolt_or_beamproject_loslite_linestrong_lite_linedrain_lifewall_to_muddestroy_doordisarm_trapheal_monsterspeed_monsterslow_monstersleep_monsterconfuse_monsterpoly_monsterclone_monsterfear_monsterteleport_monsterdoor_creationtrap_creationdestroy_doors_touchsleep_monsters_touchcurse_armorcurse_weaponbrand_objectbrand_weaponbrand_ammobrand_boltsring_of_powermap_areawiz_litewiz_darkSUMMON_ANIMALSUMMON_SPIDERSUMMON_HOUNDSUMMON_HYDRASUMMON_ANGELSUMMON_DEMONSUMMON_UNDEADSUMMON_DRAGONSUMMON_HI_DEMONSUMMON_HI_UNDEADSUMMON_HI_DRAGONSUMMON_WRAITHSUMMON_UNIQUESUMMON_KINGF_XXX1GF_ARROWGF_MISSILEGF_MANAGF_HOLY_ORBGF_LITE_WEAKGF_DARK_WEAKGF_WATERGF_PLASMAGF_METEORGF_ICEGF_GRAVITYGF_INERTIAGF_FORCEGF_TIMEGF_ACIDGF_ELECGF_FIREGF_COLDGF_POISGF_XXX2GF_LITEGF_DARKGF_XXX3GF_CONFUSIONGF_SOUNDGF_SHARDGF_NEXUSGF_NETHERGF_CHAOSGF_DISENCHANTGF_XXX4GF_KILL_WALLGF_KILL_DOORGF_KILL_TRAPGF_MAKE_WALLGF_MAKE_DOORGF_MAKE_TRAPGF_XXX5GF_XXX6GF_AWAY_UNDEADGF_AWAY_EVILGF_AWAY_ALLGF_TURN_UNDEADGF_TURN_EVILGF_TURN_ALLGF_DISP_UNDEADGF_DISP_EVILGF_DISP_ALLGF_XXX7GF_OLD_CLONEGF_OLD_POLYGF_OLD_HEALGF_OLD_SPEEDGF_OLD_SLOWGF_OLD_CONFGF_OLD_SLEEPGF_OLD_DRAINGF_XXX8poly_r_idxteleport_awayteleport_playerteleport_player_toteleport_player_leveltake_hitacid_damelec_damfire_damcold_daminc_statdec_statres_statapply_disenchantprojectwarding_glyphidentify_packremove_curseremove_all_curseself_knowledgelose_all_infoset_recalldetect_trapsdetect_doorsdetect_stairsdetect_treasuredetect_objects_golddetect_objects_normaldetect_objects_magicdetect_monsters_normaldetect_monsters_invisdetect_monsters_evildetect_allstair_creationenchantenchant_spellident_spellidentify_fullyrechargespeed_monstersslow_monsterssleep_monstersbanish_evilturn_undeaddispel_undeaddispel_evildispel_monstersaggravate_monstersbanishmentmass_banishmentprobingdestroy_areaearthquakelite_roomunlite_roomlite_areaunlite_areafire_ballfire_swarmfire_boltfire_beamfire_bolt_or_beamproject_loslite_linestrong_lite_linedrain_lifewall_to_muddestroy_doordisarm_trapheal_monsterspeed_monsterslow_monstersleep_monsterconfuse_monsterpoly_monsterclone_monsterfear_monsterteleport_monsterdoor_creationtrap_creationdestroy_doors_touchsleep_monsters_touchcurse_armorcurse_weaponbrand_objectbrand_weaponbrand_ammobrand_boltsring_of_powermap_areawiz_litewiz_dark, , and . It %s all your statsIt %s your by %i. stealthsearchinginfravisiontunnelingspeedattack speedshooting speedshooting powerIt %s your by %i. animalsorcstrollsgiantsdragonsdragonsdemonsdemonsundeadundeadall evil creaturesIt slays . , and it is especially deadly against It is especially deadly against . acidelectricityfirefrostpoisonIt is branded with acidlightningfirecoldIt provides immunity to acidlightningfirecoldpoisonfearlightdarkblindnessconfusionsoundshardsnexusnetherchaosdisenchantmentlife drainingIt provides resistance to acidelectricityfirecoldIt cannot be harmed by the elements. It cannot be harmed by It sustains all your stats. It sustains your is blessed by the godscreates earthquakes on impactslows your metabolismmakes you fall like a featherlights the dungeon around youspeeds your regenerationIt immunity to paralysisthe power of telepathythe ability to see invisible thingsaggravates creatures around youdrains experienceinduces random teleportationis permanently cursedis heavily cursedis cursedIt grants you . , but it also It . It activates for . It might have hidden powers. %^s This item does not seem to possess any special abilities. [Press any key to continue] invalid tag for a userdata (%d)reference table overflowcannot change the tag of a %.20snmemory allocation error: block too bigout of rangeinvalid valueinvalid capture indexinvalid pattern capturemalformed pattern (ends with `%')malformed pattern (missing `]')unbalanced patterntoo many capturestoo many capturesunfinished captureout of range^$*+?.([%-string or function expected\000[-+ #0]*(%d*)%.?(%d*)invalid format (width or precision too long)invalid option in `format'strlenstrsubstrlowerstrupperstrcharstrrepasciistrbyteformatstrfindgsub%ldindexindexperform arithmetic onconcatstring size overflownundefined operation`for' step must be a number`for' limit must be a number`for' initial value must be a number`for' index must be a number`for' table must be a tableTOLUATOLUAforeachtolua_orig_foreach.base.itag.itagunregistered 'classobj' in function 'tolua_instance'.tolua_orig_foreach.basecannot take ownership of specified obejct.n?bad argument #%d to `%.50s' (%.100s)%.8s expected, got %.8sstack overflow (%.30s)value expectedstack overflowlinecallcallreturnrrb@?_ERRORMESSAGEunable to recover; exiting userdatanilnumberstringtablefunctionfile `...%.99s'file `%.99s' string "..."string "%.99s"table index is nilinvalid key for `next'table overflowtable index is nil.get.setvalue of const array cannot be changedgettablesettable.get.setinvalid 'field' in accessing arrayinvalid 'self' in accessing array '%s'tolua_tbl_itype.array.selfvalue of const field cannot be changed.arraygettablesettable.get.set.get.set.array.base_ALERTerror: Sl <%.70s: line %d> tostring`tostring' must return a string to `print' base out of rangefunction or nil expectedgcdeprecated use: cannot set the `gc' tag method from Luagcdeprecated use: cannot get the `gc' tag method from Luaokrun-time errorfile errorsyntax errormemory errorerror in error handling`dostring' cannot run pre-compiled code_ERRORMESSAGE_ERRORMESSAGEtoo many arguments_ERRORMESSAGEdeprecated option `p' in `call'table: %pfunction: %puserdata(%d): %pnilvalue expectedassertion failed! %.90snninvalid order function for sortinginvalid order function for sortingforeachvarnextvarrawgetglobalrawsetglobalfunction `%.20s' is deprecated_ALERT_ERRORMESSAGEcallcollectgarbagecopytagmethodsdofiledostringerrorforeachforeachigcinfogetglobalgettagmethodglobalsnewtagnextprintrawgetrawsetrawgettablerawsettablesetglobalsettagsettagmethodtagtonumbertostringtypeassertgetnsorttinserttremoveLua 4.0_VERSION`%.20s' expected`%.20s' expected (to close `%.20s' at line %d)constant table overflow expectedlocal variablescannot access a variable in outer scopeupvaluescannot access upvalue in mainupvalue must be global or local to immediately outer scopeparametersargconstant table overflow expectedfunction arguments expected or `[' expected`item groups' in a list initializerinvalid constructor syntaxelements in a table constructor expectedvariables in a multiple assignmentsyntax error(limit)(step)in`in' expected(table)`=' or `,' expectedsyntax errorno loop to break expected or `...' expectedself#ferror in function 'using'.#ferror in function 'type'.#ferror in function 'foreach'.#ferror in function 'class'.#ferror in function 'instance'.#ferror in function 'base'.#ferror in function 'cast'.#ferror in function 'takeownership'.toluatoluausingtoluatypetoluaforeachtoluaclasstoluainstancetoluabasetoluacasttoluatakeownershiptoluatolua_tag_globaltolua_tag_moduletolua_tag_classclass tolua_tag_classtolua_tbl_classtolua_tag_instancetolua_tbl_classtolua_tag_linstancetolua_tbl_cloneinsuficient memorytolua_tbl_clonetolua_tbl_classdeletetolua_tbl_matetolua_tbl_classtolua_tbl_classtolua_tbl_clonetolua_tbl_matetolua_tag_globaltolua_tag_moduletolua_tag_classtolua_tag_instancetolua_tag_linstancetolua_tag_indirecttolua_tag_globalgeneric variabletolua_tag_modulegeneric moduletolua_tag_classgeneric classtolua_tag_indirectgeneric indirecttolua_tag_instancegeneric instancetolua_tag_linstancegeneric lua instancetolua_tag_moduletolua_tag_classtolua_tag_indirect.moduleforeachforeach.getoperator_get.get.base.set.baseoperator_settolua_tbl_mateoperator_.get.set.get.setvalue of const variable cannot be changed.module.moduletolua_tag_globalgetglobaltolua_tag_globalsetglobaltolua_tag_moduleindextolua_tag_modulesettabletolua_tag_classindextolua_tag_classsettabletolua_tag_instancegettabletolua_tag_instancesettabletolua_tag_instanceaddtolua_tag_instancesubtolua_tag_instancemultolua_tag_instancedivtolua_tag_instancelttolua_tag_instancegctolua_tag_linstanceindextolua_tag_indirectgetglobaltolua_tag_indirectsetglobalcontrol structure too longfunction or expression too complexconstant table overflowline info overflowcode size overflow(no message)error: %s _ERRORMESSAGEgettablesettableindexgetglobalsetglobaladdsubmuldivpowunmltconcatgcfunctionlegtgeevent `%.50s' is deprecatedevent `gc' for tables is deprecated`%.50s' is not a valid event nametag table overflow%d is not a valid tagtag %d was not created by `newtag'cannot change `%.20s' tag method for type `%.20s'%.20stag method must be a function (or nil)tolua_err_nargtolua_err_providedtolua_err_expectedtolua_err_providedtolua_err_expectedtolua_err_narg%s argument #%d is '%s'; '%s' expected. %s value is '%s'; '%s' expected. tolua_tbl_itype[undefined][no object]tolua_tbl_itagbooltolua_tbl_consttolua_tbl_hierarchytolua_tbl_itypetolua_tbl_itagtolua_tbl_consttolua_tbl_hierarchynilnumberstringuserdatatablefunctionbooltolua_tbl_itypetolua_tbl_itagconst const tolua_tbl_hierarchystrlen(s1)+strlen(s2)%.10sfunction or level expectedinvalid optionsourceshort_srclinedefinedwhatcurrentlinenupsnamenamewhatfunclevel out of rangelevel out of rangefunction expectedgetlocalgetinfosetcallhooksetlinehooksetlocalandbreakdoelseelseifendforfunctioniflocalnilnotorrepeatreturnthenuntilwhile.....==>=<=~=too many %.50s (limit=%d)%.99s; last token read: `%.30s' at line %d in %.80s0x%02Xinvalid control charlines in a chunkambiguous syntax (decimal point x string concatenation)malformed numberunfinished long stringunfinished stringescape sequence too largeunexpected `$' (pragmas are no longer supported)unexpected end of file in `%.99s'bad code in `%.99s'Luabad signature in `%.99s'virtual machine mismatch in `%.99s': %.20s is %d but read %d`%.99s' too new: read version %d.%d; expected at most %d.%d`%.99s' too old: read version %d.%d; expected at least %d.%dsizeof(int)sizeof(size_t)sizeof(Instruction)SIZE_INSTRUCTIONSIZE_OPSIZE_Bsizeof(Number)unknown number format in `%.99s': read %ld; expected %ld`%.99s' apparently contains more than one chunkLuavalue for `lua_getinfo' is not a function=CCmainglobaltag-methodgloballocalfieldattempt to %.30s %.20s `%.40s' (a %.10s value)attempt to %.30s a %.10s valueattempt to compare two %.10s valuesattempt to compare %.10s with %.10sANGBAND_X11_GAMMACouldn't allocate bitmap color #%04x%04x%04x ANGBAND_X11_FONT_%dANGBAND_X11_FONT10x209x159x155x85x85x85x85x89x15rIncorrect BMP file format %sUnexpected end of file in %sUnexpected end of file in %sUnexpected end of file in %sIllegal biBitCount %d in %s~@00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0d0p0|000000000000 0|0y$0v00s<0pH0mT0j`0gl0dx0a0^0[0X0U0R0O0L0I0F0C0@0=0: 07,04801D0.P0+\0(h0%=>@>M>X>d=>>p>>> UX Uh>>{ >* oUeooD,@ 0 oov~$e. \ Ac  *!#.$&*')*,-v.0O13457<89;@<=?&@lABD)EaFGHJKBLdMNOPQRSTUVWXYZ[\z][^8__`abNccdeQffglhhigj jkDklpmmnno'op'pqqrrsrsKsttztu7uuv@vvw4wwxxZxxy"y`yyzzHz~zz{{D{q{{{||@|f||||}},}J}f}}}}}}~~&~:~M~`~r~~~~~~~~~$.8AJS[cjqxu<AngbandTerm-1Term-2Term-3Term-4Term-5Term-6Term-7@@@```@@@vTvXv\vdvlvtv|vvvvvvvvvvvvvvvvww www,w<wDLwTwXw|wwwwwwwwwwwwwwxxxx x(x0x8x@xHxPxXx`xhxpx|xxxxxxxxyy(y@yXypyyyyyyzzz0z@zPz`zpzzzzzzzz{{{({8{H{X{h{x{{{{{{{{{|| |0|@|P|\|h||||||||||}}},}@}T}`}l}x}}}}}}}}~~~(~8~H~\~t~~~~~~~~~(8Ldx ,Hd|$Hp$Hp$D\x8` @`(Lp(Hl@l$Lt8X|(X,Pt  (08DLX  $(048<@DHLPT\`dhltx|  $(04<@DHLPTX`dhltx|  $(,048<@HLPX\dhlptx|\`dhlpҘҠҨҰҼ  8Hd`` `h`aXb cdeXf``D`aabcdf g                  $ , 4 < D L T \ d l t |   ,.l.|..../// /,/D/T/p//////00,0H0d0|000000000111(181@1L1X1`1p1x111111222 242H2P2`2p2222222223333,343@3H3P3X3`3p3|333333334 444XHDH`HHHII$I@IdIISdSlStSSSSSST T8T\TTTUU(UdUUVV4V\VtVVVWW<WlWWWXX0X\XXXXYY,Y<YHYTY|YYYYZZ4ZPZlZZZZZZZ[[<[D[X[p[[[[ ~~~~~~~~  $(,0<@PT\`hlx|DPP`ht|P~0 $h !P~0*~0~0PP(0<LXPhp| 0Tx,Pt,  $(,048<@LP`dlpx| $,4<DLT\dlt| $,4@LXdp| ,8DLT\dp|$,4@LXdp| (08@HPT\dlt| $0<HPX`ht| $,4<DLT\dlt| (08@HPX`hpx  ,8DPX`hp| ,8DP\ht(08@HPX`hpx ,8DLT\ht ,8DP\dp| (08@LTdlx (8HXdhpx(08@HPX`hpx@L\t$<\p?/& # Amulet~& Amulet~& # Ring~& Ring~& # Staff~& Staff~& # Wand~& Wand~& # Rod~& Rod~& Scroll~ titled "#"& Scroll~& # Potion~& Potion~& # Mushroom~& Mushroom~sssssremainsremainhashaveyour ancestorssan a spellprayersunhurtundamagedsomewhat woundedsomewhat damagedwoundeddamagedbadly woundedbadly damagedalmost deadalmost destroyedan a All of ySome of yOne of yYwerewasswerewas melt! melts! are destroyed! is destroyed! burn up! burns up! shatter! shatters! burn up! burns up! are destroyed! is destroyed! burn up! burns up! shatter! shatters! shatter! shatters! are destroyed! is destroyed! are destroyed! is destroyed!areisYourThesterrible black aurasurround your armorterrible black aurasurround your weaponOne of yYOne of yYminionskinYNYN********Angband3.0.3yesno Angband3.0.3Angbanddungeon levelAngband3.0.33.0.3 north south west eastUnknown Symbolyesno AngbandundefinedAngband3.0.3deadalive(illegible)spellprayerspellprayers3.0.3DescriptionDam/ACWgtLevCost--------------------------------------------------------Angband3.0.3Angband3.0.3NameLevRarSpdHpAcVisual Info----------------------------Angband3.0.3NSOMNSOMstartRowsstartColumnsminRowsminColumnsmaxRowsmaxColumnsinternalBorder9x15redrawCallbackAngbandangbandterm-1term-2term-3term-4term-5term-6term-7startRowsstartColumnsminRowsminColumnsmaxRowsmaxColumnsinternalBorderstartRowsstartColumnsminRowsminColumnsmaxRowsmaxColumnsinternalBorderAngband.angband.iconName: AngbandAngband.angband.title: AngbandAngband.term-1.iconName: Term 1Angband.term-1.title: Term 1Angband.term-2.iconName: Term 2Angband.term-2.title: Term 2Angband.term-3.iconName: Term 3Angband.term-3.title: Term 3Angband.term-4.iconName: Term 4Angband.term-4.title: Term 4Angband.term-5.iconName: Term 5Angband.term-5.title: Term 5Angband.term-6.iconName: Term 6Angband.term-6.title: Term 6Angband.term-7.iconName: Term 7Angband.term-7.title: Term 7NSOMNSOM/usr/pkg/share/games/angband/lib/NSOMNSOMisareisareunknownrr9@thangorodrim.netThe 'lib' directory is probably missing or broken. Perhaps the archive was not extracted correctly. See the 'readme.txt' file for more information. swords polearms blunts bows body-armors shields cloaks hats gloves bootsincreasesdecreasesincreasesdecreasesincreasesdecreasesno value(stdin) with default tagcg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)Xlib.h 1.10 00/10/12 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)Xutil.h 1.2 00/07/05 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)Xlib.h 1.10 00/10/12 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)Xutil.h 1.2 00/07/05 SMI@(#)Xresource.h 1.2 1.2 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)Xlib.h 1.10 00/10/12 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)Xutil.h 1.2 00/07/05 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)setjmp.h 1.36 99/08/10 SMI@(#)setjmp_iso.h 1.1 99/08/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15cg: Sun Compiler Common 9.0 2004/07/15@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)timeb.h 1.12 96/04/26 SMI@(#)memory.h 1.13 00/07/10 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)file.h 1.60 99/08/31 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)Xlib.h 1.10 00/10/12 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)Xutil.h 1.2 00/07/05 SMIacomp: Sun C 5.6 2004/07/15iropt: Sun Compiler Common 9.0 2004/07/15ld: Software Generation Utilities - Solaris Link Editors: 5.8-1.291.interp.hash.dynsym.dynstr.SUNW_version.rela.data.rela.bss.rela.plt.text.init.fini.rodata.rodata1.got.dynamic.data1.symtab.strtab.stab.index.comment.shstrtab.stab.indexstr ) **Q"{{>o-B@@h 8B BB,,D Lpp RUX UXXUh Uh ^Ut Utfu uovvGvvx t~@~@2XX"}  5=HHA5