08i<  ie0\t ti@@<@T 08i<  ie0\t ti@@<@TU it`Aiii$h iiiAiii>A.iii (0Aiii?Aiii7Aiii?AiiipAiiiqAiiirmD|!iii (08@HPX`hpx$[iii (08N$iii@HPX`hpxK$6iiiM$3iiiFAiiitCiiiuAiiivAiii|!iii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii4!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii B!iii B!iii!iii"!iii"!iii"aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii!iii !iii!iii!iii!iii?\!iii>\!iii=\!iii<\!iii;\!iii:\!iii9\!iii8\!iii?\!iii>\!iii=\!iii<\!iii;\!iii:\!iii9\!iii8\!iii:\!iii7\!iii6\!iii5\!iii4\!iii3\!iii2\!iii1\!iii0\!iii7\!iii6\!iii5\!iii4\!iii3\!iii2\!iii1\!iii0\!iii2\!iii/\!iii.\!iii-\!iii,\!iii+\!iii*\!iii)\!iii(\!iii/\!iii.\!iii-\!iii,\!iii+\!iii*\!iii)\!iii(\!iii*\!iii'\!iii&\!iii%\!iii$\!iii#\!iii"\!iii!\!iii \!iii'\!iii&\!iii%\!iii$\!iii#\!iii"\!iii!\!iii \!iii"\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii \!iii \!iii \!iii \!iii \!iii\!iii\!iii\!iii \!iii \!iii \!iii \!iii \!iii\!iii \!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii!iii !iii!iii!iii$!iii4!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iiiaiiiaiii!iii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiaiii?\aiii>\aiii=\aiii<\aiii;\aiii:\aiii9\aiii8\aiii?\aiii>\aiii=\aiii<\aiii;\aiii:\aiii9\aiii8\aiii:\aiii7\aiii6\aiii5\aiii4\aiii3\aiii2\aiii1\aiii0\aiii7\aiii6\aiii5\aiii4\aiii3\aiii2\aiii1\aiii0\aiii2\aiii/\aiii.\aiii-\aiii,\aiii+\aiii*\aiii)\aiii(\aiii/\aiii.\aiii-\aiii,\aiii+\aiii*\aiii)\aiii(\aiii*\aiii'\aiii&\aiii%\aiii$\aiii#\aiii"\aiii!\aiii \aiii'\aiii&\aiii%\aiii$\aiii#\aiii"\aiii!\aiii \aiii"\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii \aiii \aiii \aiii \aiii \aiii\aiii\aiii\aiii \aiii \aiii \aiii \aiii \aiii\aiii \aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\ !iiii!iii!iii!iii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiiiaiii!iii!iii!iii B!iii B!iii!iiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiiiibpf!iii $iii8$iii$>iii;$iii@$siiiB$iiiHAiiiJm iiiPXG$iii`K $iiihAiiiwAiiixAiiiyAiiizAiii{Aiii}Aiii~AiiiAiiiAiiiB@Mkx~c+'HlC:;߻W!x+xq.(|Z,[/dy{vo(/@`4grnekP[m'ed@FU:>~y9K. cMeӼl Q 'Iwyï3ʎQu5^C'QHU + [B8wbjBrѮU &P,a0U ʎ<!/.$'s'/S?tza%.3LWy 3(5t'D~uISAO_<߄eHB\r5t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4!4 (  $$@HH $$NetBSDAPaXNetBSDearmv54p@-D0D 0@`Qp(@P`F`F&a03/T@p$#A-`0`` 0PpU(pGpG@Pq`P03/T@0US ^ $\@-lPQMK \!\1 P`0 0R0819  0S  /S 0S10S8 0p ZpG2 pG0@3'q1*03/T@Y >p:0pWH2H0@3(1*03/X@ dd 0 P0 0y$4h#D0#($@-t ttNPl@dphP L´b`POU 㸴P 5@b'm'h% -P@-@O-`@@R@<2tH4M$H0[p _dPp@tH$H(  R  @P"p0: S `0SЍ @P0`0vw; 0xS'x0SP0 S0 [ P  ³ 0S;00 0  X P =0s 8#8T cTH'T   P R긻%L% }((`% 0H0`  BR` pR RX X/ḻ%%@-0 l)h% 000/|%G-؀P x0M@ + \0V`p + 0P0 ?Ѝ|%Y@,%+h%@- M @00@  o P  Ѝ,A- l1X0Zp 03 @P f0S@ ((@0X;0% P-  U @0`V/PeX`! pe0-S n@|@PhP ULP@ U(p0SX ,%$,.,%8,O-6M@T  @P Ѝ  Jp` )@5Xp0S 5%0 0 |5X 0S_d50S&<0pP(@ 70SN50S0tp pPJ400<T$尠EW00CS0 vPᐔ Pp  PYU 0 P00CS0 ^0 X80: S  +$ +pP p Qt  X0 0, 0X3($05x000 00 Q00SD 0 0 `kIp8  p 0Y 1(#00 H d 0P f@P㴂~ t\0S@zK"I 0R 0Y0YY]820#0 2p00 R0S 0100S  0 5(5 Pʨ0S;Ga@T c@P@0 ?oR20S 0  H1 0R0P( @#P @0S "P0S $P XTy P0Rt00!9P %,%%%%%%%h%D,%%|%%%S,%0@-MM@P  p  ;0U$C d P TTۍЍ08 P ,(0P Xy,,%,,%Q@-@ TP DDo,P $ 0P@,%,,%Q@-@ XP HHP0"P $ 0P@,%,,%@-!0 S,h%0$/&0$/&@-$8-@-$N-@-$e-@-${-`@-1   0 0 Ѝ-x&@-1   0 0 Ѝ-&@-1   0 0 Ѝ-&@-1   0 0 Ѝ-&@-0   0 0 Ѝ-&@-0   000 Ѝ?S&&<00/@-0   0y0 Ѝ&-&<00/@-0   0e0 Ѝ&-& 0@- 00 U$0P@NЍ-0%,0C-`A!圁!ᘑMpW0 |! R0B=00 B  T̯0L 8 R<B 8!4100!0ЍPP $=[PP 0p00S  0 P0P      0 3/R ! 7000@080L#D0&&&T #=..& .6.I.c..,0p@-|@PtP00 R 0p800 p0  B0Sqs &&&0 0 0 /&&@- #f @-@- {#d @-@-80M@0(@3/P $ p#H08 : S( 0h 3/P   00 0Ѝ00 0 1/qp b0S 00m8@@-@DPЍ@ GPЍp@-(`Vp80@  03/PP*#8003/(Pp'/@-@P`P R80 (0(3/@a P EaPЍp&O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 AE 000+ xpt| \  ЍO0 P % pHp 81/qp4 " ?P p 4 "Ra0S4 tp0 0 0 0 "[0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0004 8pX  FЍ&0/&T/f//R/ R 0 0 /\\CC  B0R00!/0"SSS S S S S SSS SS SS SSAQA0/C-lBM0 0  P0 0  0 y? Ÿ$  ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!!!! d 4 !P`u4<[4 " BXX P!d4b4)[4 " B   !d4O4[4 # B  d4<4[4 /0Z8p<@0! Z` d @44Z4 Ѝx&ԣMb &0>{D0]0p00U@-@RG-A `00P4 2#&P8P0 (1/qp $ ,!㰀娐pUЍ0S0C080 $0(3/P 0 `V`PE@!0  Z  $8&&0%0@-XAM P04 00#!8 ( 01/qp$  P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080 p0h( 3/pLp #U0* 0P/`RP `&m@-@L M 0Q   0    Ѝ&]O-wIM0@S`M. 8S+ #='000S( 000 t" ! `!x0T0# #z|0 4u& (%oIލЍ&?U 0 V0 `S 0E0VS06  S  S $0S0 600000S60 060 00 l6RhY 0Rr0C0C00Q0 0S. ,B<  6 0P X$  ( ( ,0S 0 $0P0,0(0000 0S $Y# 5%8(0St%0 l%00   0 L5L,0S <5<%0 04,dx[ʑ5$`VM / V 7* [ 0 8X 08 4p$(X Z 0  X`,00 0t 00,0 0@$ (0D&@04 @ ` % Z840$0z'(0吃# Z 0吳e&p4`00S1 ,0S #u$`V 0 !40S de\ /\ * Z0  X 0 Z !5#  0D$`[d5 0 !z0$ ( , q0  !j,00 0T 00,0@0 (0$ D41,0S 0`QP L0P0V40> Ё/ V '* 4Z 0 <-X 0< 8p$(&X "Z 0  X0040008 04 @  Z880$0y'(0吃# Z 2!p8`  0 @D<  0p E&0 0(1b1118%:21002 2&J22 C222|2222222 23,3 333@-pPP`@@Z LZP Ѝ`3MU@D3p@-XP8@T`@D p 'ZP<opQ<Pp&A-AP 0P$ 0 0 SQ ( $0vP \uh d`P, 0R1@a@qU`0``00PP\X 00CS000    0,`0CS0000 (00/U R \)8 4rD 0$00 0$ 0&h%050&b&F5T0 S 0SP/P/S/@- g0&p@-XAXT0040S+@! PPP P`04 0PV R@40P 0SU40 ^*00"  `0PEP P0P4  S U 4 P0CSR40PP 0 = p0&0&<%&&p@-8 4@Ђ`Ɵ謌h%b\50&05j50 p@-0 ?0PpMP@@@V0P  00S/S`Cu8Ppp(p@ \`P(D8̿<mp&&5550&h&555p@-@(P P 8@.[ 0TTP9pP8(PP 88P 0"p0&`h%5@-8@P(P 8P 8}0800& @-@@yP $000<0   R&%0&@@-<0 S</R/     0 &FL74( Q 0@30/@-&00@- R 0C30&A-ppA1SPS a00S S P4!`0`00`0S00 S@P0.S0 S 0P00`P 00CS0#0 m W  U0100CS00 pP&%G-AP 0pRpGWR0`0`0` 001S 0100CS0H89 hP00CS0' 0S  XP 0Sp`0 0`0R00 00C0p00  $`p&G-P4Ap  QR`X0A EP0A0S6PC000P 00CS0'0  W  pP 0圑0CS00PU`*<0`&G-A 0`0P0 P 00CS0-0 n& 0FSp 1S 0PEP0Cp00100CS0&O-PB`0pSP UB!0SR0XPPP00PE 0Q0CS00LN KP[00`F`0"P/  K P) 0100CS0G'(P; 0堑0 S, S  uPP} 00CS00  0堑0CS00  K0Pz&ԣh%bA-A`qW ڬQ1ECe R0 0 C0|00#PPP+ t00CS00 t 0q0CSQ00 \R `R `&h%b0O-D0!10Pp Ѝ0S/  $SPPPPP.P\ XT:00CS00  ]0Q0CS00! P1̃أؓ 0 S)"Rʜc0U```00P 0b0CS00 J 1Q !@o!S/ %S !`V U 00 0`P 0帱0CS000!000\Q00`PR# !RU``0``001Pc 0a0CS00jl0` 1 1S 0S11a0S S`l  P6 0a0CS00=?10`! S:`Fp00  1S pJa0S `10 BRpE` S`l   P 0a0CS00   &S7h%bh&6k7( Q 0@30/@-E&`01S @-0@!S @5LP /<P /&S77@-A00 S1 RUVʐ0\00lPBNt 00CS00- 000 @ R, R uP Ѝ00!S HP h0 Sڰ 0R0CS0000 0 Q  tP   &h%h%b77?A-O0 R ,Sp WX ! GYQ_YR\|L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}L}|L}L}L}L}L}L}L} kL}m`nL}L}L}L}L}L}L}r@sL}L}L}L}mpyL}L}L}L}L}L}L}L}L}@iL}i`jk`lmmnXoodppqL}Dr@sstDxympyzL}{PP00 nR pR lR 00 S  PP1S 'PPPP0 nR pR lR 00 S1S /PP0PPPP0 nR pR lR 00 S1S  P0 S00P0PP!R "R  R$ 000@ `PP 0 nR* pR# lR$ 00 S{Py PPP~0S!S  C0S 1SkT ^P0PPpP`T 010+0 +0X R000@ <PL 0!SP 8P00 nR pR lR 00 S(0S EC ^f.PPQUH  P G@ooG`GooPbVWP101 P00 nR pR lR 00 S PP0SPNʈ0 nR pR lR 00 SH)0S << P0PP0SP.ʈ0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PP~PP0 nR pR lR 00 Sw1Sw P zP0PP  PP` 0 nR pR lR 00 SR[P0PP;P P0nQ pQ lQ 00 S 3 PP=; 0  P/p PP*0S\ `Vl0ViV PPPVPU$p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SPʈ0 nR pR lR 00 S2S0|40S402P0PP0S 0l0C0S 030 S~1S 2SqW P000@ 0S0 0h`PPw 0 nR- pR& lR' 00 S[1S[!0R!S PpA0S1S 0c `PPP 0S0L 1JP0PPP`r0 gRG  R7 0 B RK `I@p?J0"S; b#pR1 rR1 U0 R 0 S( 0U0b0 * `P'00CS00 P00 S2S 02P00PP2P02 P P %0b200CS00ULWP!2R002 0nSS pSH lSL PP0 nRL pRE lRF 00 S1S"h%&777k7P%L%77&h%8+8,6?8&h&FyX8(&@%87j8!2R000#2 0# 020 2 2020P0PPCPYp PPT0S) `V0V PpPӒʈ0 nR pR lR 00 S,1S,02P0PP0SPӄʈ0 nR pR lR 00 S P0PP QR000P0P00@h `P 00 00 P0 nR, pR% lR& 00 S!0R!S ?0S1Sm bWW 0 P0S0P0PP1S 2SqXP0S 0l0C0S 030 Sp P0010CS 0nQ( pQ! lQ" 00 S3 00SEVI` `噮T@pJI0"S8Y`r 0  PP00 nR pR lR 00 SK0S TPP0SPPH0 nR pR lR 00 S,P b2S1HP0PP P   -@- 00 ЍЍ/'&-0^S0]S0]S S]S[S .0L0S^30   Q  ]Q RoG-鐁`P@0 SS&tPD(!,RF`a`qU`0``004P,H<( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a BC L0 0@S G 0c(&&0&h%b&"8&p@- !0 P< P@01SE0p0S S u`Pp@0P 00SP0P00 IP l0X 000Q*P0H0 ,((&6&8&&'h%bO-|b|B0 %Q + PXrX00 SM Y< U 000lP "$Gs 00CS010  Q0R0 00CS0000 S0&0Q@0C0RapU`0``00P 0A0CS000 0P \S0P 0 S 0t00S|hhP 000S Sq 0`00 Pk(&&0&&h%b?84&8&%0A-P0 0p@ W 0 `BP! 0 R00R000 1BQ G@ @Pc@pG0"S,$@gR000(&&87O-@SMpcȳ00 0GS TcsT`0``00PF` \X00C0+0&SK BR D R: Y J @p RVPF] 00C0S @Ѝh20    BR   0 \SH 1B\C00 BR?ˆr L\ DR-WppB@ \ p P \FD @L<h00C0 AQ 0 T0 Tpppp  Pu p BR   @W0 `0CS0(00oq 0 b&0&&h%bO-M0@ 0P 0k (40S 0  0 00 0(0=pPP `C̳0 S pSP(0Y01 Y  $ fP$Em` \X  B R+@30 #   BR 200S 0 0 @0 0(PP0 ߍ00Y0 Y P $ P$  BR 200S 0 z H@ P004 Q' 0 p1pG Y<Z  PH1 ppX X0p@-PPP@TTT ` U X X0Rp@\\>ppX 0Xp@-PPP@TTT ` U XX Qp@\\>ppX0X @-ppt t0\@ ^0@\\>X 0X@-pptt \@ ^ @\\>5S %R R S R SSh -^L^S R 0/0/0000 &O-QMTh @ `u @ 0@0 @0L0@@ @@D@H@<@@@4@8@,@0@5 SS$\ 0 !00`V0S9 0 0刐0L0St ,0D0000$0S00( <0@B?t;$pp;,0S d @?C000@$0D0p0H0D0p;0$pp|;$0S0040080#0ppl;,0S  @?CZ㸰张 0x#ppV; 0\#ppN;0 \ 0C0CQ0B003/0400S ޿YT RS0 00 R0! 0L0S XP< x0|R@ D <0 @\HD5H 5 4P !p \t 88  4 * R(" $\  " & P , 0,0000000Sb Q? 0 !XX0$0 Q9 0 l!d d0(0$:[(: 0R  P ,P0@:0S00P00P00PP)\0.S0S| 0!L0P$00P(0 $( (# R P00P000Ѝ &)VUUUw@Y}O-@a!80S _1PP! 3rpW  ЍO1<0匑SB儱|82@P ?@1{?@y?0SL H50CSꠣdtt\Z $ Q00L0S \0.S0S M3@0S40S L3<0?oQ20S X 040 Ѝ &̛Z:Y:**G-`H`{0P0HFL0 8+P0S$&00D0H0P0pP0 pO5T H0 `F0P 0 0P _5X0 s0X0d 0t000|00PP, S,Qx |0R4 S& S' S 5" L0S5 T0S50S4P$Q40V  00Ѝ10@GS꘧|(H`ĩܩ̨TЧ$<TlxhЩ80L00P000H00P0L00T0OX0s0X000P0L0T0H0D000P0L0T0H00X0:0P00L00T00P0L000\00`0)0`00\0$0d0!PP0<0080 P0 D0h l00D0h000000 0;(00p$00p$0,p0$00,0000@00 00p00t00D00h00x00|000000000D0@P0D @c\0 SPW ( ?R004(0\ SR PPP00`0S0\0S00S S S0|0`0Sp0\0Sd0d0 &ht@T%:% @@X%_:h%H&t  xL80p@-@PT @@\p&80p@-@PT @@\p&-L MRM\0 A+ p0=׾0 ލЍ 00 (>04@pl0l 0 0  L00S   m:h%):&&d&$0\ 0S [X&)0L0S/0 0 0/@-00 SM    4 $;Bpph/Ѝ\0\@ X0R@P0 B ?N7 0Ѝ@(&0&D&::L&::H&P `00CS`0p S00 P0S X0X /X 긻%: S@-  S  S/ I* S  S%|@=A-|1`@pTXPM !\ѿ@T10S H10S. 00 00,10'p  ⵿@0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?6 0ᅿT00S ,& ;0&D&:&&&&L&;H&d&s@- 1 P@@P `PU00S @GT CЍp0t  Q \0 \@-T (P@$U;&&p@-P@Tp0 0C0  $A @G-@0M803,30S`V0Ѝ0 0C0v 0XPS !$0S 20Sh  4 "; $p| ݾR0 ( pԾP20S 0<̾ ,Ⱦ(20S  0 : SF0( " 08"$4孾10SP :1!0 0O 10S10S : S0: S y`}P1q H1Rp@1 B?5 0v'Q sp , bl^ ,Y00S00S &`&,&0&-; ;D&:x&6;@&uP=;&&&&&L&;H&|&d&1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ00P 0 `0SpQPPU% Ѝ  B 10`    0S[  L0  $R,   V ,&0&D&&&T%d%&410G-S$0@010S 10S,0000 0 0P=0`VG^kgpP儠UG k0 0C0 W bp0S$,  `YpP R`,&0&D&&&T%0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG +0 0C0 W ,"p0 00 S p0S$,  Dp` ,&0&D&&T%@- M @ ᭹p ЍT  P  T0c'P 00 0S@SQ 0  Q'0%0p@-0PS``K4@P 6P PA⎶@P4 x'Pʼ׸p&*K;C-CM@%4 `9 8PȐ`T *F 0;pPPCߍw ? P@8w0S ?@P?lP@%@-| 㯺Z;h% 000/&@-l0 㞺;h%@- M~0P!00A00P!0 0Ua X"pW Ѝ "$ S0P @000 h0h1 8"pX   DH姅"$  (0堅&;;;#';2<.<;<O-L@PQM ePm 80Sq   `qP 0S jP  id00CS00pp/`Ѝ0S KP XTPB`P`(31 04 Rt$tp xR 0 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx) 30 p W 00CS0Kp pYW 0 P 0S  t冻XP `0: S ]P8X P `0: SᗾpP` 呾`Pq៾c0S x yP@ PWᄾ E[ ,I὿P B0˯S ,!00 + 1% 0$! 0 p啻p|F80H0 wP 8x ttP }70S `0;`0`hP cP f70-S  PTP`Ph0S  <帺O`&M:<D,h%%BD<`<p<Y@+S,{<<<<s@-@ `P᰾P0Pk UʽȽЍpU 厾㋾\@弽庽0 P4zw@<h%=<=<A-A~M0pSM P0` 0`P6p! p~,kP 6@!1P~܍Ѝ0 0`޾P6 ~,NPPʴ6 ~,EP `0 0P6x W Q \#10 00ᨾP60$ i1h%m@= =h====00CS0 0 /O- U`DMp 000D$000 0000SdV"4`0p Q 30Sa4PZ|SPZ560`$1000 0K4$¼P!60$1V 0030p Q  #奼P0 060#0V0030d#厼P50X#0L3000DЍp(0: S d0 S" P 000 S|2"00"00 0R  Rz2`2Vn `i S0% 00 0+qp50S 0㐐唠0 0p) W W)2`V%  ?+0 10 0R  S0R 0!CQ:++R:0'WW~Ta0@ 0 /T04[@T ;0W ` W00l W~,0 ~l0`Z BP* BP*Q*S  Q T0`h%&&%t% '&m>>|%2>M>%>m8@ ' '%}D00S/@-4@~M0S~, 唻P~܍&h%0@-p@$0l00S Ѝ00 0&+0Q 4, /=Ph%&>L0@- R8\/P 0 0 P/&>' '?A-p`P@ G0PPEU`@T@A-p`P@ 0PPEU`@T@p@-P@T0` Q@P 0 Q @;;S p@P00T@ i4(0( K/( .h%& '@?a?@-,BPU` V0bP$00 p?W0 pGWhPh=40 SV.00P ЍP#ڀ;;S 00 0f*0Q P?PppD1$p0pQ CQ(% 00$0SP ( .30S0030ES0030S 30ES $0Su.30S 30S 30SPU 3(0( .h%&?T':@@a???t!0SX@-dQM0S T100CSDA.Ѝ0S0SS/ 0070S S00&.S0S0@pT0pS 0L)Qo 0.p T0)Q00L 0医P000S$ʲ/&h%%l@@m@G-P`0 P ,p@P"ڴAQ")Q 0Q P 0u)Q13D .ЍP 0Sh%&@@-xaPMP d1@0S2 SU@D;00U0pp0 ?)0Q2 -Ѝ P0S(0S 0&)Q2  Pڌ0U 0?t-  d^-0 P 0P2 0, -h%&/A^AAA '=mAO-rM,M R(`RX0E@FP20 0S 0 00 S(0S d  T"唵P2p00 &-00"J⇵J?00"‵To" ?e܍,ЍT 0S =! !h!0`b)- ̸10Sx1pp1 00,00!JGJ?08!00,q0(`0 1娀(0 C0J1 +00 $0 , 0 l  0  `, xT%h%&T' 'AKMBB'&:B&PB 'h%aBC-XRXb0TBS0000 Ѝ440 0 0S 2r0S Q2 張  0S ٹpP (0: S0 0媹 p10S10S PGTP 0 0 0S(q<\ 1 00 0S000p000 S(00(000 P@0S 000S 0.P 0+0P0 + 0`M Hh%&&č' ''̍''B&%<'BT'B 'B 'A-MM, ⸷P31#,E ⬷P'1" ,RB$0`SF 0`CĂ0S2y+pO.P} J.Px 0 u S( .pe+lc+h2Lr0`0CSXXZ+W+HU+DS+@Q+<_+P,#.P000 0@+ 2 `ލЍ6+0S  R  sS SS YSOP+yS+$qx+l+<+P,-P 0S8 4-P( f+1P *0S(*PP P0000+*ԍ'BBh%&''C|%t%CCiC%CԣC$DLDtD D'CCDDDAEhExEE EE#EEE00@-@HpSp`%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S *@DT  Ax0d#0UPTP*PV0S p|*@X`ꓢ" @2/PL0 !ᒣ#, 0:%%&%4F& FT'O-Q0@`p@F f[ PppWPHB* ЍPT10S  1*p@ 0 $03/P$ 0 R T @ A  80 3/PrP\\00Sd \* Q < 02/P " "T'&YF%FF&&FF@-AMP/M1@P+ p`pP/0P0 Uh0h !*AލЍT0_"e,/0P0 000 ` *&G&0G00CS0 㐳0 /0O-S$M00`Y P$Ѝ$P0,03/P00T30 S,@C@sFP7PPP 0030SY  PV J20S w!P!P x4 CSR P8 ,G =P.7"~) H70/SWP^) AX | 10S  P0S !S 0l!202;/P Z ," 41  0S a0S 1100C `]0D0 3/`7 0S 0S 0VP0x0CP0&P"P0403/OT'H'&č'8'ԍ'ȍ''G&&'̍'&'p '@-@@BP.( ((&G@-飵p @@- (G@-@fp-0 (@Gp@-MP׵p@-0S  0C0- `p 0: S@S NS Ѝp-`C-MzPЍa0H03/P0 03/P,plA]P@ 0AS0@0 a3/PE0 0#P)3P/P WP0/S4P;( A0 0006@ Z-t =(0(03/ Xѳer0 PT'&&&%%Gԍ'O-MPЍe0H03/P0 03/PP㮑D50 S 05 P -%'50SuJG>P 0(03/ ン#P 0AS0@0 a3/P|4C003P H4 C(P(40S  ӴP T 0 0  ȴP 0R S = $ `0Sd003p0St00PP p@S`3`0Sd00/SXP_', A S0 0  ⇴P0SW 0S = $ `0Sd002p0St000S "SD 0 l 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P  x1 Hb X RP$PP ,1P50 P E @ ;/0S0S P0S 000[\000*4S 0S 0T''% HH''ԍ'p 'D'&8'0' '& '&''č'̍''%'G- R@}P T T 0 9&@H03/P0 03/P0SB0 Y Pq0 09paMP P: 0 P0(03/P@F P0 0 @0S 0' 00OP@' ٱm?P0 0A p0 0S TQP \0 CY yPT'H8'č' '&'̍'Bԍ''KHp 'T0@-0S\PP 00H03/P@8'T'0O-MMD嬀$0D! PP(0`! #(00,0$ P,(:8! #0 S 0P ( R M0Q0P Yߍ= 00 SR 0*("0P':8P "pt0 !RP *0( $'% 'm>}JJJJKA-@(0S`pP匀AP 0$ 000 00/ 0$ 0S0(0}Pb 0 '%T''0C- 0 Ѝ0a 00CϠP 0P  0 pO0 3"A$W@ *P 0PU@$ P@0 0$ U0 00CS /R0 S  00 UP@0 'G-pP`lV  0 BRk PPEUPR@@  $"`Fp 'O-0M00㒍PQp@𑟵 0`(=P2Y0 0㬡$0T0+U R 0Q0T0%X1@00S0T0S 0 :4S  !&0!! 0 BR  PU& o`Ѝ?T000 00 $0%PPd 0 R  S@T o R 0Q0 ''*K}JG-A`#RPp㌡>0S5  Up 0)  r!000SPER0  !: 0P! 0p 0P0U00pPF0P0 000/`F p ;!00`00Q xQ P0 S  PF '%TK'T'p@-0@0PpP E%0Pp@| '%A-`PlplU@0@DTj@P U@0 00`PE '%G-P`ကpU0@0@DTG@PğU 0@0 %0@UP0 ` '%G-pM =@ P` X10S P%:8$! U00 J(A 6 0 BR P#?U0 6P0PU0o0⯭PJ%8h @D 0RP J(L J}%80 _ `ލ$'m> '%KKK Q/p@-JTUPPa%0P C PpPPU%4$ 7 Ȥ0 40pKL'0@-PM@ FPh00S Ѝ0 $ R\ 04 0R\ D'L0@-MP @ PЍ000S0: SxJ"PQPU $0D P 0 $0 D'GL̍'L0@-M@, 0000S# Q0S 10S լP'0S% X0 ?A3c000S&!h0 ?A3c0  P $0NS $0X Ѝ0$0< 0S ừp%%Mb~LbLp@-@P`ῬP p dP $0|$0 ^p̍'L@-!@SP 0h$0@ I̍'LO-P0`/Sp/M/@P7 RP. jp /00 9P&  P!00S  P -P0 Dx Ѝ'G-@P 00/S (QP 00Q  G咪ZP#0 0`0S vQ뤀夐p0 /P#0S@$<jP@D0 40 @7D긌'L :MQM'̍'[MA-M`P@pᱫP5(10S Ѝ 0RP  0RP !0: S P ѪP#0 bpPW NP l# P W0 @DD'lMMM0@-:(4@: SM=0P - \ 00[ P0 Cp 0: S ,Ѝ000  tM:P/  0 fA-pQ?ZdV`éP#0H!@1@0S/0(DS7 (1!0 0 0 00! "4S pẩP"p0 ԪT0 40Ѝ@$<@0(DS PL(DPL(DP 00 0K' '%%M'O-J#Q30` P (tJM Mp40CS񟗄8Xp`3P x30S ⏪P0: S* XP2,3,0(So0S| (4S~ 0S20S 4m0C?o2 000! "p"pP"0 "1XG"Z/ Z\20S0 0 D" J>0@Pz=0 CႩz Jލ Ѝ  ߨ Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40*Pz ѩP#P! 0 `0 + D`\ QX00O0S0(4 008 00'7Y('' '%%M'[M$NVNB|N/O-p@M W 0DQ 0S08 0<000SPP0C080pG0S 0`S : 08 0 x! x3  P< p!@0  0R X2@ @?Q*]!@0 ?0嘰 R P` dЍTT a { ` `@NN''N''Rs@-Ѝp@ 0@`P^Q!08  刧P !0 NȌ'N0@-@MPPᰧ00<00S  = J"Ѝ0ȍ'G-`QM MJP㠔@ Y #p pP 0p 0PP=! SR J(Tݍ ЍרPJ 8 = $ HL0RP J(L0 00QJ 8 PTNm>NOG- QP 000aq@T+00CS0pT0 0S0T@ 0 S@ 0 !P 0S@ 0S0 0 S P ̌'،'4%% 0 0 S00@-@R00000S0@000S `LP LP40P(','̌'' 1Oȍ'p@-PP 0S|p `#@P` @P0/S000000f PR @@@p`O{Ǒ'h0 RX R  H R/< R/ $R/Q/ ̌'<'$'L'l0A-0S X0XP@0P`PpT R S> 埣0@ȍ'̌'h%OC-b@ 0,MS0S/,Ѝ0 0P50C S>##########x20S 0X0 00!P 0 000! " PPP  0!$:$!5 0!0 㓝 Iz X B((4 : S>  S8  S%  S04 0L! n0 J $!e1_P6 S  S0  S04=! 0400S ̈́!!" # "040+04 ⅥP0P 00   0 Ǒ'ȍ'OO P%P 'B9Pp@-8M@  ]D 0`P`UU`$ $ @ 0⑎P8ЍpSP]PA-t1hM0@S T壢hЍA `Z(凡="(<p@1WpP0 0000p084 40CSH$0"60"$q0( l4 CR+x c hЍB>'PZS+<  kč'iP{PPP@-@XM="p:(&0 XЍP7@-@Pp P Q Ѝ0 0  MI Ѝ0@GI0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qqp@-@@+0CQP0"S : Q%R0W^$B0CBSB 3b 30@pQ0^AC S*p P@-*0S ^*00 S R( \000C R@30 ? SR@*:@ 00 C@ T \A C@T2  0a0C R"  p@-0C@0 PR"S :$B QN%R02W" 0C@Q `@ 0PpANQ0 C S*80P @-  //4'PA-@8q8`Q PC-PQPUPQ S AƤA :UP0 ddޠ? 0:S@ 0S000 ,'%Ph%P/ s@- `0P PQ10*@PЍp0S @mR! bR kR% + 0*S xS SwR! /QP0@P0$+* &0!SP@P0PA- 0S蔻`PpP ㋙0P# X p R 000R p0000S , P0=0 @Pḛ Q'QFQs@-@0`P0C30 0  R R00PJ@P0@( 0ЍpPE 00'@-  :G㳝h%]Q0 Rr @-/%@-4@4'G($G !GG㗝h%QRhSbTO-px 5@ \Pp`0, [/00 `)UO-lM/P>oPb@P p`0p/小0/ `0@ ?/@|p??A0s S  R`?`/0X CRSE <+zP񟗳|75X25t75555575777755557555555555555555555555555555,78755D7P75\7h7555555555X2l6555566655557655X2657575 75555555455 5,55h55t555555566 6866@6H6P65`6`N>4=P $,PMP>@J >0 -R,Q0 00 0;= =, 4<= 2@ 9`3@ <2 3 T2 @ .83" * 2@@ % 2@  2L 2LP 20A00㬁堑 RK aR eB Q PA@A@A@A@A@A@A@A$A@A0A8A !00000 00K1]PJ `1J  P1I  0I Hꈁ 0 010L0㼙1Pd H'7Y'''%rU%%h%̍'% 'FU&\UD'%bU' '%<'č'H'QX%%%%%%L'%}'<~*VU VU%UVV'8%Wn7W zP'@'%5Vȍ'8'-KVaV-h%bN4' '|VV0'VV,'V&(' ''''%',&u' G 0.T'%%[W'% B#LL#HwB'0   0G 5가z0P  , G# 01F  1@ jP00F P7P`1*PE 1E  1D s1 1C1WPC1PB $2B  42A  D2A  T2p `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C 礚0 0S3# C*SS8C0U Pg000Sv|30UӈePE3PhPN0000S 3 Y0P  /'l0P/`0p@-0 PL@LPP@0@P6 ?B'T'WWh%'7YA-`  @PA?\+ \ *\.  Q R( [\SPQU !\@@]^.!Lo \0S8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ L'p@-@@0/SN00N P\WpPQP`Q*C0CT030@"L00Q*pQc;Y@-1MP M AaqRP/P `0P0Sۍ Ѝ.S@T|`l @ @ 'UYYYY Y Z$Z4Z[ZO-cM M33 "@p 3]PW0`0 00S 0f0 0 0⇰P`` 00 ;RSVz @0 0;T* R`DV:  cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0  0@&P\P   (0 0CP;T+ 0S( `0V"p0S 0 0S 峘0S s  0l 0 x墘@T *0S0T00  R S 0 $갍' ZZh%ZZC-`PMM RP p\SP RT P0S #  0SM\S R. gS PS$ SS GS 8˓ 0 0=pS sS0S00 R @@@(PPRP  ៓D@P p OP ; ᰡ0 0ᆓ ۍЍZ{[V['Z-[A-PP 0Sp`p@PL P40  R p`@@ @[['X0A-@0LPL`LpT  SZ 廗0@갍'h%[`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0  04ⰲP 0S/  00p0S/  0`0G @0/S000 0D  /ᰍ'<'L''\"\0A-j40@TPp 00S0o`0 00/S @Tx0T0ohP0 SD fP04谍'<'P'2A-0@SP' 0`.S0.S0S/S XYP 0 Q CR S.R  S.R0S/S  10S410S 4P:4 CSR ! Q`V 0/S0S.00 p  300C0V0<0J `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0 0A0 B!"00@h%A-Q@pW : J($S20d 000CS100 0=P  0 R ⨁0≎ᩑC  S@ 3. b 30:   J(T0Pu[[P081  1 Є0(p [P0<x TP0@ MP00  0 DPP u00 09Pl #PK=Ђ;PP P <ꈎ'cccd6dTddrd'// Qp@-(0PS$ l` L@P|St 0000X0 `#V0  @p5Yd'd eO-P`P Ѝ#:0J84YqW V#/00p0K0CSt3l IPi0<00H3  _  d ( |qp  }? $004000JH1P tn@0 B(1<'P l`<0 㓍 H K06S 0S 3 CRUgSy K CRZ0 40r;;000(4 9 xS!04(4:(404(49(408400C /Q000Q($4S::  $ R(4  @0&"*4*0000 02S($0 *4($040)($84  R KS 0 0 40r;;00 00KS8  0( $ ''6ele'1eBe;eO-z4@SM- S `cV:60VS0d`F`0PS/S`S 0EoᨂSXA 0CSpPF 0?! *8qЇX0L)[pP1 0p*! *8\ЇX0IFpP 0p*NHЇX0G2P 0pptk  1 :x0pz! 8 PpX  :x0pz! 8 ىPpX  :x0pz! 8 ljPpX  :x0pz! 8 ӉP!  N88PpX  !L8@ Z:w0@ @! 8P@W p W0p긎'@-q 㤄hh% 0;p@-@PT 0Q00S0P0T`00000^\Z00CS000S pȏ'ď'A-pPd@d`0000SP'U`00CS0$00SAȏ''ď'p@-@PD`0S@'T`p QP'G-0a000P60@ R'QS \! 000CS000S  0I p㌀匠`DYG60W0ZY00CS00 @W 0pȏ''&hď'8h%0@-S R' 'A-pP`V@ k@P*Pp@-XP>@P hDP0P 0@00aT8@py'A-ppP`0006@&60 0!6000@0CS000SAȏ'ď'p@-P`@T PV 0@p@@-PG-Q=0@T: 0S W@0 Y =GP P0 V WX00CS00 {V 0 0 0{@p`꼘'Bh%Wh8h%C-3sPc 0 p3@0! 0  0004 B @3 3 00`D~5蒟 *0@ Ѝ/R@R R@ m&@ B&Qꔝ<<<<<<<<<<<<<<<<<<<<<P<<<p0< x<@0=S0  "?R 9R:BPH|R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R'0o  -R(0h )d%b#`0 ]h%' 'lh''h0@- 눏'h0s@-0P`0/Z0`0@S P 0R@P@b  {P@Z0S00S R0ST P000 R  Ѝp舏''%i i@-L ^p\ȡ<ԡ\T @@~, \ 1#P? L 0l0̠?0 c0àΌ SQŒQQP0R0R0P0QPQP !6iBiSiO-`pu딠P @%R@W &R X(4! 0[00 @P@ P@ Ѝ舏'`i@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F2P@$ P@k Wꈏ')p@-@P0)Spꈏ'O-@`p04MTV TY T( T) #T! @$TU "T 0@#SP  +4Ѝ'0DSYG x@W'0I @S 0 0@SP'Y00p0p! W! sz! m0  @@P! `0  @PWWM'T@@p@P, @ǁ ꈏ'ini|i)O-p`M8P谟蠟4!@ 00 R@ 0DS U# 0 \ 00S^^ :U 00SY` p PU @ 0DS Ѝ舏' C-`p 0BS00@SP! @ 00 TPP@@ Ѝ舏'G-`dP0@S! p0 00PP@舏'@-@MP2`PL0P  IR NRpp PpEp@@0PS@ $z2Ѝ舏'iPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P33Sp0@1PH0@P 0,"S@2%%''z@P/-0 /RRR00䨏'@-@PMލ0/S X凅p ₅p 0RP 0RPp@-`\1@P 1D0p@11b0"SP Vp[먏'ip@-T` RpH0@Q 8 DPP q1pp@ꨏ'%iO-p6WR 0S)P |B000000000CS020S 3@T  U tU`W<1a828b0400@/Sp?EpPI0S0/p0CS0oppW002000pA0P00 N|001 hhU \dU00CS0810S 00CS0 0W00 pR0S/S0@D001@ P  R*0000t/S0S P 0/0CS0 pG0S 00CS0001@1@1@ꨏ'ȏ'ď'ii%'%A-`p0@00P 00CS000S q0P0CS0d00S b%@ HW 406 R0S 0Qȏ'ď'i%'G-2BM$8)r0@T%U@P' 0.S00.S000/SSJX20Pp  `PF } ePZ( `V+BPP "` 0` E0E3~~@0-S0SH1@T@<UP(0⮃Pw0S y/pP0: S W l/pPXP PW 0S| O/pPsЍ% j'4 j Pj'j&jIj@-$0Q @ S @ꨏ'iejp@-L@QU70P000S LTPP 0S}@@P 101yP00CS00 P 0 O0p|Tx'j'j%jG-pPp@R` V101 ?Pp 8Pp `b\TQ @0T! \0DQS񟗀40PX`hpx@0 0BP!0 BS@@00CS00 O 0@0 @T0S 00CS00 O 0 0SY00CS00 kO 0 MO 1 0d1@ @ @ @ @ @\@@%"kjA-@ ` PR 0R 0S SOp0S0 R O0S  OU  |OTO{ xOꉙ Td@00CS00 N 0 AN%''z%G% 0@-P' 0͟봏'@-@(0Q .P봏'@-x0@T   @@@@ @V@00S 4060S MЍ贏''%-$0@- R    '-@-   0@-'-@-0@0 H@-P@` =@-@-   3@-@--@-00z " ЍЍ/p@-P@n p@-@-   ЍЍ/ 0H P @-4 4N,P / $ j̏'0/؏'p@-@῀PPPP p` `P p` `ps@-P50@T t0t`6 N 12h0@T POT0 0@ P@DЍp輘'%B ؏''A-`P0@S'~<0*P/ 0լ`p(0 N {06S 00S PЍ @0t0S0T.S ؏'N@Rlj 0    /؏'@-@TЍ0Ѝ0CS긾ؾؾ   000 P y0 6@ 00 0@-@M PU PP 0byp ,P   HPP 0Syp  , ? Ѝ0 w0 0؏'%%@-@P 0S0S 5P 00 0E Ѝ'G-`0S q0P00#@儡T0SXe'@d1$@00CS0D10S &Ѝ00S P U~y1  R *P00CS00S UC0S~CUP~~@ w~0Sr#ȏ'ď'؏'WlC-c@PP^0M& S'2,똓sQ x\<0TS#$0@30S 1K0S 2$P@@T K^0S 0S@,T ^0S$0 0 @^0S 0S$0S 20S BH+ @@$@++10S ,H0S $Ho^0S 0S$0S @TM$@P10S H,10S H 10S G00S G  0$ 6 $0?o2$0-0$ R  h00S G 6@=L<Kb+  Ѝ%('؏'0'll%G-PMp@>+0 `㠀堐堠|APP b+Vx0$`W U ^0S W P 0`S"+Ѝ贛'%%؏'P8PG-P* `0@00 0R0Cp0W S `S0p 00 P++S p0@*PD0(00$+ 0$ 0$/%%'؏'A-Pp`@䀟000{^0S 0S 0S00CS00 0S  BR0 00CS$`0$`0C0 $0 R SP 0$`S S؏'%G-P䑟 M^`AV $`y*pWT0尡p0p00WZ 0S- |1|a4(Kl&K $K00CS00 J 0=  L00CS00 J 0 J  MN^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 ?* Ѝ%؏'''%A-@ M p) 0 0Pd@T/ 0S0$`V@ 000$P 0`@0T$0 R ^ R 0 R 0$0 $0) Ѝ`0괛'؏'%G-`倂Fo@p0媢S' 0S$ L2LRH23kJ8iJY8(dJV`J00CS00 I 0 IQV000  'P7 V a< 0$000CS0l10SG  D EPw P00CS010S C00CS0 VVp00S #0$0CS0|00S 0S0S0000>3I8IG 0kI%'%'|lllȏ'؏'ď'lp@-42M000000 20S 00S 1 `13II0Q@TI16I0PP& |1  1@@0S @T H1  GD@I8I$1I0S  1$ ލpA 0 000 0dBP00CS0 0@ a0 00x0 ?00CS0 0S VIlTIL0HX00S @00S 꼏'%''|l%l'l؏'ȏ'lď'0@-00`o00 00^0$MSP4P @Z(000P  pg&P 00S nz?fz0 p000CS0(00S ^($Ѝ%ȏ'lď'C-@?mM000@H0?_00?0 0P@,@ (0@ ? `0d00@T 0PPpo0 `0g@T pd0hP 00o 0lP@T 000P0l $00`0S$'`0 S 0D0>60S >0S$0S 00D0$ 01C 0p>0S$0S ph@PnT@ xP H077S 7S) >0S*00S6 -0000,0(00 0p(0P =&0S(7S%00S 0 0Sp= 8  8=, tzp@ P 0 8= M8 $= <, R , S,( r%P000<<0S @A @X$ 0 $ ` 0bt<H<O1Gh@T: =pHP?`P H00CS00 G 0PppH@T4`@T @ [00CS00 dG 0 H@`@T0Tk PU#00CS00 HG 0 ;)G00CS00 4G 0  ?BP @P07:0P cPP@HP\: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP0077S 0C8#8S0\\)SS B708#8SBP0 Q A!Q8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  p8 @  (00(00@070040" 8<000LgP7 7H 00R}0( ?$0SP007pGQhJ 0'000 000 7 0|'0x'00$(0h7  10103/$0 7 G474' 6,' EL0S L8 6 6 @ R] 4 0  X $E9&@00CS0 rl`60S CP x60S%,0>yS5T6$5D h0 L5,,0( Y0000*,0( T#0hE$0(0S,? $ \5 d50S $5,0S pwt<%050S 0 @0 AP0ET?0 0<0$0 0C0 000|D000t4 8\XR00CS0D40S sP) `40S*T0SXQdK8 3 3 3 \ 4 03WCh*00&<p3 0 0S '|0R#C#0 0 3 Bxh%L00S0\P0"0C0000QK8 2C  |2  t2 \ 2 !*00 0`2 T0S@"00CS0 2 R   01D0S$mߍ;10S %0,!SS{1 08 L0H@BKq10@0@0S P1 @0S1 41$ @0S  1@0sH1 R#0S01   B  @0S @0S7S@<M 0 00S i;X@,0S0  =,0Sh@P3 sF 0,0 0H 0''؏'''% ('ȏ'l''ď''%0%'Ș',%%%%l''!'' lB uG@T(0Sp0 t0v,0 0s,p)Dl-HF0/؏'0 /؏'0 /'0/' 0  /؏'P@-@'P@x<0 QP cR   m؏'0 S0/؏'0@-0M0/0@0P  wP L0: Sl  S` PЍ0vP0 : Sg# PP'3g!mp@-Px@x`M$P*00S `#0`00``00"`$#$Ѝp؏''@-h@P$0n'0 RP  B R    ؏'//C-LM*8⦕8 p@<(P@0` D, ` 0CLЍ%7mA-@P`"uupWU nxNI" 00](`pĘ''O-pWC R``%` P0S:S2E@А @0S,W@  @%0T/S/00p0 00S00P R:R0:SPPP@DOS"S"%% '@-@MP/p P㨐K  0 @ T9up0 @~0!0P 01pWZ0S 0 `T0S 0S 0 Sup @9" f`P T T T0@@T >0DS 'A- @PM`Rk1000  8p"XZU hBB Q PBLBQ8B 00AS 00CS00 ]B 0* 00CS00 MB 0 ЍQ PBB000M }00CS0 TBBHD00S R,r'Tmlmum%ȏ'~mmmď'mp@-P@@Pp 0S%SpXP @ p@-P8@Pp 0RGPp@ - @0@ R0S P P\ 0@%'G-`P@唀0吐00|Up00CS0h00SG0S0 S 0S00?lPPpȏ''@%ď'A-`pP0@00 Q Q:R@ @:QR@P0SwppR %Rw@2%Ppp0V:SP0@w@''@%mA-`P倀000|Vp00CS0T00SA0Sp00Mk@T`ȏ''ď'0A-pPS R+z`a@T"W p000 Z 0 @0 0 n00CS0H00S ?`]P `@ 'ȏ'ď'p@-P$@Pp0P0@ @-L@000@00 uk00CS000S@ ȏ' 'ď'O-PM/`@ 0P @@@ (sP000 0S 0S 000Ѝ#   P@ |2P @bPR R R R 0S 0   " R0""  " /R0 dpP>Z0 R"00ㄲ0  pPZ m P2 @ 08@00Q  0S/R10SZ #P %pP A0000S R  pJt#P1 R - R )(sP0 * R; R 60@@DK P R  BU T@0000S R    BR =D R9 7 a'm@% '%`mȏ'm%mď'O-@`pM&PP'0S*[ 000`0p0Sw|2!| S6hB?01 P?PЍbPEU( 00p`@[ Q \V  0P!0X ZWYV M1 00 _0S& 0s1TP P*X 00SW0 0 S0 P 0SlYT 0s P k]@Tm''%m''@%p@-`P0000S S@UK000 00 00000CS0p00Spp@ȏ'ď'0@-x@M0 0000\0P>00J 00CS0$00S Ѝ0@Ѝ0ȏ'%ď'@-gP 0SKO-@p`SM%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩00S"" 0RPW>= >0 @ TW 8L> P 4>>0 R @ T Ѝp>>A00CS00 > 0 00  x100/PXP!  dZZW YR>O>TpPWE>W~`F|jWxWtWq ~W 0` @ p`>`',n'0n Bnen nznnnn%'nndnnnoO- MLBLRp0@0`V' VV:V  VF /V   BR 7` F Rh! R  |a[  0000SHB@P   ~p[/R 0/S |0[o^P ЍY^ @TW 0 BR  R  BR    BR  H C %''%4 A-(A0S 0PS0 0aqP0S00 P000^g00CS00S P 0SRh`hp0P RP000:g000CS00S ꔐ'ȏ'ď''s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `L@0S00S=STL00 <0 R0AD1U0 S 0S%'Ę'A-dp`0PS@  R Rs00PH @ꔐ'O-rPԂ0M00B00 00$`0040Cd ;4`PP00CS0E0S00CS020S & HmP+0S 000PmP pf P ?10S 0EC0P0CS0X10S Ѝ000 @H[ [` V (Q P PAP 0 SR BR  R  B ~  ` B `FAQV  RP Pꔐ'%ȏ''ď'؏' 1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xQBP  `V' Q`:00Q@  @% Y0S" SP P@P P DoQP @@` ꔐ'''%A-XPX@X`P0p00ve0p0CS00S ꔐ'ȏ'ď'p@-P#@Hh0@ p蔐'@-QP`p0G0S `*00E@P`P P `R@ Ѝ0P@@0`SP0S0O-@ Y X0 S@0 S@HY" \YX0 S@0 x00S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x^\| ]\Q000``S XSQ0 0 @ 0000xQvS^ P[Sd:Q" P-Qf]Qc  \QQ PP$` $0( |P1 0$0 $`( |P%H0+PP0 QPQ P !$ P80QP*0$0eP e`0]S0 S 0p@X'\PP  8QP4\SSPP0 SP0S  @p3o O- P@M0?S*S3 [S;0^S!S00x \/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xPS@0/SR"@ R0A$x RP R  \$$ЍlPX9$P| 0U0/Sd 00EMpP $0S/00E0S``0` xQP 0S *V/00D0x RP0  Q: 0 R /00@>0P .Z. B/o" R  P V0 e$ꔐ'ď'0  Q0@-0 @\C\0CC/x^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S P g$$$b0$000CS0H00S N 0S }0Pꔐ'ȏ'ď'p@-@ PTp 0@ @@ꔐ'G-p 00 S QA0P 耟`V `R`F@ V \XXXXXX@S`` S =QQ RU  0P   P 0G-`@ M G0P (q000e U00SV-00E@`PIPE@T Ѝ00CS0@̠'O- R@@0`-SPM S! C R      d  P?So @Sy 00C Sht0 0 G`l0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P@7@p<(W@A0S 0g0CS00  P6FBЍ666;0000Q00S h6h pR\&TV(0S 0 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 R I 0  U  R~ȣ0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   I ~ C   0S  QAQ$AQ!   Q R V  BR + `w ~  0 BR儡  BR  ~ ~  `K E~paQ 00S T 00 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00Ę'' ''  %''%'%O-$M000 Z0 0H'0=,W0Jp00 0 7'0` 0`F#ZGF@Y0/ 0o@P`6 Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG (A39 6`0P`F 0 0S Z?0Y : @5% @AQ TK[Y0I Y@i ZD5  A0B F0  %T5  0 Zs@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R&$$,&,&d%d%d%d%$&&&&p&3  AQ AQ~00AQ ~ K R  BR ~0 0  BR d~0 0^ @0RP[ 22 0AT[ @T 000S[@Zp  Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0 0000P  00B 0C 0000000T0 00qP 000l0 GR00#S00 B00S0p0 G0 B0 [m$Ѝ|00S[0000p0SQ ''%%o'' '*oEohoO-0M Pp0 5 500 E 00B 00~S P0 0`Z Z":Z =Z Z! Z     BR  W PR 0 AAK J R񟗋+(+++((<*))Y 0S`Ѝ0S 0S0@S0=S( ( # #00CS00 w 00w00  4#00CS0 0 u #000P00u00"00CS00 00 00(0S 0  CR  SR`0C 0 Y 0"00CS00 v 00v000aS000 S 00CS00 ~  BR   Zl!`00000~00  `  000{  BR !  P  AA ^  ~R[=Z0SV 00|S N ` '%'%''G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S!000`0`0CS0!0 0@ p  G 0  X 0  R 000 0p %'%'%'' @-0 @%O-XAX`0$M`F*00V00CS000S 0S @pWZ00萠@ 0 Z7SꙂ! P00 R @ 'ȏ'ď'%A-`!@SPp% K&WVV |1N0S9 U 0S0P[PZV81 Up,U!1@ ! !&0@$$060S& $$$V&&U 0S PP ZXYP HHV WT  0 蜖'%L%p'' 'p08 N R S  0S  P 㠼%O-pR0`BM0 pP 0S0S ЍP880@000$00 #"P%:T 0S0 10S 160SdTf P c100CS010S 0S  02, \ Q R05S00|) \~ Lo ^ \ \ \@W~ Lo ^ \ 0S 00=TP 0000'ȏ' ''%%ď' G-pPE@P ?P1N0St `S@ZT @ZSpJS `㜠@0S0S 0S0S#`@Y 0 X 000 -%L%jp 'A-@PP PT0Q 0S 3zlP@ pP@ ZP@&z|06 R0S@@d`Q 0p) 0 0 Sker'%%O-PPdPt,M @P Y8 U0!0S05 @nT pTU P300SU00S00 ,Ѝ 0G(P ,P p0S 0S@3 P#Zp `X*00SL T0 @@0 00 00QBZR00 RiUX )Y ^  pPX2 R  Y RQU@ )260S&  @ Y00P'  P0`0V 00& 0V0S(0S0S 0S06 P 0Q p$@J0S 0S @sԀ0U0X0S 0 S0C0 S0SY UX c) @0S 0Sr̘' 'ir'rr%Yp@-@W``Q000 R 0S <1"Rp DR!r0S 0 00D1  S ?` 4` V0P 40``0S`0S\00CS0X00S {p800P0V0S  ȏ'L%p '5rOď'@1A-Q40@S~%P`q0SP00CS00 % 0 j&0Qp Q.U!{%PlP000T0@0CS0800S  'qqq%L%pȏ'ď'@- @ 00'@-@ @p@-`@0 0 p 0Qp\ PU%00p 'rA- 0p\b0@PU RP@ЍR R =RU "0Bh 'Rf 0 BRbtc(d4dcbcc$b) 1PU ^ S \R0 R  p ` Q\1 0 0A Q "Q" .  Q1 01p0} 0$ S0." W p 0p: !0}RQ 0 0\ $ `0" X00z Ux 0"  @PEr '@rrrrI{rT%rrA-@` tMTg 0SdPUeDh,ffffeff0 000E000PS V 00CS0l00SG E  P0(` 0`00ȏ'%'ď'T 000@0A00CS0/00S/ȏ'%ď'p@-$@P0 0C0C0p%'p@-(P(`@0@D00C0p%'( A00C 00 0C0/%'-A-@P(MHp@`DpPVP u \T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@L0 P 1ps T4O-` 0 40  |4 dt$0000 `SH4 ` ¹,4$ ($00CS0c 0Sf@pW 0䃟RPp *p0PC0pC0 Sڈ#sV@0  Ꮉ0 0C0Ps000>0 000CS0030S0@2 0 2 0 02 P B1 2R z0u`B0PUZKߍ20S d2h@d2d0p@00 0S V 0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PP@0000 F@!00CS0 0000DP38 1.1@@*pb0PC2P \00:0-,M00CS0`f R {00^%'%ȏ'H%%'ď'*y0O-鼯弿pM0ϟ  Q"/O/0 0202280 `00T/20S0S 2Y I,l(ܷ$Ȳ/Q00S; P.Q00S2 0P0C0p0000PbT.00CS0*@.0p210SxPpNTP"Pg KPEpE U0@#S?ꬬph`X|tp6p P00@ S0P@ A0@S7P@a0@SdWP@ W_ P H'P 0p@Wn00@S"cWf'PG\p0000Pg<0 0CS00C0~00P00C0l0P@E00@S0P@8 Y p0P0C0t0E4`0@?o? @2;R0S 6\P'\Pp ?PPpppWppUpW 6;E S< 5:0 S0 U0C *0?0%3?P00 Q~  B  PA0U!*00%60%3?00 Q~  B  ?PA00 QPA~P•3U5*00%90%6?00 Q~  B  A0%3?00 Q~A• ?P B 00  R P B ~ P  B u300%<0%9?00 Q~  B  A0%6?00 Q~A•  B 0%3?00  R~   B  U?p00%?0%p0PU 60 \0 e00CS0?H1P@0H21SZ0 0#<R00SQ 0SJ60PS܀V 0@P0 P>WUT@>P0 |P0 &PU000@$P 0Ѝ %H% % 'Đ'Hyykyyyyyy''%h% И''% '   P!0 ,  0@ 0 0 S0Q >W @<P >P" &P0000000p0p0((0 P -P 0(0  pO0YP0  0{P BP 10 }0 01{W00E000C00Q#PpIM}PP 1 " )00 0: <}P,p @R<2 3 p BR *p) p|2  BR P=  ŤJ= P2 Y%W :W5 #Wh~v 0P 0 wk.0G P p BR pYpT3 0 @ R  B 0p3pmP3@  BR 5p02!R1S $H<Q C2 ( C 7PP / R  7PP UP 7 R rP0 00CS0t00S "T0 00`Q RP'%%%''{ȏ'%{ď'O-`0Pd#dCM`s`` `00 :p(V( PEWUCc 0 pW` u@p00S0SጫP20SU0SR0sS vS V`p0+S -S Xض @g @Q0 @R: 幭P     W3PU 0 P0SA<0OЍVF p p0 %  " Q  %5S' 6p"?1 Q  06p0T (00%1 ^ X0 M IU00 DZ,%|,''|i|| |%}|0}A-PQU 00CSQHq10SL R@ 0`0CS00 `01L00<S0S  50qL0S 0CS>S0SSxh R 00CS00 -  YD}p@-@ᚯ0TP R R R& 1S# 0 兯PpR!Q QT " "D0600S0T0S 00S0('ȏ'ď'%@-@-P @60PVP@-@P .WP0  J2 Y4'}QA-@ 00CS00 P `tpt ?U UH?U!P0P0CS00 `ԣG-@Pp000 T` 0000CS0H00SG 0S 00S `.@ȏ'('ď'P P0  /\ Q0 S//('@-b@0pSM910S5 0SPPT,2C 02S իp? 0Sl UX U` P'p2 W`RUV0@D>T000 0i00  510S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ (''%'PO-`@TPP P@JP ,EP0FpS`@ PCPBP0P34 "PP`tDa0S! 000M-U 00CS0 PT40S ޳00CS0 40S ѳP@U00P@`s䃟1 R 0PU TgO@`@VT @c儃Q0S 00S 3@@TP@P @寪PP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X P̱̑@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR P,pVP 00CS0\00S 0U00 P#G2}n}%}('ȏ'ď'-}ԣ}}%6~A-@P P0` pUTA0S 00S Do0@0@000CS0 00S P(','ȏ'ď'p@-H@P02`S@20CSpV02p('40T0P?o20S 0S//('C-p@`1010r!Q0@S10C1 ЍqXPU X2ܼ_Pj+ϼP 0S Ҽ(''@ 0P/!!R /('p@-8P\2Sp@?<9\Bp('0-MM01`"R !R X"R   1 1d"1!d2S ,QPl1, ,QP L!0,00Q@P$1, @T0d3`0P, U @T 0S P00CS0 ! 2&00 0$0(00D>S 00 2312"!031('''ȏ' 0@-`"dy('p@-L@'P0PPp0C/U00p p@-T@TP0 0P0 *0 0000CS0p00Spp@eȏ'%ď'A-@R`P  10PPEU`pp WD,0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S sDP`0000 0C0ꐛ'ȏ'ď'p@-@P@0SH00Spp@00CS00  %0%0%@-@sP*ЍP~-@-   Ѝ Ѝ/-@- 0  ЍЍ/% -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`P$ 0S! lH0S00CS0>0 "  u00CS0/0 " 0S NpW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' {~ %0Q%@-@@%@-0rS~~0G-p0 P0R(0帐@0=004=`0`F@VPpPER000 S=S B`` R`ĥ`PGV@%'%0@- 4@ 00C00 0 0c,Ѝ蠛'~0P P PR00/0@-HP@^ ^ R0L00 A-鸀(  R c(p`@pW p0S 0QPU  0S 0S   3/P@P00꼛'0SfA-@PǣU p`pp0S'STP@DAM'PP(  EB}~~~A-P0`Sp@    3/@PP@X #W p0@=S0U0 0 00CS00  0 00CS00 x 0 T Y1% O-@00Sp 00P㼀✠Z  0C@PU* Ѝ`V Y   [ QʁxaP`0pꠛ''d0@ R P=R/=R/A-`P0S=SPERPU@'b\0\p!0qV@pT 0S  PVpp@ꠛ''@-1`0@S @  PPV 0 `c' Z h"  `R Ѝ@U'Dq   R <0 2/0`@' 0R , R  00 0000@!L@0P U U0 d00CS0`00S Ѝ@购Y0#L 00P P Ѝ%~ȏ''ď'-x0GM00h0 00MMP  <0  40 Gߍ 0  0  e꼏''A-`p= P 唭@VPp  PmP0D @S= O 0V  @)`ЍA50C-GML000LP00$0 0  Gߍ伏'p@-I/X@P0`&@0U<,F 0U`00 0p@ꠛ'!#r v!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ]$Ѝ䤘'(''%'p@-@`TP000T 00CS0p,00Spp@迬@ȏ'ď's@-P@T@ aPP0 P00Ѝp@n` OP 0 @E00000 00PЍp '8A-PpU`A0  %0%@TP@ {0@00`꼛' @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =ᢓ@@܏'C-pP@0聟rS``PW! 100S T! 0  ЍC]nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000  h(@0 L @  !W P 幫܌'<[s@- P`?@P 0 Q   00 00CS000S qЍpQ     R T0000   $ 0 $ȏ'ď' A-`pĀ@TP0U0   $9$0S R   0 02/0 x$00 0000ꠛ'%%A-p`P@P 0`0PPEPvT` eTp` fTxTp`X @V R@q'PP@-  WvC-p000P0`-S㸁@TQ 募@ 0@00`0CS0Vl10SR ЍC詪 Y@P=$P ~0 @0 00  0 00 00000  0  RP 00 00=S Tt0T 10=S010C0 0P00 Ѝȏ''%%ď'  'p@-@PTpt@p@-ʴP@`P \aNP@ xP@ IP@P(P0 P pU'00@/ 0S0@/s@-@0 0P`0S 0"S U1r0!l%*0S`0T000 @0C?o2R0SЍp!h%2@-M@ +P ލ+P@D 0RQH0PP0@-M@ +P ލ+P@D0 SPH0PP0@-M@ w+P ލo+P0RP 0RPA-@`+PI0 0SC P+UA +PPPlp +PJ! 0RA"@- 0-RS# 0S0 00t% Ѝ0SX0 0P0S00 040,TP$ 0 x C 0@-0P!S@M0SPЍ0P{ 0SxPUo U U HPo U *P? *PPEUR$4<D\l| P  P  P  P  P  P  P P p0St00@*T @:*0(S0)S0 0qop@-@`P(P} 0Sz00CSt@P`pppp,Htᆟoop~PxsP0`@,TV%@`!VT`@V@`@ P`@P`@V@)Fcw0S0!SPpp(S0)S0S pp@-@PPPEP.U)<P\p0op=Pp0\0!S0P p(S0)S0S ʧp/~FP@-0Bͧ녀%@-$0$0 00 㿧'%@- @კ R1P\ * ǧЍ&O-@`@M"T0pD P-R lRC 5R -R| `H@P{2 000E @PppGWP ePW pGP〢倲PE0%S``PX奧pW ;sR R`6pTP`2唧PU W@1 000 PPP@U aDP@ 1 Hp HP lAh9X @P &H@P0S0Sp@Hp괠0 0 ̘ `X0 R P!q *S0坠 0R dS (1'pv   TTTs"'oh%#<|[%AS0@-DMX0   0@@DPU#&@0 e#   (0P x, pp LdDЍ0=ڍP ̐' 'Du-Y %/ v#r vvrp@-t00S 0| 0x 0p0p p@0   PU P@P0P H0H P p~ Pp''Ȑ'ܘ'%'%%%%%p@-@0@o 0 0@0PU@0002A d0 R 00CS0H00S p@^@C0PC'%'%ȏ'@'ď'P/p@-@PTp000@p@-@P| ƅ@A-@`PpQP-U@QP00  PP 0-U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp x   p@-$@P0S 00Pp蘝'Q+  0 BR@- c M| 0- BS^0@Q ^ 40 ? 0 C  / /Y''hp@-hP@`V Pp`HV4,0ꘝ'-C-MPp`@T HjV@P ! @$       @     T  | p d X@<  Hy <u@ 0q $m i  e a ] YU Q M@D@ <$A 7t@  < S S  SH  D6 C"VyP   W        @uą0ST  l" X@ t@W `}t @ Dx8l ,` TL@4(@  T4 @QV \ T@Dt8 0d| \ x Lt  @p8l(h d`3[@V RNJ FD|B@l 0@:TY Vl2<08 *(@@V  S W   2VxApr`VЍ00 d @V   Q   0넑0l  @ Tl@ pƆ$*29@GOW`it|ÇʇЇׇ *m29AIQZd q׆%+38?FNV_hs{ćɇч؇$#uiq1:@HPYah@-3 u vh%@-,0, P 0 0 e먝'Sh%s@-@`d000 #S@PY0S  0U00S 0 UЍp}0S/#Sp@-@,P$p0P 00p訝'Sm@-PRP@ p`p 0R" Ѝ0"S0SO 00SS  00@Oh%@-TPL0 p@0"S7UЍω'߉@-T߅PL0 p@ד0"SUЍ'p@-h@P0S 0S 0SS <<< U   S(000P 0p踝'L{-p@-Px@Q dTݐP L0   P    pp@ @ I'0@-@PPM 0SLlD00Ѝ000 0>P0 0 bԝ'zO-Pp`PM 0S<H;$ ,z P 0S ߍPꃯ0Q 0S (@s?0P P@ P@0 ST WpU: 0S  H 09/PV` 0`긝'UNJ@-0S S S8 4 ЍoS$ ЍꤋQ ̋7@-lP$ R\T;@ H$0S p (T T Ѝ0踝''9dp@-@P 0Sp@埉0PS 0P000Spꘌ@-2PD@D D`DpD0S600  h%C-P`PM 0Sn00(p/p0 AP" @/Q `0p0@1P T0p 'PH$0@@ 00Ѝ bԝ''G-@0X T1 HRD2D1H#<(( 4 $, ( 0 8 4 #4R!  !4S !4S !4S h!4S Lp!P0S t0T!T0S \p(HP8W TЍG 0S. a``  0 0 0US !S|  !3 \0US:3 0U  $ 0tpP͌% <n Ȍ$-6?HQBBZbjy(O-Q ,@QlxP0QT 4QP@kPQ,e80S,00 80<0S804 <0P<SPP<LP1 QB"9B`㤱8X0apS pR  1 <0RX*P 00< S4 P0S9`(iQ (bQ @P0S0 BS `a 0h R  R* P*da (Zꃍȍ''i7;hO-;$M p*bP 0$S G ߍS P@T[D@P 늤40 婫X ZS' ("$0f0Qf/ j​,2!S!R !SS0䡟1,21S 1a(!"$a$"R R P@0 0꘡1Q#>00 Q,2,"b"!4b4# S 0 HpP#> 0"448#8 R* 0S 0p=jX P 0S 0 p/1Sq j3  @1S jQ f/ j 01T T %Hl 갣''VEW}}WEVݏFq'%A-P@p%P` %R 0R000005Sw D $0f0Q $Q  踝'''p@-0@kP  P$p@b$0@-0S ,P踝'@-P  'O-@:P,kCM M00 8P( 8xP008⩨80p0SP :%}P  u@00 周Y x 屌P 1(p X嫅 p@ 壌P$4 X p: 0 $0%P$0S  ?$02P #P pGGqryP,圙圩$ pW 0S$00k P$00 P$00$0 P$00   @GP pWa 0SY] 0 0$0P @2 8$ 1\ t$ ]P( $0S  S;Ƒ8@0;RZ((  P  %P  P0 0$0P$0S ++RP0 0  |ދ P 0 0$0gP$0T0 <͋ P 0 0$0VP$0`0 弋 P 0 0$0EP$0X0 嫋 P 0 0$04P$0\0 |嚋P l啋P 0 0$0P$0d0 (僋P  50$0 P$07 q P  l50$0P$07 {` P  (50$0P$07r jdO P  40$0P$07a Y$> P 0 0$0P$0x0P H- P 0 0$0P$0|0? 780aJ0S0S  |P0X: `X0 H0I070t 0 ST 7 . 2Z/ \Ŧ0S 1 #0Գ000S05 0  3000"0$0 0 0 $0]P {@$0!S Ds@q0$0|2$ 2 ,g@pCލ Ѝ0S 04  QP0 [hP0!A"A0S 0崡0S 0C RS񟗚lblbbmblbb4mbbbbl H@0S0 0S Pz  0$S 崉o 0 S Pe ~ 0$S~ 埉t 0STsl 0 Sk PI b 0$Sb 僉>W 긝'zaAT* Ɛ%$'&5C'}'R_s֑̑=ԝ'< h%^bs@-`0PU V  P@P hЍp`PD!y 00ex0@xV < DP$00S @-u00 %p@-@5S4 0PSP p@_Pp0S 5S 1S M|Pp5S T \Pp< HPp (( PpyM븝''0bedArdAs@- 1 AP(000(`;a5 S4 5S P0S 0S005S  Pt p0pP"5S ЍpH DlP8 WEV'fdmd& %q'gd7@-@P f/㺆@' 0 I %'md0S/!  -3@-PmT P 0S S@@ P@Ѝ0@ Ѝ/긻%p@-4@4PQ?p@`  @ %@-t@t0MQh  `P0cS CS SS 4`sS00ۍ0'cԙ0@-MM@` PP 00YSP ,>ۍЍ0nP / 0 ꄣ'%@-@M0 vP  ۍ={p@-@$P  0p@ o%'' @-YMM@p p\YލЍ<0< S <fCPژ10YS<0<0\rdAQj@-PM`p;@(;<<~<`8;5=v<  Ѝ譚@-P0@ 0$S0SA 0`Sp7 TQ,BQQ,Pt10S+ 8@0 H 000!C0ASwvvvwvvv(wvdwvvvvv 0j>`(p; 0> X0[> L0 80S> ,0 0K> 0'К@@-\@\0MQP  HP 0nS yS0 $)00ۍ';P `00CS`0p S00 P0S X0X /X긻%G-P 0p`0U@P QKn pGτT@Y @ 0@uH;4`P92a0C" 20< S :A(# "YA x5|%.A  p` P0 x5< A B0qpA A 0Q<0PAHx[0x5< 0RA | jbP 0 000S P0`p崀(V R s S 0 00 0`PX ލ Ѝx % ]{x #ɞN|4'%' - BR0 R  A-P@  R1!  0 0  !X0 X0 pX0 \ X( H , < 0 0 8 $ 4  <  $ $ $ $ P  T  ٱ0p 1R0S*0X`p\PQ  VlıAu  #,>Qf|ơء tbNO-pᔀ 2MSR R@`aX 8QU ,[R 0屃0 ᫃  0@" b  8 圃,  ᕃ `@04" K  $ 02  !R21` )  0S 0C RjSgꨉȉ  1 0 0p 8QI 婂T  <0P+8BQ* 8 0A0 @ 2<0P+8(Q *ЍO0 0 0 0p  d 8 T ЍO-Ѝ,5 QYC^qA-@Pp(D <ư`8SAt 0`¢Ң 0`( "4`#/A-P@ "440 "440 a ]((,,004488<$<"444$D"444$D"444$P"444$"444$`"444PTTXlpXQl`pQ("448("448P`0@`V@  |0TP0A0T0A T"440AН'@-@l40Pm087f/WEV@-@LP TP8#!00Q@WEVН'80@-0@S B08f/|' 0\ P0//@-$L0 D<<ѯ8@8P(` RD 0 h%C %BP7@-@ PTρP0 08P8 0 p0 E Ѝ0'vd0@?o2P0S@- p`P威@P 壁P 垁P 噁P@V@l吁PH@T@T d p0 4E@@ ЍVF[Q4'ud0@-PM xdP@` D p DkE 0 400+ +~Ѝ0'zd@^o}s@-@ $ p KE0  b0 \0`P   S0   L0  hE0  P>0  87Ѝp'td@ɣ&Nr( p@-@PM`Pi  p  ( ]V V d PЍp (yH( p 0D 0'}d(@Ϥ`~d(0@-PM @ yP 8D4P 0 p0 DЍ0'{dЀC-`0@Pp!匁匑,M00 v p0SP@TTA  ` p  0DeP qP p` $0Q 00S*@P eDQVW V 0n R00stP 0S,Ѝ00* *  c`@,%,'|d/>sz@-P$M /@P p p"D0P M A0P 0P` 0Pp@4p@ 0xv@dp@"U@@Pptcidyararbmngntsuz0D S/ 3C5C$1 4! 8<0/'0@-4A QU0&Q  „?/.01 ^ L043c 0P0Q  „?/.3@01 24@5 ̎ @' 213/P/'A-PT0p(,`|@|,0T@@DA??@'?0@-0@0 (20,20&z0P!P30'> 0R//G-`0(,Bp P z E|@PPW ,20CS(20CS G0'UPp@-@`42SM%^  E 82<"@ 0(2,"Ѝp@<"82E@d` ,"(20@{X"\4Ѝp@u'l!%YbʫUis@-P`~  >0SЍp00S@~0"S1Ds@-$MG@y00  0 0ph%A-`P 0p @Tʬ? /,s 0d  ? tqp  RЍA<L`90S`@D@,y Ѝl!%'A-0ppP@`ph!14P S H d" R S R 0 ci/U'ݯp@-4@P0S(  ~0B1p'O-PTM0$ (00#,0x0@08030匠s0<080S: (2,3`D(0,4 0x40D$04 @?x$0 0x$0  00 x@ D00ubd"P D?$0( 00,0 a  0 RL0 $R0 S t2000#1-R0" 8LL`P@4tx0P00S nyP  hyP  byP% L`і0L00 S? x0g2< tjE%KUP1C?C$5\"0:xP@\2S@0x0@XRx0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (0 0,00 0h @$PTЍ P @Z'l!%('%Kh%knr-s@-@00CS0 N7P` Pp ppk>0 P00CS0770 Y@oЍp@Ѝ/ḻ%O-a0 pE>Pp/B$0e@O 03sqp Ѝ  R ЍO]t`x0S 0 sqp `BE,w D0S l!%'p@-@P2S 0p`n/(2w1!41#41U &"U 80U p@@PC @X|@Tp'8''G-r@,t`P =` VPmYTLE J$`,,|U 0V!U ! [E@s_Ps QwX2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@t000'JA-\P@PAds 2Fv t B B$p`00C0'O-Q40 Ѝp0QSP LaXR XF0 pQ 0>80Ԣ #ZYPPUJ0U @DQ ČUȌ̌X L X0PZ 80S 0sPU*‘ Ұ'"O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q 32 $450 (, T02Sx Y< ЍP P倰[R21 RS$ [0 0 2S Y zP{<Y 200p@`p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$K_00C0@@PAy`d1S  14P8 <   00P2S. Y  a14a8a<0#d1a#h#0)S :Z0)S 3R0 *Q !P900 0:f0<   0S8&'ɲ T*Ҳl!% "V̳U>a  I{(1A-4RUP@P@DЍp(0PPPB1P@TaTaTS <ЍA0!14!8!< 1 11p 11!1<0  11 ?01!1<0d  1P 1@?0ЍA'-ʹ޴(9J\O-0P4MpE``d,0 q 0Sၤ0od\,("/op" R 4 0M 0  ( [ 0[䒑 Yy @ `D pH L( @P 0d0h0l 0XS T0@Pt˟( ppPppW;0} @P8 21S /0.3p00102044p58<0 TTpQ4 R:HL"T /"R, l4Ѝ0(2o0h(0}H 0 (v 0 (m wpUt  @D H L(@P0PXB(@ Xv  0 `d0h0l9@`V2SjW 0l !? 49 r,pi  R    0$  $  0 0@PPT0p V0S P8`@V 0PS$0 @0v 000 U 0S@8Xb\" 0qSR ` 00 RV0P@0 0z P`@,p0S{ 0 00@7P2S W[: @P@~  avv 0@ pR,'0Q0Z08!2 @PSppaQ $ 0s ^A$ D 0 H L@   @P0|21S  "/0.0010T0 3p2044p5 8<0 T @P @P2Sp 0 00@P52S WC[ @P@ 0S7 2S H"%>0 $00 0S- 1S*  W000P$  00SW0!14!8!<!14!8!<W p$ $PLPD(P0 S( 21S$ / .0$40 81 <W S  PW 32 $45(, W\ 00$0`@P`3"Rq2S0 h60 00@ P 40 00@ PWS (00D#$0 #(#< 0&4 0&80&< 0 0p `xR0 @2Sc BT0cp%P[ 0 1<Ap 04@@,2`0C 0 0@@(2 00p ? 0@@pp0`Fa ??`1`<A` 0@@,2`0C 0d0@@(2 00 <0@@? `Fa?`?``0S 2S@ @TJ041S0Sd 0s PX2 0 RS  0A04o(I'-m'% &7GSO-HBp42MgS0宎P(r(b42S 0P*U42S 0S 啎PqЁ 42RSfP:冎42S]1!$1(1,ЍO0Sd S^` d04兤Y2S L` ` ؠ0)P"PR S0SЍO:+@ D0ЍOSP 0Ѝ'a%'rҶ)3@-0@M0@ pp`PLpߍ\ n0  0 OP \ st02S 0S " `P D\!SR 0PTiB['d0@-Xa0 0LAP d2S8 P(N!p! 2SP0U0 $pt"2 Rp\EU$p$0 00P d2SP P@ Ѝ0P0!!1 l!%'md,'ַ8'A-@T2 @PpP pP pP@ `p@T 00S p`V@pPD00S @@p@PPi[{8'!%A-Pp`'@''000 0@@@A-@pT` mmPP'0@ @'@>G-M0h4 P@ TPD >pP @ 08pP(4 00(0 4QT(0 ,0'4@ 0#0@,0S @@((@`@,0s0000CP倃0P>PP0 !01P,30  ,3Q #  c0T0< +p@8 PA ,0S ,< 00S< 00@ $\P&0FSʆ`\'P0S -S@= `P00@@P,0S ,^A0 /QP o8800  0 R00S' `410XAXQXa400C0 6C2(r0S0S!r0S0S C 0S C CC$0#4 ܍p PS P8'~-;!%)0/,'0/,'0/,'-@-$@   6ch%G-P`pq@0S  0S X| _U HTY0S 0S@ -,'zi-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @LPPݍ Ѝl!rp@P=0LLD@rO2P,0: S0RP00 0+PP P81: S  S U r+PP--P%PPPU r#PP @P,'E<'Td~@->0P  0 00$Ѝ  <'0@-4S 3/ ,'@-p0 @(1 0$8lp@' ,'@-p@4_+l(lp@@-p PL`@@0 7/P0 S Ѝ _00'O- MM06@  @  @ 0p$000 (0V-P(LL`@ ܍Ѝp 03/0P0   *#P @$0PS (0SDUI,`P 0 W U euX0YpY 0 `  W Wp[ 0S $P % 5  e@uUT \ 0@W0SU 000 !00S# 0S,aQ]00CS0"(@ T 00CS0!( P @YT Y@DOoB 0Q   @OoB\ 0 @0  0 0 SNT'LZ%%R0@-M 03s0c00@S oPP* R!PP<] 00@  E 0PS >PQ `Ѝ0S 10S +0S\0S\  0/@ \0Sp 0@0 @Rvp 0S0S @g0S嵇  @"  @0St壇 @D HP@ @0 @ `!0xP|"%#   T`    P @@``a/ "] x Zp h 0 @`'''d|jz(_G-0@  0aP 0S< 0  Q*a  xPPZ   0`P f pЍ!URQ PB l l0 p H0 0W40p P , 0Q0   040 04!$0 !0  0( 1 0, X0&`P`  PD 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0pb00 QP   @ 0P GP |yGpP1S1S1US1S 3S3S3US3S,  pP0p* p2 02 121300p0b00 QP  7   0Pp00S1<01@040  0b40  QP   0PA0O A0  5GP 4W ԡ 0R  N eYX`V P0Eh 06#++R`HX8 $0S,0,  RT0ChD0"P#10P  0QL \0   0P 00P00h00l0dd@ N#=gRRaArrAaU?sL@-p@`P P00 P0a 00QP  Ѝ 0P< !@ !0 P0a 00QP 4 0PN@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  k ,zP000tb G-Xp` P@@P W Ѝ0!0 0LaXY DF ~X0 X0 PO-@,M0p@l@$0`P PprP$P V@,Ѝ j0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 S 0 Q q 8( $ 0L $ P 20 2 p(p,"  @ "  p@! P0@ S  2"!"0  0@p={d0P s s// /b O-`@PpMP0S Ѝ X  H r0A D00 s/ r qh  \*P0p@P q x0 ` P 0 00  P 0 00 ` P s0 `P pP0 0 P`8P *u "R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0pO- p`0P\PPX $P  qQ0 0\Q@T(2 R@0 P" R S C0BTX t0D s  3 0 TX  R 0 0 p pP YP  L BPTR2 Q PE9pO-X`0pM@PP`Ѝ Xh0Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/KP Tc  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0!  0d^0 QP \ PxG-@P`p,P0S 00S <0s+@qa$0S  0S 0S,0 ( 0  `0S"P  S`pl S HDpP@ q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hPP0P Wp0RQ@0@-?`XP\@#@3P@T@TpW @@T`L'O-P@H@M18p p00TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ0 0 0m] Q P P0 W:0 0 0Z] Q P PLR 0 P<0T 0qB'=$O-M@L0Sp<`@DH S!-P PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:W{' A-@/pp0%B?[`0S ~a0ES PC ap@@0T?  C0'0 PK %/'O-p 1cMW, 01 SP0 S@0Pp(0@@D0 0$04@|D0' R$ X0`1#b#000<< 0,00\<00 QP cߍ0P@4p(0@pD0 0$00 C``02#  ,PV002800aL0`FL08 SD00S   80< 2800,000Z\<00 QP  (1 0H 0  RR R0(104D0L0 `0L0C < *9P.  (10(11  J  , 4 0B0 D0P 0D S140S  ZI@(1  0I0@;+ l P(10(10@4 40 0S_ 0@ H /o@0(0"s R$ 00P p, 0Se0(00$0@0S@0! 0C@0 0@ 㓲"X 0X  PP  :X R: U$0p 00pP0 4n U/0 00pPd(@\Q UpW$     Pp PK/\e g0x!P0p00pq P$ b QQ#hQh  0 U P p$pp000 0000 ,p@Pp0S*0  Q .b A0 b @ @ bρ LG?@@0Cs PQ*W w 04L |1r 8 <|1 0W4 8 <1t0U`0  0\|xQ1PP|!R \  P PPL0sPP|!70I|1@|Qx1U0P U* SR   1S \ldP@ 0I 0000@14haPP 1|!RJ PP 1@]300 0Q (0R| U$0p 00pPt, uZ000U\`0) 0$ (\T P0000T 0 00P0 00 ,E@W 0$ Se1Sb I_1 S0(0YRhkaP0S 0Sl \d|RR P0S02S 0S0SV 0\2SJ\E|!2xQP >PPx 00I@ s 1 |1P 'P$P PPPPPPL0Is0PP@1@S!U @[Sh`P=PU p|1WS P@ |qppL0Ispp@P !SP| t<PP 0 1|10|1#40L0s_?00010PP$ K/\b^PP05P 5P0h00h0Fd 0ES:\P P|!d1HrH"HP :0 @0|12PPp818 ,80PI 02S0P0 S0 U$0 P 0c000 000 000 ,@ D00S< 0,00CY<00 QP80,R0 oPI Pd01S\+0!X&P %4QIP0%8%\0 P@i'$= A' ';S|Ok - Im!G- p@r W pP\aPP Pp $PK/9bD08QP0Q:" 0PS00  Q pJxPh`P 80"8 R 00 05 !$x'I wp@-@5%SQ%  5%QPR 5UUQQp  0Q   0Q0  'A-lP`5p{@ @ 0% Ņk@ŕ\'O-POMp0P* b5S 5唢@TE  _P@ ET XT 5d 50 ! S$5"R$%P0SOߍdP  RR @`0d B2" 0W JQP d ,d0P Eh0K/0h0 >a0 @!,qr0d  01(b\  j (a  $a,10,1#40L0sK?000/1001001#40>000310 00 000T0 CW(%,5QP Hd d0P ' '@@-@ P 0 5'0/ '0/ '0/ '-@-$@  F ㆮh%G-P`p a@0S k 0S X|b U TWY0S 0SK@ G} 'zi-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  NC-@M Mq` @PPݍ Ѝl!r(p@P=0LLD@rOP,0: S0RP00 0XPP fP81: S  S U rkPP  P%PPPU rPP @P 'E0'Td~@-c-0P  0 00/$Ѝ  &0(0@-4S 3/ 4 '@- `0 @( 0$[`@S' '@-_@N{[x[_@G-`MMP@p`PR0 `: SW/Wb0P  rR _00A 0C @H#|@ V& 0S UP0P帐`0PPJ0: S,^0"-@PTP&P \P  PP @u3M`@ S @ S@PPZ #PPn UD e-@+S R U8>PXp!t0#PU00`P00D!M @P2  YP8_0S`X QPEP0 ;PP W80% ܍ЍnPUz f~Uv TrU   F.F F@ 0`( "4`#/ p@-"440 @"440 P"440 "440`> $(0 $(Y XXYddhhllppttp p@-"440 P"440 @ >>>DD>@@ >HH>LLPPTTXX\|`\ `SYp` pOY p@JYp@-`@"QUpf@p@-@P====pA-P@M4Q->C=->CBX?X\<\99>=9>:>C=?n:>CF= 0? AC>=}C>G=mF=EnF=E~G= 0X J~XpW  $$((,S>,j=}S>Ge=mFa=HHLLPPTTXX\\O-P ! "441!"441 $$((,@,0`Pp0Q࡟\5 S L5sp`PҀ0,$ $Q p W AvTrTpXnX\j\`g`dddhah`l]lpZptWtxTx<0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 PT 0 0 0$ 0p p(t(|(A-P`E p@5p0S 50S !SRp5p0S 50S!SRP @P @A-P`p @ `$P`P 00@AO-HMQM k&80< @02 0B_ `P?T VP( ,PHr 04P`P (0, 0S/(0, ۍЍ10S*  1qVQn8.#4n4#0綀.44(44 0^ 0 0" R?"R0`00L48Q"  P`k  >0 0 @Є"44003/)  0 0 0 "44 0^000C =0`* 0=l0-60S )U'0 0H( (P(p(|(t(P(x(@-P@p`AMM(& t0 P@ 4U0:t0 R0*d %@1P 40  P,, %AލЍY10(7@-0 Ѝ0@-\M`PpX @ X0H0`0 `'!P0DP0S L P2 \ЍpLt 6l(O-P`M0M:YP3P#6 PP#Y0P#Up ލЍtX @@X006否D08H00LpSPT`0  D6`Ɵ 0GS  0PFSſ P 0 7SU@`I 0 p;4,PZ pl뀕 P0 c0C CN1L1 T0Z 0100 0 8}600 $ 0000/( $4   0 0P  B b", $>̈X <00!Ч8 %8 !(0 40(0,0 R0(<0 (0Ṣг R 0 $ R R  000  S:0 0P00 C c9à30S00  S8%0@%0L  (0Sw ><I z$20Sg q0 0 0 000$? 0 6@ptP 0 8RU` p 01S0 $400(!(( x(o? khn4k( h(g,0 R0(40O8L @  H ;! 0bM0P000 ʏR0T A'' 0'2 P/,P)8 $t2 t0 _1( @(  Ph@h0(|6l(H( (!%((O-M`@ ) P0I: 0 @0P40$? 0 ;62  BQ p{("(qsQ<042,0 S000#000 wD2pQ 04  0R  @PЍ( 0$;  0 4 Y: |10S<000D0z`&2 `0 0: 020S 20S 0[` `$110010S ?p1p1000 . *d (H(|(!%p(l(O-@PFM M X `Up: 0 5 R|"0hSD 0S00  000S Fލ Ѝ$o00 10000 0~4 H0pT00X0400!0S \`  " p$0 0[h~"`.P P4 p\t4y"0S$ L000 0s HP #0000S o0  0v.P0K 0 8 s@ o  0 0S r \  P1 "d.P Ѐᴢ L000O0 H I { 0-0X0|2 0J0  000r00S$c 2j0 0H 0Hh [ Z0# 030C  4 S 00403P!op1 0O 0O0  k000C0 0 S <   0 0001    t0000 0 !0vs  0: 00S (l((!%Tg"((NlLw0(ԣG-P`M@HXpAZ 10S t10S 00 0N P<ЍG(@PEU> 1 RP1H W0  P!`0 H0S$00S U  0S Hn0S G 0@ЍGfX7-P H0 ЍU((((!%+7( 0`( "4`#/p@-LP@088200@ 00 !/0@0 Sp (00S 4 /|( 00S/|( 00S/3|(P000R0SO-`02@ RPMgD R0R0`ď080S  C/ S ! R 0C00 0@2ἰ? 0aNp\5h!S 0 00Ϯ0 ?@U '  ϬR7 R  0 \5S0 0/070/0 0 Ѝ  [ T R  P00 0<00/8( ((ITqP0O-@P:1 R0* 0똑嘡0 `P3Qx 0 T B:\500 M00,"1p R 0 0 !Ž p 0M`0 C c00p0S   0 .0x 0M T0 0x 0M400,00S Ѝ0(( (T(l(O-0p#M PQ P* D'PW0k:, `\5 00 RM00O,"2@ R 0 0 !Ž @x 04M`0 C c00 d0@Hb CC cA30B$ 0Q,040(0PÏP0 8@,10S 18P0XpC9 ȡPWEʸ0 8,80<01p!0<S0<0<0Ѝ U8  P\E1EE1k1 U0010 S0TP0S<0ذ(?0WTE4U  P 0R0SE ?Z0:P0EU 000Q( (T`(X(l(\((t(G-1P 0p` ~L   0<0@ 0S 0 0 80PS `P` 8UH0ZP000PS cN`4OQ$,$ (,`(PP8 (*(l(O@-@8P 080(G-衟0PSN 1p00 B?*L PCP` 0@`8@Px1 ?L`10A0I00 00 0 V0 (pp1 p#",`(p ( W Vp`0PQ'd0SP 1@0  XPP00Ϡ^P0d000 Al( ((((((vP0p@- P?@K800P 0 c!SRp((p@-X`0SpL0LP0@1CA0Sge000p_((( 00 /(O-H0MSPp` M 003/ ލ Ѝ30 Pᴣ00 +0G00@0 tp0 ¯ S 0V  0>K0W0H3p!0S& 83Q2Qe *"0  10 0 0[0 02M+ 2R2 t R:X;000TP  $^$+P"1 Q    Qt Qʤ1 +!!0Q3 !03H0 0C?oR20SF <1B 8  +B$(P4 P R& P i P 0S 03/     0P  0`V b8 (T(l(\(t((0O-S0 00㨄RM`PV@#M( ( , : S \ \p$(5R<R ,P  RSV 0 0h0S  lJV ,dJt0 PB? J0`p 00p0S 00W Z 8ő @5D0LT 0 a31 Q>P  10@(Pp 00 p4000?000S* A0 0000 0 @0S$p0Yl 0 `00P $ 0 00000 $~hQl( (.@- qkh%s@-@P `⸮0S 0S 0  ЍpO-xEM` MP0S 0S Hp P 0Sލ Ѝ 000S  P `0S 0S 0S >0S} 0Sx 0Sdv0SP.0S 0S0 08Sd s/2#' 00 " " 0D@?!? 00? 0}C 0zCd!! 0sC0 lpP50SS "04 0 R0  0"? 0 , R*( ,4ï0A8 ?S%78P0<P0Q R0" |0S lhbPUt @0S HDb@PUn ,0SP@PPDPpH0S  `Cn* l,xl%|0S ll@0p00S0P0/% 0,0UA:000S 0S P H1 H0S 0S,0S P  'P   000(oP 0S yP tPP |P(.Ch 1PkGN (~O-H0PSp`M W0R0: P p`0"E,"0 S n20SQ aЍ@ 0Աԡ 0 000CSY?00 1> R. P!\!0  S P  P (  . 80< 0 @80< `P0 W P 0 @$0 S@ `00 R 0SQ Q\ 0X((L(D(((((00S 4 /|(00S0`( "4`#/|( 00S/&|(O-M,M1@"@ pW0,$ :00`SHW ` p!P( !XP 0 00 0؍,Ѝ:00 (!P  pX!XPh0S  0D k@ P c0S, A ; ; Z  W 054%00! ?0S S :00/0S 0 S :V00#03  R00S l:0S7  0X 2P: 0S R< kP0@S0z4`Ə5 K)Q9000 B?@pQP%90S  0  0 0 L 07P 090S, "ATP09 SPp0 SYQ980S5  V0;R00*h0S- 8((d0 #0 (P fd80S (0 0x0` g@ ((d*70Sh0 0! 7'(5SW/V S:'<V  3 #\  RHSQ; 0 0B D U0$00(p aL7 UPP0vX ZwPe P'000z@ 0PP6CPy"9h0SPp%Q_'qQ PpQ^q U0 EpPQ Ppt A?7#Rp 10S0AL 0(  Z$0S 1000S 50S $0S 0#  t ??$0S 1000S 50S $0S  < 10S0ꊡ  0_000 04 0 S0 0 00 0 0h$0000 #600SH40S l4 PP @pt3000 00S1 LPX00 H00SS9 0S 30S2 \P&  0HJDP  2 prLtoPd62 0\00Q&&0: @000S828040/<0a0#PQ8`\@P 1P0H0800A@Pa`ppPU0\(85  @5D0L 0T b32 R p'@ `글n|$\5Sc%Ϡ<# pD ?(0 3>D40S<40W SW ,4,t`V0`@0x@S d0, ? 0 0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0X30qA101[S>  0(A 0 Ń># 0S  !0S\000 T@T`V T0?  @`@T` 1 0X20qA000Pۿ0P0$WS !bB0 00 pS ;*00p0 VTX0 @ PX`` @W0`3V5 R 01<`7: R 0@ 0 00   0K0 TR 1VS0` 0P   W@*  A 0A 00( (TL(t(( (T((X(|(l(@(h%((U (X(2O-` @ 0Mp̰̐ 0 0  BRЍ PP U QP |` @ pQ RP Q @pp(D( 0`( "4`#/O-dMX A0PpP0P1P 0L1L H1 0,0SdЍ0S @d0,`_>0 `00@ట 0D RpT0 :H`P 0RA0 ST TX 0S @PptSh ((@(p(_h%l(|( 0000@/00S 4 /|(00S0`( "4`#/|( 00S/ |(O-LM`PV`@@M,:0S 0P *S *`0080< 010S y0 n>P0 X P ) P9`0S 0S T)D P00 ,9 #R0p0,0S0100027(0 0!"4410< 000800$k0P@ ` \_W0@0C0N p@100S 0z =P 0tE0 S$ 0S '00P7~`| .0,0S0100@06@'0 0!"441('p` 0pp00ppP*0S  ZPa 0 1$`YNPU @ ` $ $80< 0 80< 0@0C0Ɵ 0 00 0Q.*0S  P  0"pWWލЍ0S 80< 080x5 0< S dY0 00$001 k$_ P 0S 80< 0805 0< S Y`0 00$`S! B("( p F$ ⴑA$P@180< 0 80< V00C0 80R<.PSR$ .R  $PPP3P`080<4l3 R0 *3 006P2 0 0q$Xp0AS񟗴ꨣPP0SS 3 00 20S40000MP t2 =#R0؀2 00 #R0tQ& l20S`20ST؀ 0 P  : S000 0 0 #R0 Q   0tFQF?d!d  @10 S& LX#R0 š!ɡ0S  0R ؠzP1  000p0P``0P00C0X?P8\  l(t(0(p(G(|(I"an(a(( +:O-WM M'0AS{ئTx T- wP 7 ` l hjP {P7 00T@ , 7 UP 70S 60V6 .*X >0`06`00100V0:6 Rp0S:`@aVyPVWލ ЍT P@P   3o 60S b @ F LqQ0 0%0@(0S S㘕u%p3;XpG(pP, 5 2  B. !@ ]450SW 0$0(000]/0o 50S W(0pAp;4pG0(pSD ZpQ(?R,p_=40xpS@09Y(0G5 ?,0 S1 # (R& S000000Y!"!"5 dxhp5  (  ]/$   ,0 S1 #( R S),)-*-ؠ d ` p0S(0S , <2(p2W ,@R@ )' 0x AT!W"!"dh TR@ )' 0 AT dx@0 (0S 0$ QP 0  s00 ~ 0$ `010S x10!l10!00C0L10!tP0 Y00000C0!" {pI0Sz@0y 0 0C0t 00@oVn(lmp((((P(G@(h%l(H(( (+|(7(1K00S0`( "4`#/|(O-В"0`1CĢMa2@Tߍ0S Pdp@FDAG@D0 ddpG00@00C0 00 R2PU 2PU0p 0S0S)P@R1PPUPRPU P0:0000S 00"P D100C,(P X P;0P0!!0` 00p0SL" dTaX}!Pe 0 0q X000pATt((@(eh%((D(((fl(gO-p3张P M`@?@6 \P  ? 匣 ? d0 o6d30S\30T ST 0H#S 3S 0"@ 00000CSFTYr P 80R000303L32   ?5` a2! Q,S Q0tB*d2D20S P PB PЍS  ` !Pj?00 1>!  R1\ 10SK0T!  0d!S@1`0 ? 500 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0 ؠ<0 *Pp? ((T(X(|(U P(x(L((((00S0`( "4`#/|(O-plMX D:2嘒嘢00,0SlЍ0S @d0,P70 DDPi000P0(@1 0 0 0DRpT0;:`1AQ \`X00X00@SR|<< Dp\t`d`V %P 10S  0匽@P=P 00S  0_Q SR  00y Q  000 P  H 08DL (@(h%(l((!K@(sO-oMM@P`00 }90|2H?0SX0S $5S$0SXPYX0S $XmX S Rܞf>`0Vd2 P\20+! `" d" BH900!X d"B1h21$\Pl2LΟ\0C00p21`t2QB1l2>V 2l20CL0=SLq Q\20B  0S 0 $5$> *>=0S ,0 0PS0 $5B111`R B- 100 S  $|0S%  0帀- 00$%BR0Ө`S<B11@%L0ᙷPP H VD PN 0S  <Pt| *堀W`<T<0S 0 00\0 bA?L04<5A?X0 =<0T0.H0|8t; 0VHRQX0h0@ @0h88 84<ϠQ b{ S Q,0 S[?^ @P= ;0S @0 # "@0A!" !@0 ! @ @0| ! AP: @ @_30009|J*p: d:0S G0 0؍ߍ0<00<`/  `!.0i0S pd,4 0 PP )000^00/\<$5St2 ` 0h pp WS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0qP3 !D0 R  "0 0000 0 0øP1  "b2* 2,20S #0 0T20S _H 0P 2p"S\?"0STT< P VbP2 H 0"bST 2"TS\?< ou0 0<30S 2@#S?d?0`#S\L P  -P 0#S\ 2#Sd2/?L c?E0 0$ppS $S00 S0`@$Sd2?/0?`$0S0\0000p`X 2R`嵟\ 0V $S`0?0$ 2Sh2/0^>00p`Y7 0%S0\000S7囡!"TpW`l嵏X7 0%S 0\000S7囡!pWO-P`@DDT(Ჷp ᭷ W @f).A-Q0 % C@*r`! 10" q0SU 1玷0a&0  a*1t10S 0 0T 0@# 03A0S4 M@ 5*< 5_000S 0 0@TP`UA[t0Tp Pd0 0S L P<0 0S ((!%bP(x(|(z3J(0/t(0/t(0/t(-@-$@   8h%G-P`p3@0S  0S X| 4U TܶY0S 㓶0S@ ̶t(zi-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  ӴC-@M Mq` @!PPݍ Ѝl!r⭹p@P=0LLD@rOP,0: S0RP00 0PP P81: S  S U rPPP%PPPU rPP @Pt(E(Td~@-0P  0 00ⴵ$Ѝ  嫵(0@-4S 3/ 㹺t(@-20 @( 0$ .2@' t(@-2@ !.-v2@P/00@-0@S ӵ@ (z0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPP  hP R 8 4 Q  0/TTT8 (|(P(T(X(T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/h((T8 T 8(p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0=H3H3L3u/L3P3P3T3T31 -h p@ p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0H3H3L3u/L3P3P3T3T3 EEP  4K44K44h 4 5 5d0d00000P5P5H5H5 @ A S>S>h p@Y 0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//l(O-|4M X hDhhdhP@quP:|(s (8 h(Tl((((x(((d(T 9O- 0*MM08Pp喷P/? 80S ' :P/, p0: S X gPލЍ48H0,hSO 0)00S ʲ00 78 7 $9   w` r8 l8 f[V``Z`P`L7VD i,7P Q ήP 坓ᴵH8P0 0w86 R>0 0p 0<&0&0P7p0p(60pw>0 P0p(2S# *,P *,P *.qVXZ hY 4[ 0SZ?관X V. 0)  K+ <0\:P$V, Q3C ?0)|PPe 2S|3%8 S20#"20$#20PC 2SB4$040404б`02P&V20A2\02@2 0*0C`+ `Fb* 0| (H  ?`0P4tT#0`P\`Q=S/0P 5` ( 2RV0 S0Skc 5*< 5n3 30S 0 0`20S 0Q#0 0R V 10S `2R\\0SD{2= C ,0"000 0t00Cpb&? p0("l `0S10S!0 R=S0S lD $000E p 0L%000P%X30,3-q *, 10S 'S0 0d((A(Tc((gwH(((p|((9eTs&?`T(A<anMr"XEy(ԣ6(ZG(8(L((0((((((( (jp(t(l((2x( (P(x(([`(X(\(|(=SZ0SR  0\p<<00P%X30*Y0 |00S 0 00S5 0 >0S tPq 5*N> 0:#: 50(1u 10S p0 000S(PP0q0*1U 10S P|0 00<cQ0,zP 0r<0*(25 20S 0\0 0倂0 RL%r0L%r0H00q" T 000cH00SPFPr*2 20S *0$# 0 00L40q"  400cL00SPs*330S 0# 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*ad4\40S 0$ 0 04t R,5S0%45S R! t004e0SP*1$5v50S q0X% 0 00刅(0S xQ$ V0S< x 0(%0S8Pȅ*5I50S Dp0 & 0 08%<5HSR$ ( H00850<S_^P*660S B0& 0 0܆@%D5LSR$  L00@50DS6/P<*L7D70S 0' 0 0 7 70S ,帇 0R" 0Rz7 0SQ `@9PLX p *@ Tʰ8 @/  @!. A@O@@P 5  *,@ $)P0 ( 8  Q DI ϠR 5l)p) x))pPW)pp \ 9 1 P, P'Qڨ0Q, D 0 0S }Pz*:: :0S 5a0H* 0 00S aD0S0QQ 0 0S KPz*::0S /0+ 0 0P 2D0Sh ,D0S &D0S^Q  "Q  D0S&! D0SQL<Qk D0Svq D0S0 C0SH0085L0<0@5h<D ,5S0SP ,000<0,5<0(5H04e0/85L0l0<%/@5D%0*D<<0S 0 - 0 08=0S 4=L=0SHm*%T=jL=0S e0Mh =w P%L5s0SB B-000=0L50P5?T5V>X50$E- 0 0B0T ӣ1`R.B!!@tN00 00L 00* >>0S ?0. 0 0@P0 @DT@8 HLd Lc B 0b03"4@ `P Z( \?0S  8 H4L0d @ B b"30P?0S  0p00P6堪@ '|6PpE h0d& 5000T60S 1S <#&P ,6 $6 @ Q V @ 0`P@@  04 8 <%c#!$c4"%S 50S TP 0 0 . ``0  0 04 8 `0@p 05(JO|(}O-pM0P8 0PȀ`0Ϡ," ܥZ 0 Ѝ 0|x @Z ЍOĨ ?  P  ? 0@`(H(KC-P`U@ (1 U P0 PP0 0T2`p܀*0 L@D0T@S   8 H4Lđ0Ϭd @ B t b"31 }0S   0P00`0@T Ѝ(P( (|(\( 0S/A-@p dQ A0\ a2Pa00 SR P00@00 0` PЍ ( (\(`(@-0P@T@THd pL `l0p `̠V W @ 0 0 0P0@0@00 Ѝ0( (p@-`P@XMX  p$ `P @XЍp @-QXH0@S X00S L>004G,P00( p@-<`# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍTR(yX(|(0 \P/Q/ Lœ0|   ,PŒPŃ ,TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> >S*Z3`30S 0P 0T`dSTSIPsCPUU00Q AP 0S ??@S$"P`"hR0"00S8 lr003Pb0S* xB0S* 0R0E>0*X4 2p610S 1]0 00S]<XP10S Q< 1TQ `1*X1` H10S 00 0H10S </< (1P 0*0`00S 0t 000S d0P`b 0{ 0徨G軨t((\(`(P(d((( ((l(x(|(((0(((()h((B( (\O-PPMp8 R B@0S 02 ?Q00@aV`` 0[̑ YP t \P  ?H < ? }0 2r0S0c Sc 0!S 3S 00? 0!0! !0!S`0 0 0` Ul!Ϡ0008 L3R 24  B # R#  B ` 0Q" P*0`0S `& ` `Ѝ0hS  j$  B$ $ R$  B   (8(L(T((X(|(U ((P(x(A-Pph0``ATR %@P<[0S @  1p0A(|80 0 1S/ 0S/(`0 5 /H0P 3S P 3S P/// (^FPO-0(P,0@4p8`h P P0P` 0S 0 S   000 00 00S 0 S P0 v0       ( ((Q 0`( "4`#/O-`@8 0P1 008Q ЍS@pd8Q Q 00$ 0pሀቐp ( D* h* 0` R | X D P/! 0 P  C1  1 @-' 0` R0!!  o/ 10#/C!000P/@-' 0` R!!!!  /  /C! C!/! !/@-( 0` R\"@"$""  /  /C! C!/! !/@-e( O-$5 SW@ lPphU00 `1X 0000$ p  @R ![ 10 <T+EP 1C0 2 @ @Dό R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RM@Xr PP X\P`H `3tP P7   &p 0S 偃ߍ<08 H(00,0 000040!04 04$0D0(0P &WZ  pT hp* \X寎` 8  4yt (t t t t 0,0t0 t ^ ⡦p 0`?`a8SPb 0  0**0P0*  0* d@edAzd@Q6-BA-PMPp`;@ p@P  P06PU00 ## ݍG-`MMP@p`LPR0 `: SW/ 0P  rR 500A 0C @H#3@ V& 0S UP0P帐`0PPJ0: S,^0"a@PTP&P 9P  PP f@u3M`@ S @ S{@PPZ ᄤPPn FUD e-b@+S R UPXp!t0#PU00`P00D!⮠ >@P2  ⺥P0SF`X ⲼP妥P50 ✥PP W80% ܍ЍnPUz fߜUv YTrU R  F.F F@00S 4 /|(00S0`( "4`#/|(O-pX1`P10P0ʟ 0  X 3#ˠ121@ R` 0P萟A00!R00S! 6% 0%#s(0!ZXl000Z T00 pp8P,0( ( (((G( 00S/`|(O-,Mp0`P@ᄡ0V000,Ѝ00 ?U0$p$00 0000P$00S X00 ?B$000 0 Pp(&O-`P604MF06vp0儦匓 Y rP!0i 0 CR)4T54444 1 60SP 1 50S 4 19 Q0 ㎜ 1 Q 1 P  ,50St (4 1(0 0 0 00P(0Q. 0 0! 10 `40SP 40QG(00 0pw00`P(0 R> 8700ğ,^ 0P Q P )Q 1 $( 000`4Yq tYPl 3 4ЍLOPlJPX30S, t? l`$3P3Q,`Q0C,0(@,0h `PX,*0p ,0R0( 000V0A+X T2 Q,``!(@,0)P,`S00@ 0 `0B"30 ,0V(! 1 1S2? @10S 3, 0R00 $00?000P. <k4P1,00 0(0$0$ ئ0,00 00(0 R  000 0`@0` 0$00S .xS (((XM?Q|(^FF^!(l( (,pGO-1APQ P1a`3$MS0_ 1P11r00`00 0p.000P0@T <PXpXT 000/ 0[P'0Ġ[@  0S 3  FP PD0$ЍS (.x(((Qp/((p@-P0 % .  @Q 0S pP# #3 l0# #:>0 @w0SpP p (^F(R/>G-P `$ 0p@@V` 09@`` V`@&!D( `G-P 4`pC80ȠX㉑ ,Ƞ ,4 ă Ƞt,Ƞd0 "% ?Ѝ0 :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-P5>UM 1 !  a0@`Spp `J 0 U 0 0n7Π ^ÌVQ 0V>  0P" G`p P b72 R0V1Q0V"0   P 0 P$ ` U P ``Ѝ2* J s0A-1àQ`P |0| ||=a0@Sp࠱ P$` p@QL ࠁ PQ 2* } sp@-@PaSl0l lla0C800S   0ٖ0080P4 PR*Sp0 * , s2 ,0S/`0@-0@  L21,巖0,0080S 0  `0@觖$ (* s,0@-S ,0, ,,`@TP @萖*  sO-dMPpU`@@ U0!@3 @#81S41@D2s2@Ds1@DS@D5@D0  0 00PV U0#03?b[[U^ `#0P00T5Q L;O000 FDD 0XR @"!$"!L0<p(08p$0 0H(0 0 `,0`4  0 4$N`HP 00 ?Ph40  (00l"P  0,05S00SUSP3S` 040$0`UQនV  0* 00`FD040 CH004`380EPpT`D0H RS@0 8 ,P0Xp\`^@P,Px3Q 0Q- 0CQ%" 0PS THpPL`P@ T@"P$" P0VT`@V !ᤕP` T@!00P0 p0403 0?L00T X oPT X\0RP P/w`04 S2<0%"<0S@p L0 0 P  X Z 1!8"! P 9`"!400 0Q 80080p0? 00T` 0RZ@p 0K 0 P 80Sʼ0 0C800S   0 `O@  > _0@0dЍ000$ (LBAW*L* sV* NBAW + +  G-0,0S0 _P@}`00qW40S*ȔЍ!  0K@P   k@Pp0+ F sA-`0@c,0Sh0h h^PpRQ H0< D 0P@DT@C+ sa C-`0(Pc,0S0 ^p@&Q |0l x@PEU  0P !  0 P P ЍY+ q ss X0sC-Ђ0@ P@` 0 00 0,P 0Ѝp$ (\(X0sC-Ђ0@ P@` 0 00 0P 0mЍp$ (`(BA-0PQ B@`p0P R   T0! @P 84iP'(( (r$ (@-,@P,0S 700( (@-,P ,\  D Ѝ( (p@-@Pp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRppl(|( (27@-0S S+,Ü2 R0 ELi `Q |xPC㭕aQ* Q( PDP <4B 5*< 50d30a3a 220S ᡵ0 00@ @7.Bp#x3 Ŝ ' 0P n`vXA 5*< 50d3,81q,10S l @0 d3S, CQ,aQ$ 0AS#AP F0@a3d3*0Ct00S >j D0@ S Ѝ04($ ( (*P(x(|(( (Fh @- eoT: O-0` M"##0@p $@ 0$08 npPc0S@P@# 00"' qp=$婒LtUhUaU$ bU |P?i0E SThThTThThThThThThTTT09p$S @: P80 ( 0 @+0S ,00(# `!$F P P0V xoЍVp FpnP` ,[ p_P `P0V:P0V PP p;0[0T$$0 E !Q Pl  @ 0 00$ 0S Z(0,  $ 8v)p Op @d 0 00$ 0S Z(0,  $ 8Yp  @0P  l P0 Pq 0 ! P0T: %p+ YuPG-p@P` 0P V  00 000G 00`000O-0` mM$0P@t004080 0 0p40S+ mߍbP AP LP `8m4kcP iP0p8- 4@0 0H4: S@ @0(0D04,0008`0#P  P 0 0! xGTd Йp 0Q= $ 0! $∑匱@P 0V$0 0/Sᴰ<<`V $嬎pPp<0"<Y+P0<0`P< \v Hp< 0 0 n?C0 n?< n/0P < <忐!$, Ṑ 0#$0@0P!Sd `V|s 0S `0S  R$ R Z m0$H 8 HXPp`G0$pR 0$ pK opBZ (,PQ(,PQ S R `T%+ zd@< )j]O-P@p`,M,$P p)$0S0$020S($p P V 00 0P0P 0 0 "fP AP PP XbpP$p,Ѝ`P 0`P ,! ?o  00 00  0 `< p| 0PCqp p Up`X%^t+ UG-@pP` Lp`:D10S:E A p= o09 6X $$ pp+ P%W00S $$ `p YPPU `fV rV GTP$$  Dp$`7%+ 5 @- oT: A-@P`pP$ hh嬓 XU  AD<塓4  噓 A]zh%IB@- R0Ѝp` P@H\P 0 R SR  R $$20BR R <P0 , (P/00#01"$#+ O-@  @T \  `?p蠟 T00 Ѝ@P 6 [ PP P7 U  Q*"ƌʠ? ,͆  RQ*  R*Q*"É?   C- 0P @8a8q@^ \ ^0᳀ 0S@ 0S@ 0S0@@0\ ?\CT:^ *$@A0607;00@R0@Q 0BR 3C !lO-0P$`ϋ@P 0㘹z'0 0Q P @ Ѝ ,PC-`$4 p咓P`品(@ 0Q P Ѝ P404-@-0  Ѝ Ѝ/-@-00@` 0 Ѝ@ Ѝ/-@-P 4(巑  oЍ Ѝ/zO-MPp`@PЍ 1P P 4S  0lᕍT0P$ [ Q$VP 0S 4S $ X 4P S $kSG30 0 !0!|p`0 0 0  @ 0P 000 00 0 0 P 3 0T0哇+ P#(` ,`$`V$R ڀ 0 `  tB @  "tPY 00pP0SpV[bO-$M@ХpPP? 2R 4S  0Ռ$Ѝ0 mQ Q0   RSRQ"  "S 0$000 00 P 0Pᣌ4S 0S,  00 000 P0 0P0 <00SS PẐX   0 0`V4S 0$R V P0 RS 0  000P\ H0H 0000 0   H;pFVU 2 = P m w  G-`p@MP@P q@TC^t# E@0$4$ 0840 ;p+p *⋔px H4$$: S! R B.T pD $4S8 (4,$0.B.  op 0 0"dR04<,$$4(4$t0K>Ѐ 0    - 00E`d$t؀E0  P0`P 084S   0p 0gp 0p pp{ p 0pps P P 0" RPp5:Ѝ Z0pY"    d@  d@ * @ o  @-@P 4B BRP ֓p 8L4  VЍ@ZЍd@  @-@Pp P P 4PS 4 & S x A- @P0TP p` X`p0 p  $$ QEAS$0Ŷ 8#8"(Ѹ0 / 0T 00 /$4 0T0 / $4 0T0 /O-`P@p M6`YP̀PP `00000따 V:Ѝ 1 00 0P0`P1 0 0P UP  h% PC$$0A@-yP@- x`R@dbЍpP P 4U R 0 ,  ! O-P_o!R0`@tMR(0S00S "R0oU tЍP PU 0SEpWB (0WS>!RSR6"RSR.pG/0[ P# 9/p " 9/p 40 P m0 $8  |P P  6P 1 A-@pP`P 5/p 4 5/p 4 A C-(00pS4P Ѝ$d@ 0   0d` 00  0 `WP K _  O-0 0P孌p@ጀ儠T Ѝ` P `V DDp 0 ㊌@,/ A-P@$`$p0 @T/ O-Pp$M `@Ȁ뼰0     Q  x0 p `p X0 X p`r00P0  $Ѝ/ P0 O-PQ@04p 00` ЍP P0S* E g`P0       04 p p#p p04pp    + G 0s@-SX`@ PT0 ?o2R0S  Ѝp, @- iR sR aR p` 4eg p@-P@P (`Pp Fp, p@-@T 40`PϧP>pp, iR@-- 0 aR bR LR( *sR% tR@P 0FP0S`00p`(j0  ,  p@-M`@P`˵P0 0͵0,帋0S ⲋ nЍp iG-Q@PM Q  ЍA~␀ p$n`P phB~00 0 `PP ᅇ i T*O-$M@`H&P ,`$ЍPP 0 0 "0 $ Y># P0*Q P0 0?Y S0STP pY0 P pE00 PU 0pop $ P 000 00 pP 4  {\$  0V,S( 0 `$4 80p| Ĕ$%!#,[PP T P R*L0Sh 0p_ L004 0 000 00PM 4$$  - 4  !4 "4 $@xp7 Eu[ 00S 0@-@C^M E$倊E$$0 0 1P Ѝ0 @x("(!e"`#XT 80 Z @WP8T꘵%P0 4?PbwY0$ 8O-`DMPp4 2<0 p 0S8 ! R4!DЍLRd a0BS)S&̇̇̇̇̇D10S  0P 嗊@P   [@ 㞃Pట   T K0 0@  T 9@0  @P@p&%,}jd0 % A-p`(P@xP0 p!`P @00 0$0@-@P$0S 嘅@蕅O-20SK@0SD00J@ DP 0SD0SA \^<40$ 400#qpp, 804<0SP$ 0I,0 , P tbU@ qU PH04 8pPTЍ0$$ h$(`VtJ0Y `0 XW0 0 0S$ (0G [ P*0W0 000$0 0(000qpp 0 QP Р 0Zp , 8p p  $ %T: + l7 O-@PDMCnp F#p tpX50S HDЍqP sP 80Up#  0qp PPp0#F0$$`P P  0@x40P0  0 H0 0$0#P  P 4  0 (0$0,0  4 PSf 4,  (WUXpVP 0T 1 T00 S :0 U 00[ 0  40P40 (, [0V [(Q,UX? U0U0Xp.P p (V,#X<! 01p8 0  U  0 0CP_ Q QXX 0 0  P4\ p 4 "$P0 0S 004  4  !4 "$0 S40H0L p $01S 0S P0`8#8&h$ r/0$0s?`mph4 4$$  f%7 j&  T: /` C-P0 @p`$M!!ᜑ P p*0S00 P 0SP0SM \^H 0T' 10S#!Q` O.NP. a@ P P ȪȪȪȪȪȪȪȪ TdpT T  w,$ЍP`(%7 p@-M(@,`P6# ,X0ΪP0 0͵0,廀0S ⵀ qЍpsi@-WM M`pn@T 4G0S @^< P咀 0$$ 0$$0 x0 |xOP xK xox 0jlgm0 $8P_L]#<Wލ Ѝ:YT*|S@-0@ n00 0 0 9ЍY@-MP@a qPw 0xPЍ@`  pЍ|  p!80pp\XT0 0 (8P  @08 0@TS Q2P  Ѝ@ $m0 8 00  ` ppx1S1SDPЍ@pY *<AKOP `00CS`0p S00 P0S X0X /X▀긻%G-PMM`" |" x:2r@p嘂嘒TݍЍ  b ^ `Vj @T   `0"F0 BABP 50S8 1B-B*B'%$! @|<##P%$ !P<# pm0 $8D($# b@B~ 0B~ ~   E0S 0CS 0 80~ [% azsYT* (  2^G-0p P`@M!ဂ P dpd20S$^PD$@6 lP`Pa@ PдشuP xP @ЍPP p*PPP0S00" P 0S0S \^ 0 Q  @~ <~0p帠W +~ '~ Q ~  }   up ~%7 [% azs@-LM@P`4 B t1qD0 ᨄp T  |P 00S 0 iR TR a0BLR :lR s0BST pLtLЍT }pT: % 7  &0@-$M` 0 0@P!!dq Qp$0S00S P 0SC0S@ \^; 0T 00S!  0*a@ P 0`888888x88TtpT T   4$ЍL%7 -0,M$00 0 00 00 00 00 0 00000000 |,Ѝ7@-@ P000 00 0000 P  S  Ѝ0C-@pM P`u q0 0k0 00 0 00a0sS 0lSp@ lP$0㓄( p l@ VP 0㓔) p Ѝ@T@Tp7 C-`POP o_P0Sa fpP tMPq\q D/NP  0)NP  #NP  NP  NP  NP   NP  NP  MP  MP  |MP  hMP YoP  SP ZPY -OP @X %OP p$f PMPU 1q"80xVx \NP P R2")|`MP  lQoPk ePU  p $ 02#W: (NPE ePP? [1! LP4 0!xxx NP) !0x |x NP "MP "pMP #\MP m0$ 8+0S pP  p  MPp@!0T Bu00Ѝ} ,%x: : !Fjѷd!{ !!%!aA4!=!H!U!c!r!!p!!Y!!: !!!!: rBO%O-@PpjܚM Kp :0S ЍO 0FS iS:`pC>؀C$T2P WT Ѝ%P P WP*9PHg0P0 eP000$$ZP] pe`P |eP (0ZPXIoD0 wKP $0 P pQ4 pMP 4Pa0P 4 &Pu  2P00000[000000S 000(0[eP dWe0P$0 hnPP HHHp`P p$sPP04 LP 4`P `VP @ JPn H JPh @0 SD00H0 RL0( 0l` 0pqpH  R$4,, 0_qp 0`} {$4P `$${$4P` Vd`P dP h&tdP mP+8,0 Tp`P Tp<&? ` 0qptnp JPZ3po  JP   JP  JP   JP  $ JP  X {JP q@ tJP  ( mJP q/   kJP r dJP 01S 0r/S㲰, s? Ѱ  NJP s/ GJPz$$z$4P$MmP裟z o`P o$$`0 qpS, p0x< KPj <pP < <(< KPZ <P  JPO  JPI L JPC 8< rKP $ <8 IP3 8 Y* 0c$ Bp $ gzPp$4`  0#qpt$ QzW$4 $0 88\008$00(0 0 00(0 40P0,` 0$00P00T0$0E XA`0$$qp|$$z$4P0 00H00L0`#$4+` 0qpc$$y$4P `}"%: ,""5"!!V"!!x"!"!!aAT: "rB""##pѷ!U1#d{ !!%!4!=!H!U!c!r!!n#OJ##[##0@-@M P   ዧ bp< <o 4?{p$g0Ѝ0: #'i$@-SM@P, 0 T  \ $ d l 4 @pt H0P0X0`0h0p0x0x00p0`0h00`0 0X0D0P0L`0|`p D Sߍi@$i!$!i-$@-@  |  0`( "4`#Ѝ10S/p@-!MPM@P% PA. (01P A!AvP8 0`0?oS c`2 06P. 0I0u0 0A. 00P0P A Au0 000uލЍp`u0 0A. 00PH0P A4 4A@uv`? ((9$B$V$d$$/O$s@-6PP vrP o )`@TЍpVP  00SQV  /u@: $>30 R !O-M@ Pxp*p"7`P"  $   aP- eeaP:apP YepxaP Re \GP 0"h 0R00  p!  FPr 0SohQl @ ypal #e! R R RZ  0PW l Z X徲X (s<㵲W 0j0S, @ hyP@ `}ypd HQ L 40R !>Q01Sp0S 3/p\ U 8 X^yp \ [ 5@ `Qyp Ѝ: #$jTk$$$%$$%A-py`@P@`PP`"ba PIkxl@aP ll`Pll@- YHP Ѝ丞A-MP pF@P00p`ЍpP  -0 xp !0  H$i@-@p @A-P``pP00/dP@?02d  FQA-P`t`pP00dP@:?0d m F3@-( )FPt00 Ѝјp@-8M@ PFP 1 !  :;`P c0 Q0s0S00qcPP  |`@|jDp `  Yc< Pe``ejV8Ѝp#%: ,%m%i0@-@BM M  8p 0S 7  /  0(⽦P(@0S700$0/ 0h (⮦dP(@0S Bލ Ѝ0Qs@Is@iw%%%p@-xM`_PP PcP@ VP0P Pn9Qc   ,pЍpm%%: ,%i%@-@M  \ pЍi@-M @IEPC0 :9| p  1Q0r R08C84 1p`Ѝ#&; *&iis@-`Pp@ @@EP0 9H@Ph坰{b P@ L㔰@_P 4 nЍpn&; *&x&&$&7@- P@=pT TtL_ P@00 <<80400U_@ Ѝ0; $&&*&$k7@- P@p\ \M0H@@^ P40 008,_@ Ѝ0; $$$&*&p@-M`^P0P0ЍpYbP@Uxk@Pd0 D+p<8 P@ PP 0n.&&&i'@-$Mp^P00$Ѝ$b`k@Pp 0 XpLկP@ P`@ p$ϯm\,"'7'iP'@-Bq Ѝz]'0@-M00 0  P}vp `|k@P㟯 ` @lvpp P0 `pR00bS hqmoU `qqPxi i'''s@-@`.PP  1p hl0o'p@-` MP@]P a Ѝp P(    !a  P-^@-hDr+vi 0@-,M@ PCP0 7 p,Ѝ0 0R0s0S 0 $0`PP  (]@gD'; f*&r+p@-P-p@`@@]PH0H HHE7)aQ P ܮ mpjT&; *&x&@-T @4CP00Ѝ  p  Q'; @-]'@-M T@CPD0D DD708 0~ p$QЍ < *&i(@-M T@BPD0D DD608 0] p$QЍ< *&i%(0-M $00G P  cЍi'@-@0\ P$0$ $$6C]@&&< *&$00@ P/a CRWC/A CR=C/@-00@- M@ 0( 0 p# ЍiP'@-PM  X@@=w 80ڊP0 0 'pЍ:?z0(<(@-@[PP mApPL``:P00 00pt0@`Vm`*` PT0d0X @ @@@@tpfn03/`,< M("%A(G(h(h%)////0 L0L0/"%0 T0T0/"%0 \0\0/"%0 D0D0/"%0 d00d0/"%p@-@pP .00p00D S 0A0CS"0$P>P 0@p"%@-p0 ( 0`P/ R/"%0 O-4M@@!2T0.  DPspďů6 0$ (`pVD@PT P p1cehT6l PP@ p 00JP`p R  P Q R/6 0TS $ P\(P  1/P 3*O-MMPp  X p`%㦬 pP$ 100$0 -n ➟ ]spO ⑟t Psp Q Xn Rn8 p$0Q n$_ X@T jX00@0 0%sPmn@R 0 0R ,0@4@sp 0h0Pl0q 0X 40,@rpDg 4<FnSj0H0S $P317nH0S=I0S:Z`@T 0 3/@: " m렒M0S:00 % p"`pM0S  nk@ mc@03/@r JߞI0J/rpNI 1R㿫a`"%J` 1 0 d1 T|p 1 d\!1 Hm`@#%Js!1 @ t1 x!|1  VmP@Tf 03/@ 03/ݍЍ2< #**:+iG+~ic+k+X+"%i,i2,L,d, (; kr,y++,i 1*,,,,,,O-@PpP  p 4T Y@ YPT! 5Y `P \PPU D1O0S lddebkW P.Z  P' !AP! K0S 0 L0S 0M0S 0 N0SO0`S PPV l 'H< ,>3 (%@-,MP@wpP JYP`(  p_0S h㤪 H>P00< <嘪0 $努,Ѝ$/(8i(/E 00@-P@0 Pv00G-@ YPP0 2`@ Y㔀\p\PP  xpp H H@@@}h@H0E 2R0(9s@-@{X@P00Ѝpu\Pg\@P <` xPPhu 0(js@-@QX@P|0| |h2L\P>\ῇ@P T` OP'hu( iЍp1E R0(jA-@"uXPP0 92`@\ \ᎇPPp p< >FJN@SnE R0(0@-@ \>PP0P PP2L 0 S@@00 >00Ѝ0E R0(jh%00@-M@XPXP XPp XP d0P P P P 4PDp `Ѝ0Sn10H0(7i0s@-@hpk P LhkHPH`" P! ,]kЍpXk@11G-M`@PK `ppP"(    & op% (v( px" <@T t8Pkl2P\k UR TЍ0 P4e@Pܨ $@op Sjt 0R jk)j j` `pjtQp R%P\j jmKP;ЍGfQ\ 0Q    1 0PjP0 RS jj # Wj0` R P U 0pD` P\\\$F #8i(i1,1E 61=1a/Q1BF T*4F s1|1]1Pp@-P`@'VP V  3W`P 2a`/a 00pVTp!aA-@T 00`Pp[0 p @-MPP00Ѝ`0 00p0@ 0 P Y0P 0 p 0 `P0G-@(P00`(  P1r0Pp*0X!U0"R0 w"0t0"SЍAH0Ph 0 , \p 0 @0@-@P `@ O-`@pP,(0V0S 8`cP$P$P 40S 04S 0S(0p(`8P0S$0(PeO-M00 X$0 00Ѝ 0Q`?  0Q> 00 ;PP; XpP ,,p 1,4@[T /Z@P00 D0800X5Tl (J( R R[`"00dUx 000 /Po0"0CSi 0BSe 00Sa2^ 5!445XpbPPT  ᲰD$pP }XdXB 0  Ap; 0STw /PPZ0!偦8!10#R0 .0i8XdP Z@ 0YPH@T 0CS00x C00 X ^0:T 0CS wQ0x L @0aD\W@DAD\ 7@D@SB0@ 0#0  0@D@ T X@UdTl p  UP _< D _0 0 0`0ј1@H 1&&A-X Pp@`P00B0P 0 p 0 `P0O-P`$M@ Hp<X8 P W0  tPp` 0p0  0^ƜO-`MM@ <j0< l gK7KP7['S(0`0 @$0 0 @`F( 0R|P~$0S0'V$0$:$ 0:0: 0:0 :0:0:^(@!!0 X qq0 /C BRZ  0  00=C$0Cɟ"! 0P PE ^p PE0`y\900IppcppCppPpp Spp@BppA`8$ 0PX0` ^!0X@"0,0,0S> H^0( 0B'S(0؍Ѝ 0$0d(S   BS>C0CD(S Q:ȟ"!! CR   ##9C0C"!% 'S>Cǟ>C"" N=C0C Q 0*S ;S. RU 0C'S`<<<t<|<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<S6$75755572S# Spt 0S R Sm &S|h 0R  |T |0L]0, 0 B, @W0S 0S `p]pW>] 0R 0]`0S ]0S `p000 ]00C!xx娀XP0  @ ]p` ]0S W  04 8 <$S Wf0S  +z]0S 0r]m] ` 0d|Y1 4  `pG0p00D(4@Y400 03c10S1և!u E]p 00 =]3I $( P  #P# ß P# #]p|P3Ip#S0S l]0S#  P]S8]0S $] s 夢 ` V0V"    0`\V4\0S 0X\gD\` 0 d(Y1  0G p00Z100 `&"R 1 !o 0B0 \1I $( !P  $P|! x Pt! T\pLJ|  lhd`\XTPLHD@<P0i77777h7`5&8(78 ( $7!77%8+866:448;8H8Q8e8[8l8P8w8|886768P7P]{48884J 7887&7+767A7K7S7[7c7m7r7{7777p@-P M@` dQP0 aPp@@#= Ѝpi8@-< @-P$0$ $9" Ѝ8DJ V4@-< @-P$0$ $#" ЍZ6PJ V40@-MP "MX`@PۍЍ0@< P+ ^P@<ۍЍ0@_0S0S1iS9"90@-M TPfp@@<Ѝ01 rk@i19E9@-T @-P@0@ @@!I \p [Ѝ6\J AV4o9@-T @-PM<0< <!  >p=ЍfJ V49 0 /t+%/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0-@-  Y}Y ЍЍ/@-@jY=_: 0S/@-(-@-  aY]Y' ЍЍ/-@-  SYOY ЍЍ/@-\00S 0  0000 0 rXpЍ(:@-@<^H ^^p0_p`N 8:J:p@-pMPP2 P0S 0@P 0 0 00 0X1Xp DlP@@ ((@,P0P4P8PS~00!031 0@-Mt 0eW@P \㲗 SLPP @ (@@ 0RWP 020Ѝ0x+%ۧ(a@-u@0P ,r>N @- 0 00WP ЍH+%A-P؎p`@WЍ VP P3MP@ p7@-P@U0  (wT Ѝ0ᄉ>A-0@nS0oSp@ pvP``WPZT0nS0oSUPPUPP'@-4t0 XeV>h%O-MM`<(0p0 0D@00 l0Wp10S SH *Q 00,00 `QD0DFDuDp@-@P}P (V0/Spp@CCC@-fo SQCh%O-`@ Pp(,000 唐唰00 Zp0@DTq oP0 P,P<9 O4,%, TT C@-M@A>0 0D@00 l0Vp0S SH FQ 00,00 Ր2QD0DFDuDp@-@PP (ː0/Sppp@lCCC@-  Qh%DO-`0@P(,p娐娠娰0 Yp00@DT oP0 嫁PP哐뜁  PA+O ,4V %C@-MM0An H 0P0 $@vVp gP-(Dp@-@PဥP (Y0/Spp@CCC@-in RPDh%O-P@M P0`r"Yp)20 R. +x   &  x `!p 0 *00)0`VpVpz uPfPMP9 9P$ GP g@PgTfTfTfTffgTf0PC@P@(0L AH`q匁( `L0Rp0KSh0  R < (Lh0 m(M0 廌( h0N/@  0PP 00 0,P.0T0P P T0N0\ $00X 00@00\0|00x00t0 0p00l00d0NRݍЍյ4(,G2C[  GC->CBX?X\<\99>ߥ9>:>Cڥ?n:>CFե 0? AC>̥}C>GǥmFåEnFῥE~G໥ 0X J~XpW  $$((,S>,ᘥ}S>GᓥmFᏥHHLLPPTTXX\\O-P ! "441!"441 $$((,@,0`Pp0Q࡟\5 S L5sp`PҀ0,$ $Q p W vTrTpXnX\j\`g`dddhah`l]lpZptWtxTx0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P $!4" (2 !8!"2LABLQs@-QPsr@  $)g P`1+l#C0AL 0 0 0B0  0C 4 0 808#<4 0 #4 0DF $!4" (2 !8!"2& Ѝp:0S/!  O-,Mp0`PTXPA $  $0Q/ @T 0 qbQ BQGAU! Q긐ܐܐܐܐxܐܐܐܐܐp@ @ @ @gA \0 `U@T0 0D dS2Q "P  T8 DR0UQUDTP 0  @@@0 X R   0P[0 x00S P  X,Ѝ0 00,P0  K*KMKH(nKK@-c@ PU xxGpp0h`SPP\@Lp0S2ED0D,G  zG@H(Kh%#` 2R  0  ?<#΋ 0`x 0㋼`0報 C c00d0 `c C ca0b0 0 0P!\Qpx 0&g0sS $$TGQT`P@U}l  00 ЍO ᔼ@0tS hhȀ& XȐPUVP,t(T(U UUTTt0p@-0`S[\@ +L00S000000B0E0p(`,%Pě00/000/B10B1/101/ 4EVh%O-eM  dϠ 0@ `Ì0 1P50S  100 R(0S\P pЍ P` ` b5BL RW@QWR5ꠝ`@ PP/ R꼝$ P D " PD1  2D1" " P 1 21D0 8 P U Pp000 0$5S ? 00l1>0@D@ @00C03`0S30 0C0 0#0030 3#00020SQd 0@ `?50 ST0T00  B 0P SX0000Y0,ڨ0d0? 0 0@ `5? 0댠 ,1# 0 ! ?غ0 00C000 \S T10S  2 dϠ 0@ `Ì0 10! 20XDT40AR8 0 B0 080$ 0C $ @$  $ 40040 08 R R` /  `1> ``& (T(U U-VSVh%pV`,%VO-MM␵`,t l51^OR0\u@DSia@51GlG ?E 0S/nE? 0?E4[P`؍ߍ 2@ŒD 0L 04;2 0d04 0l0  0 SF0LSia,41G'G `&!""#0_ED@HL0? 0 040hl 0@DU0 L 0/4d;0 0 0@$ P` 04 <0#p R0C0p00sSG`Px'x20S6t 2ܢ 0 000`0z  `  Z ~X ZPPQ ,⓾ 0"\0Q>? ,0##90 P?( 0P@/  0@őD L 00 /4;0FuF 0d0@ 0_ 001r 0PV ]F`P 0"Ϡ #$$%90\X`d?(,0I P 0@Dő L0 0/4;$0 F0F 0l dh 0@ `Ì0 1`,%L((A-%/%(T(TO-)MM,0=0?0(8$0-F <pW:t< 0 ; ?  0P@P`P  <啢 P@ 0  ;剢pF 0  ;Ezp@ ;T@  1@[Pp *㰽 &@P xK(㦽0S0,5 Sx0<0(500,; 0,%S00\:X:Q04D >A\ 0Q( 6AT* 0 04 0A (AF 040A A= 0 4Q A4 00 Q* A+ 00Q(| A" 004 Q\ @P9 p00W 0G\3SrD9\sɃXX9X0S@ X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R0081@ p4劃P 0P8 a 2! Q S,QdS18$Q<4R:@ @<8*\50? A00p#!3x00084$0<04D0t p@pX0|00pXsL5P5 P4H   ?ᙷ8@`D ?ᒷ p?7`\tF01o&" A00&"n0  4%8$05<4R0*@H 66 p84<00x 0 08SoPN @KP@0 ? @P06PP* ?5@PP(5#R0:,P@$0[`- 0000%" a`0 ?001>0[`0 c2# S,Z Q Z3?001> !00 ^  BB0޶P`0/2"0$ 0  ?ʶV`1V`#T0`10F 0ŶI ?࿶B@TP 0ἐ媶똀  00B1  B[1 ` Y"B !!0 R0C!I0B ?0 `ᆶ똀 0  B![0Ӡ!`S1B 110S ??]r @P`x1m F084<ĔCP`0S84<Ą-0$5BPS,`QɑRB@L0 0 0000 20S|0` ?HL404P@0 @1pr'F{Cqp00"R6  Q|T1(\50? A00!#4t x0Y0(0#T a2!, A3 31 0  @P0(d,%h,%VVl(x(W;WgWWWWp(&X>XXX(XX|(l,%h(t(((^FY>UYL(YX((Y`(8_ (Yw%ht@%Y(=Z`,%(T(TTP(U 04 ` ὺ 0H$4  E$ ( B, @%LV.  R*h b <  X ! \ ! ?.@Xd@+@B@A.@B,-8 He `埌 @40K `0 ,p B8d i A YZQ 0 0 XZ R A  pW?΄$t<4Qï80P@D04 0H4(0Āp 2 R 5#< 523pr0S8 `k ]ll 3]n 00 d AQ\ a6Pa`(PX= `4Ek뼐@ Ak>lk 3>n0@0P 8勀 0,= 0  R0:1P000\P2#00@P`@` 0 0刞p00 R00L&X0 0S:pD Rl= TP0 뤤@t j0JF 0YK 0`0S 40Sa 0 # $1 $0+V. 崴050S  O 0=S,n0Sڤ0S0$0! ,00C."\ ^  00 0?d B2 b<10 4&<$@6@H p APP04SP0 0R0 S00C0 S 0,00P0F 0,0S哨 p开8嘥ȿ+" < Q \%0R.  @(0 0 @DU`40 @4A`70 @R40 `0```0T0(w 0 ׸` p7$X0`0 I9pQ80< 帐 P0x0 0 Sx0x0t B\0X1`01tQ0C00h0`0lR#00B1 d0R*%pĈU0   (0 0C0(0( 0 R R` ` e 0$5S  l01` p0000S3dQ0)ST0T00! !0)SP5X0`0`P5S00d0 0ص յ   ϵ00%00080@ W`Q ~+H0!H (AP+H ~H000-ᴰR㰱 ,  BU 00W0000T0 10X0岑0= 8R\ ?0 P 0  B  R\ ?0   00C 0  080 C  C 4400CS T00C@ 0|`4  80QT:  $5SXL $`$`(0t|V0S ,4 ` d,04  0,4 $哷 00`  Vj0S   0帀0 X#` x0@} X\h># P 0?d @ `0 < =\%R m0SP,m\`/ `ƌ$  $ l(0`S`  0$5S  l01` 0000S1d 0.ST0T00! !0.SP5X  ``S 0dᓴ먐 Ᏼ    0߳00080@%0C 400400T$*Q`?0@$00$0l0`0@hppT:S $S0ppS $S00S0`@Pl倐H(ꯈP00@.}8p`0x1}ሤpY70IX!@@l00@0T: 5@$\,Q 0@08(0 T (0d0O@ 0NN nC 01p0Sڔ30S0 000S.908CLC P3 RH0ł."\5 S 00 0 d 0/ @ `.3,00 $ 90000S0S 0,00C0S0 20S 90S s9T20S 0| f900l:h*,8iP 20S#A C 10S303040404 0#pCVW*WwV.PaV.GV⿵0S  d10 PST1\5=S,⫵41?^ E?ᒰ0 0S 04 W dLĒH 0@ `Ì014 ,$0S0S 04 ? d ,04 0= 04=)ݍЍSoh(TX(B[ZL(dZ`,%|ZT(\(8 `(G-`RM@Xr wPP XvP`H ` P P7   =p 0S ߍ<08 H(00,0 000040!04 04$0D0(0P /WZ  |=pT hv=p* \vX-%` 8  4  ()  %  !    0,0 0   ܴ =p 0`?`a8SWoPb 0  0**0P0j J 0* d@edAzd@Q6-BA-PMPp`;@ np@P  P06P;U00 ## ݍp@-@P6P (v0/Spp@CCCR/>G-P `$ 0p@@V` 09@`` V`@&!D( `G-P 4`pC80ȠX㉑ ,Ƞ ,4 ă Ƞt,Ƞd0 "% ?Ѝ0 :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@O-4MX0p0\00``P0 0,, 0S% P 0 *umS;aSMSASB0C0b0C ShSSU0@0 0DT dS$ 09R 廳"P T 0U8$UQUDT P 0 sS @ @ @U00@@@ X 00 l Pt0S00 0 000 00P4Ѝ K*KMKnKK@-R,@ (d7 5h%ZP>U㰐Y  0@00D @/60d& 6F H >w Td> R`$0"r h2 XSQ 0@H0t}o 0 R (cR 5-0$0_0ᓩ (0Z0UC (0 , P(0,   @R 0 0? $;0F4 崼0 0 60 6&< 0(0,200UX,0000@| PD   D $`0P 0H\ d0(@4LP88 0T0;0Lh5o0L0So h{/;PU Pc  }0L VR0400$ & \`#  @ \ 110B0㶪F0D໬0$APpepeC0CP!P`\` :0p0%-P`0"  p㭯 0(0d0040\0@080< <0(02(,0 0C0)0C000 SJY 0Hj00 pS D!*&A 7 @ +3|) 0 ( "*!3 6 !"0H& 0 09PpD |IH&S0SK9 R070Dp$0S 40S `PD@ 80S<000 Sg0C Zp,  00 001(0@`@ QHR'0 Xx0S7 0S0=0S00 0  C02#(0C27P p O7PPXP 0R SHS SQ«`@pb Spm0 0Y 0:Y:tV3006X  0+(01 0塮0 JT  060 6&勮(6Y:$0TSL0S d0 P V50SapW~@0S D5L R d0 P# 0PDT%_oRU+Eᆩ&0#H6 C 0 ᓔ)6 4,0 눔p 36`U0CT 00C0CSX: B 5Y1 21[0!!!0 Sq# 0 ᓢ"  0d0$&S: 060& 0vg0.a1xGz 0W4#0003 1pXk0SMf`F`VI l30SA 1W =1D3PUBL0S \0:`0l Mt PP1 P# z⮭37+66|0X00005096 30;Pp`F1o"t` 0p` zX275X00005f &1 #?1#  0RP *d "x P0 |0YPPP!f v*`Pw!\ *P  6p!dS!PU:< U*!:0U:,0 ,0 xp$L0S\^UB: 5((+\(S\(~\\\\1%1%:](x](1%QNS]x((](](]3^Y(j^tb ^w%ht@%B[ZA`dZ^ _._^__b _,`3%1%A4%b V`\#(((0Q:BS! Ŭ0 B 6Psd  0P0 S %%* 呐  0p1Pl 1 !7P 8 `U&`D1l6\0U/0 x xwL0S `0  1#'$/%174\X0|000j4090& 2|0P(( J /0 `px2& 0x90Df?o2U+u^&0#X6` c2H H0 HDZ4GߍW@G-`RM@Xr mPP XmP`H `bP P7   U4p 40S ߍ<08 H(00,0 000040!04 04$0D0(0P U&WZ  -4pT h'4p* \NmX` 8 ᰫ 4 (    0,00  ፫ 3p 0`?`a8SfPb 0  0**0P0Ya  0* d@edAzd@Q6-BA-PMPp`;@ dp@P  P06P=2U00 ## ݍ@-`p{  3@Ps00S0?0\$ 0S 0 lS\F\GL \ ddd, dd,ddgL0 SDKT ЍE%KUJ%FZO%A_0 }``@-JP L/DDNP<@ /M0P00, @R  T_\0Sj 1Sg 1Sd 0 @DR$1C0$S [  [ *0SR3#:\00<0S @!0S )P@ T <0 0P U8 PDJp8紥P@@ 1 $11(1d000S\0`S`Sx0S4\0L 0H->0 $0Ip+ p`PxC0S)0p2 p1S?V?`#)$p& a1S)p Q$1S$Ae$1S X$/0p@ k 2"OKK@0DP?`|KL0OK\0K@L0 0Z0T0Q0S<I[# [ [ ? [l0S -80S l0Sd0h 000@0D0 0#h0S  d0S   T*,800S0 [0S0S"  0C0T {0#Su:0S1`0S S Te,0S , 0C4,00`01l0S1|0 0S010S(1h0S01d0S4140S /40P(0&:a*:zF0P(0 (-pp(d/0P!* RbR ߡV 00S(dR0(1S01[X$1a 00PV`5U1000Aร0pY ,g'Hୣ뜵U p⤣ 0 pSf:Yf(0pⓣp`(uU ?≣ 0`SM:0!\R&0S 41 S$40(00p000 [ !0R5 R4*P 0!RP5P"S4U (R41SPP4Q41!SR U |`SRQ SP" 11S<1 +P3P%Q5 1CP0Y [  0D1Q000pP$1+!`GT0b#02b! b&X 0S [() Y': [00ŸS#."T0 S :0㈀ 0[٢00DŸS#Ң00S#<0 01Y`T01 !000 30$q W5d:0+a! `  +!  G0   [dQ [XQRU10A+!2"ᕢY0 0@b"0`(t0(0 +!z 0@G00S1!YV*/Nccccc cNc(Ndh%Zd!dRs1a=dkddd edd1e_eeefe4fSf\f/?ffff g+gNgggzg"h0hLhTh\hehmhhhhK$@hhdhh%\#)hgfffd0f UhRRaArrAa [0 [00S 0, S00R 0, t  [0 [00 V[U* 0!A(1(Q R0XL( 101S0S0010 [0\S 03 ,! q5$15(000 T0(P0S ( 1S,0 (1\0(E?0Y0 z(F?0!0G?00@0o($1SL0 \h(Y,!(pb(t`(Pr0bRQX(V(4QQ( (H0S zލЍS03$150 q5 [(1 $1S|0-^ = C0 H02$`!PP fH, =C%$Y(0 T02#H0, [00H <080$40`0P0#40d0,0#40h0@0$0Q l $   Xt  0|0(4Q0X080 S @40S d880 0x 0|a(0$040S' [#4q4 0W0W03 W00S pZ@ D0pp呚0S  p*p T  ($ p Z [41T C/oS" R `0 [ 0 0 @ 000000P00d00,00h00\0001010100L0 0 (1$00(0,1,0>03M?03)001x 01100 0T2 ?@1c4 04 v. 08#$0 #(#<l 0 0&:&t :>Q X0Q40S00|00o0 00 R  ST @X垞H'?  $%*pE TS x0!R R S 0 S7071011H0T RZ* JҠQ\0 [0 0+ S  R   0S* 0H0< 0J?oR20S C(0 00 25 010 0P B24 0180Sz 0`( "4`#/A-0 0P@pT @0W0 `Tph 0WeA@00@- 44@4P\P 0B"" `#)-@=B'/)@-{B '$-ih%G-@P ` 崢!>0kP V0 0  PP G*pP`0h0 0Pd0S 4d0 庝V `#),iis@-pP@ 0  :X 0TT%LЍp P `:0 %`#)p#)j@- 04#$$04GQ   % Ѝ j@-$MPp  l @q1 00@ 0! 0%))%1 p%T:`%O:P%`PDpATV@D:$Ѝ%jSjnjzjjX1Ɯp@-0A0MP`  * 0 0 010R  2   $0Ѝp@%R  #   $R 0S1#$$ 0("( 18#! 0Ѝp@f%0Ѝp`#)jjjj @-q(p5c$)jL@-0 L@ R0* 0 #  /)P `00CS`0p S00 P0S X0X /X7&긻%p@-`ḡ@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hȐdƐ`0葡Pp <10C <1$0 810S81`#)8%%h%$)O-@ ^"44”P dQ\4$M2=p2 040 "< D/*yuh%@-=@TP P" D~" 8z" ,v" r" h%yvv'w}wwp@-0@ R R 0 RS000p\RP 0SP0PP'R"R `0S S?"P0h%z3z@-@ P l00S\ 0@ !0R3 @00SP P990d/*/*x/*p@-P0@000`?0@@ Q-00B 0$10S !0 0C!0R3^0 P 0 0 0*00 R))))))))))*)))) R  C=00pPP! 0#0%0&P/0@0h%x/*d/*/*?zh%嚒A-@P`pp P0 SR 0S0B0Q3 00@ 0  x/*d/*/*4*P 00CS0 S00 P0S 0 /!긻%A-P@pᰚP  p垚Pd4`1`V :<<0/S 0 R0S /Q C0p R@ `/RR FR .R@` FR]P @D T0t/S~`0 /R/\>\h%`z0O-cMM00@00<+0< 0<0<00} BP 0S0,3,00,30S3S0G<PdlhO \|\ T  00 3 S ᗗ@@ 0T S S00 0K#=PC@P0S+K K_30S3/S:+K &K @0 P@PT[K>P 0 t8  t,  t  0S 0 8xS`S*?S DS . y000Py*P0C iK+ C 00CK+ ╒00CS00Pa0CSL0@/0X11@/@/ 2@/@/@/2@/@/@/,8t8@/9@/@/8D98   ZPK 0@P( 0@0 9 90S|9 00K  K W ֖ < 4PK 0 Y PK. K M ⹖  PoK P 0K. 80  ⟖ t @PU T80S 7  ⇖  P= 8 (<08808407007,07(07$07 0707070707 07070707 W  ⵘP K  PP 070Sx'0 0C!0R3x X70S0Sq K 4 @P PRKh <*PK &t0@Pp[ K> 0 pt`@@hP0V"0T  HT\HX0Qx0pW pdR000QSL00D0Q×DD0@ga0 `X\ X0S 0PV)PP &PP& K 0P@0 K. K>x%x 0  `@씟D@pP @ VG| OS 0S$0 0C!0R3 0S0S 0`0P `0P c=0,C 0  R+ .t  Ӄ0  d0|d0`@ 4mKR p 1  1 S 01 \Q \HHA/p@!bJ L0 S1P00P0P D0S( X3 R  hX  X   `|H0 S   \0T0 S `,@0SG @DUYC    bP0S|& x 0  ` PPcݍЍ 4  ߔ  =PPA0S, &P ˔  )P ⾔  Pt Ⲕ x PPh@d0SXT000+ ML\,*\' 6*4*/*z/*h%zz^zz})/*48%<z^z>oXd/* S{{g{.{{{{{{$|M|}|||||}%}zL/*x/*gfffA}Z:T}m} *}}.ZX}}}}}}}@-<00iS03S !e?[P h/*4*~l0@-h@   L @0 0 (;*4~9~A~I~R~);*@-`0@Px0 B0PU1 S2P T0p0S @0R<<O 0,$p Ѝ08%/*x/*[~Ϙ%`~C-PD1`0B8! Y!R!tM@p  10S  tЍ000iS00S 00S d `P W @ 0  P ( P000 p 0pf W@00008%/*d/*j~%h/*x/*48%~`0@-@X0 B0@T1 S2@ 0P   0S 08%/*O-tQ0S hhT @P 0S <@  /000PU2 x/*%FU/*0A-0S P`||p U0(@TP`0  RF000S C@x/*%`/*yA-p`P@P _p0S 0X0 0C?oR20S ,DoS 0ꏁh%p@-/0@P 0Pp SRpL;*@-8g0S$0$ 0 0Rҁ8P/*h%A-@0`0/0000 SPڤ/0>+b T0 P<P0? 4 x00?L;*D[*>8%0@-@0 0a0@0Ѝs@-@P`P @TZ TT?0 00?F+"+R  + Ѝpgh%$0L<S/ @-鼁PD[*><%O- 2@`VCM b@0DXCߍpTW B/ ሓ0 S'44x'xp☎ j@t1P0S8Q 0SD{'{{g W:0000[9*0S ž0 0S 弾0 000R*Q }0S `X0 c#.$cc4"0,4 4Q0 P 00000S  ` \/*U*%b*x/*@-<p @,pP0@0>8% O-X3p0]MS DD_@c@C 800#0600RS #0+y`p"& )LRPP "^TW 0"00RS[ 0"xR`ph"lLLPP"L  PpMDDB@@r0PSY : SVH`P؀/0 h10L<aS$ < 8H @ ( D `  P  `\  T  ؂X  8vP ,9 8!88"hG/0>+b  P<^P P #b0?0H @P `LP)PD |# lL P OLPBP|]ߍx/*%/*P/*h/*>8% FD[*B`><%n! 3*L;*q$QXQJ*ƒh%>@%Ӄ@-$@0 00: S3*G-@ q `0S+P 00S OP0 S00P R HRڄ00S t Y `HP 0 Y00:$00S $/*d/*h% /O-AMM`P@gpP8 0 840 AލЍO/0 009/P7 0p!p  ⛌`Q D D @P <PD z@P@   PD b@D t`Ġ崰TAލЍ0A. 4B   R ; 0 0 {D E@D W`0 z 0 D WD[*yh%QA-MM00 /R @`㨀pxPP 0S P@ۍЍ0 D &`D @P 0V hP`D[*p@-0@ @P P @p@-@@O-3tM0 S tt4p00RS`3 T3T#0PLC4#S@<<tЍO0 (PL   +p0@`00ܢܲL<` bL\0@ MWI < h`VV#W 4 @Pp VL<0@'pl0PxSiScP 0'0@$ 000 %L<0@ 峻尻dd姻X夻L WJtЍ0 0C0`10S 0`S%0` S\fXfh0SS   6860S d00X0\ 0`0G0P!bc0 <,d;x/*%h/*/*P/*`><%>8%h%D[*&1l/*p/*Keƅ/*|مA-MpM`@PP 0pp*d!d@P TTL(< 0ۍЍ aD D< pPU U`k jp0P ɏp xd0S 3p T0TP 8 및W8 [E(zh%4D[*l/*3*R}@-P@-L@4#S 0  0#S 0 @y>8%0A-@P` 0 P0: 0tpp ?0@$aH00S$`)*)#գģ0@-0@MT[0Q@X0T L0LP H  Ѝ0@U@U*I3*h%0@-P : 3*h%0@-Q 0@T0 R ||嬶% 0AS@ kЍH0 DPp ( `88%/*U*h%5@@%m_A-D@p 0 0SP(| ` `o `U*pL0@-  Q0 0P ,03  Ѝ U*3*h%@-0xP 00S@%*S`  FP@` 40P , $  0 ЍpU*3*̊h%0@-0@S 0$P B5/x00SP`P 5qpH0P@`  0((@  Ѝ`/*U*l/*3*h%p@-hPh@4S 0SP LL8H0P00080 4Sp0U*3*4^n/*Y*0s@-0@SP  40B3/p00S\0 pH0P`@ᙊ@  0((`1 Ѝp`/*U*l/*3*}h%p@-P,@P@p] P @f p@-X0XP0SpH`@P P  創 @pX/*@@%U*h%A-P 1 a051q0S :pw@P 00P'P' yP?P/  0lt1P! T 0H000@A(s X/*U*/*T/*%}fًZ*C-paM! 3W\ X  0 00@! &W 0A0  08 !Q 讟 0"Q / X. , W   0 00`  V  8#`Rp000F" t F dش00@ LJЍ83*%/*%h%p/*S2*$COlO-鼣@0EMSP8a  | 0 @ሳ00T*0 ?o2Q03S P30S D3 T@#@ $a 0S Eߍ0S 00p0"a 0S 0"p! 0B V- V V: ٶ  B B B 0 0l"p0S0S P 0lP 0- 8fPZ 0SF EB  B B B 0 0m!  B B B 0 0_!V! V V     \!eh;e004488<<HHLL&e#e exx|]|e9^EeEe:^EdE""442""442T0AS,ԍ  ` Pk PI lPdT0S40S xxl00[XU R O!"441 40F""44"2"44"2"44"2"44(23(,0,T-TX*X\'\`$`+Ṅ0 # #1 0002#22 02 0 (0#(0/,0, H0T0/X0X0\ `0/`0d 0,d20i0005/(0, |2-02R0L "S " 0x30=00 2R 00# |# #X0/80\ /`0d 0 %0L0<040h00S!|#3 |ut h1S 0SP! Da! AQꔏx$ 凯N9-0CS F  R0 R R 0N\ \0|Tt0=0- 9!m\/*lTU*x/*%kd/*6h%W@@%so֑C- 2 B P000000 MQaM0S q쑟=聟0=P  RP 0AS^ꤒؑd=0p、0W\hq P  RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ0=ۍЍt0 h0P0`0\0S H,@崮n3*/*TU*83*/*[0*h%/*$5MjO-AM0A(0 "S $U+p0 (У0AC5/0(0#R00 #0Q0h2P00 (0S $0(C#5/0(0,0S3,0P0?0!#0,0@ (P Aۍ<ЍP(0S  +p0(У͡0AC5/0(0+p0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  B0S 8#R00SQ 00S \0l 9P tlx3  P8P0S/*TU*[0*@@%3*'d/*ؒ% 0 3*q@-@0SS/*0O-wM0""<080000@ 040P0 00  0H0@0@L P0D`^ PP:P S  S  S;  S 0 ``&p SK  S"  S<60S  ,,(60S  6v0S -P  050S  Ѝ50S P 0 L50S  << 0,000%p,,Y0S40S  40S   P 0 0 8'' V0 00 `40S 0 H {30S  30S30S x  ?Pw 0> ppV 0 0 8''P30S` P [L 0 0#p0 0020S  020S620S ( P* 0 ##V 0 0 8I'F'20S 0 $m"p0 00c 10S 403/ !PbV00 0?X10S00S 0 0 800S 0 i4\  03/`V 4   00` 3*?h%x/*%t/*l/*U*0Z48%mr|ss,U*p/*ړ{oq+`/*0Y*t(v,LA-1( 0  S !@ 1 1R 4S8 !4|q04{@0t\a00S/ P0S  R+* RS-CP- !0 010000 QP 0PT 0$M &P ЍPB 0P;C0P|80S050 000 0 @ 00 0/*3*TU*Z/*l@-|cM0S llhChS0S Y^P0#0,,u R0h 2r 0 0500K Pr5"0C590C990C9000Ph|n xȪ0S \2d"`2Q090 9\8]els|l@-<뜙A-@P`App` P L<0 S000ЍU00j*p@-BM @P`0E CR V  iT{P‛0FS \0 BލpAS vP0P S00@ N{<dj*A-P@`u<0 puW a<Aj*@-M8 BPX< v 0SP  LP<<0PP p@hPP 001G0S8 0 00T1T00 pOW4a 010Q05 S:; S0,PP!00P  0 0 P 0 |Ѝ  _S-S x?p0 00_P0;Cj*BHGp/Jh%mj*X/*W0@-CM@P0,  0  >Cߍ0vj*@- @ R200j*~z@-$M0h ` ^ P @PPDp$ЍPU D0P ;끚4j*p@- M0P@H  : u4`   Ѝp膚j*-\M0 P  \Ѝ䋚aQ -CM0(   Cߍ/ᓚ 0`( "4`#/p@-`P0 R  @  0!S \X#; y!>T0 0 d Dopj*mGp@-P@U U  0<' $ p@h. ꗛ{%P 7P P K/ //Მ-M M? ,2ⵤۍ Ѝ%4`00CS`0 XX0 X /ḻ%O-pQDMDЍOh@x`lP !W200 u00020PS00C00@@ Rp@T3 W+X( U U P   x  t 0. 6   x  t.0X   p8M p W%֛f j*-j*3<0S/@-@QPM PЍ@f p31Q``]XZ00CS000000,"91PЍ@L -!0S SL   d0AS&lؾȾH 0S0PЍ@荒$    0ks1hS fS501 0400030020j0CS PЍ@=01 (0<00$0;0d 0:0090080070060 0500400300201jS$ $Q Q ( xVPЍj*f zg 1f &g Pb_lyƑe˜#BJXh lh uO-@`pR HR 8@ 50p债p3 pX ,LR,\RtTpp0pS  ,< R,4, R pp , R, Rp  , R, R|  , R, R됹|  ,| R,l R`{  ,L R,X< R0{  , R,, Rz  ,R,Rиz  ,R,|R렸y  ,tR,|pRpy ,\hR,|LdR@xW 0 \(2, WR, SR ',HQ ( <X7$R Z 0XS XQ;X PD0h4EH0 1HpL00 1`00pD0 pIpL0X 10@s^Xp&4 0#Q0KX00CsGX`0]oXP` pWI-nX )bL6T&8<f86/641X00 h4`갠Z 0 R(0 R pP {c1StX0@swX 4 0 0 0 0P3A7/,%00D0 Jލ ЍX@  RH 1 H0UpH0S# 0 0 @3SH  M8pW%$RZ 0 00@0P0@3A4/HpX񟗶x     0 0 @3SP1 04S) 403001/P  0p 0040 [*pmY g0 S P40So0 00   $ $  0`p`08ᛣ#0S P   B ( P R0X0,( 0P$0 ,( b$0H0pp p0p<  H0pp p0p+;㨀H0 H0tppwg0 Sp HpP  H0apW 0 0H0lpH0pp HFp0pHi@P0P 5p ppH0/p 0H Fx*hB%`B%w*z"7 3>{*GQZblt~:ȫj "8{*߫(B% O-`ؿqM=P `T@Pp Up#*p0T?SpDp00PPP.0`0p/809` R  0P1S@?x@`  f00 14@~f0 ,&@@<@%@_T0pP@ @0WX!3W0 SC0JSI T 0 =?TP@8PcP p080,c P8@ T@pcP3Y =y-  0S qߍ,T0P00T ef 8!80S ` 0STf0Sp cPY@cP,T {cP vcP040 ncP040 fcP acP040 |YcP  h `PcPT f 8Ʊ804S  0Se0S 3cP T e 8ᥲ80pS  d0Se0S!1R0 0:q~d cP9T] 0`080 Ro aBQ# p x ikklgj   p  l 975e 8 =8 W $ Rse R0!P  : <0<00140kS00   0H0x9Xh)  Qe 8  8 W \ R?e R0S*  %00140kS% 0404@T0q_4_T:k e 8  8 W p Re R `001  k40S0 S01X40S~   0H0 4@Tt@0s;p00k4@ThXeX01S|^4@Tj0@sq #N0P.&90004 081@A+gP8 BZ804@U08080S@00 @ c/4 4 6@ @~M6p8 80 @ Y@0-1 `0400<0,0@op'sd X0H?oT20S 0H?oT20S0H?oT20X0S0pp0r1!05 1"04 @1@SX` 0 c 0tH0c?D`D0`5p`H MpH0SX ZcH-0A1 ^d! `0 D00P0`qpd t1!0`100CS<$H$1"@ =Q@P qߍOdoob4S g043((0 0,0c?00400003, pLp;WO,^H RT=00D@ d``P0=S "8 R0  0`P 0=Sd h"8 R @`  `P 0=S 0"8 R  qߍO( TV0@40,00@pQVD@0S 1SL X* 5PP `V- ,  0 0(0 0,003Ap06/00`8T"X^(@,PX\0,S(` T'&*c X"qp  c0"S c ~0 SX0T R: w*>\(B%.G0i/ OqaA0c'% Ȭ% (rT/uŮj "71hB%,IFOe8{*` x*00S, S S0&P00CsL "j `B0P T0LP0PT0ppW65h0l PJ000&00' T00.T0hPb0S @@T T T0P 00,0@L D @' 0`@0 J000.00}0h 00PP \0pUp WqߍOQb0S \0,`[0 0 0LT0( 00,00p @-@P "  x l ` T H  < ,h% Fgu´ t0p@-@PT`9_ P  p@0mp@P M|*V8@-M @ P  # Pmۍp@-IMM @`P;IލЍp P0 堮0 l嚮hP 0S 0S0 :0S  PW||*@-M @ PPDۍ00 R   P|*H-p`3M|MPPWZ@P^P <^P@ P04^PV 7 P00S , P    PPi P t[^P ,N[ 2, P U(J")P0S vV! J1!0 J P RB PQ N 0 JUxέtJ|!|1h@  R$BP< 1 @.4S J mP 孭pRPh 0R :CoP᫲ ] > ]P00 S5VP0 xxp0 `X{p|*NɵٵO*h%oO-pMM`;p.p P@@ p up p0Wp㼱0Z:0S ލЍ0 0W@P\ Q@PLqLL?Hk]P  1pZ+V㟉 1Z SP Z.pZP vZ.20Sa00 0Z0V9 Z-P \\Z.Y@)0T:Z^P MZ. |dedA(ն|*O@-0`0 0UPP 0@PT ~UP Ѝp@40(PP DЍpm BO-tM< 8@40PPpytЍB0PP(0  (0P$0, $0U  wT T T;P07W 0FZT6P07W 01P07W 00S\PT7TP 004 0S0R0S00 00 (0$@` 00@TH*H7H'0D7 0<7<087P0T0@(0@P,@$00Cs$0640S 0TS0[dDt   0` p~  ;X pv xX `u(j0P0L6PV 0Y0BnS010<0S 08 SJ ?@0?D000S5 0S>P ?Y T0E HPpo 0rY? 0HjY0L 0`p 05 05H L ,0 0,0 0@000D0@ B^op `4 0p0`X p $?4 $;` p H\$?4 ;$h p X0 08T00 0`p 0 3^h `Pɏ 0X` 0X  0B0SP0剤T400[S%  p8c0p`$X p $;` p 0@[ 04$;h p h0` XP 0X `0X 0@[00P  0X 000 Xe,0S0T4 00[S>  paX0 p`$X pH 4`P$;N p> 0[ 04$;hB p2  ?#`p :# 08 <1h00H!T0@P $#`p # 0 00[P ȯ 05X 0.X 0 (XT0| |a 0 22>oNx2U2Ƹ:Y@:ظTZt@- P둹h%A-@`4Sp  PT0DPEE$UX xZP00pZP 0-80 P $k3MDPE@D|*N p@-P@Q0  0 pFZP @0S \G$Pp H9S0@ 0< 0p R$5$B%X*X+dP+`P+\P+@-3800S ,0 0$p I x*X*ԣ*O-\M0 MS1 HpW-Q`@`((Q(0 K+ 0=P 0 0 ۍ Ѝ0 000nS ?S aS ppS qS x0  y0 d0r0L0垇0 8fꜬ** X*%*)d%39\tA-X`0S L00S 08P8@p0Pp00*x***@-@L0@=3@00SD',0, 0S00<'눬*\*|*X+*C-RP`tM  ,,E P RQ ğE R`S V0t`FQ ğR   TDR 7 4* CR ` 0S $ L[ ,4\ P20@04ßQ [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+Q`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0!00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊh%d%X+X+T+P+X*8PA-@@P@T .@ P`p0Sl݅ d0 @ P ,0< 8(0@AB%BX* s6X+dP+TA-@P@pP0`S00|0 R d R 0L 0S @!P@`T !\P+**B%vO+P@-- 0 CX+P@-- 0 7X+pP@-- 0 +X+P@- }- 0 0 )X+X*O+P@- k- 0 0 X+X*P+P@- Y- 0 0 X+X*PP 0T00aS0` 00S0``0 C:PaS` 0` 0R`0 0@0S0@T@ @0 Q000S0W' AލpX+#X+ X+X+G-1MMP, 84 1ݍЍP0$C:P @4@0 OPZ30S Scs 5@PQ v0 3@cs0S0S PU~\30S5 0P/ P30 043 0 $3$ 3Q0RQ300?o2&Q20S  2 0[P0002@0 0R R00 R ?P 02D"000 H 2 2QT100?o2& Qy10Su 1@P0001@h, X 0 PQ0S0T缥B ,PU Q 0S 0S0 0P+ 0! 0 00} 00QQ000?o2G&Q|00S  d0 0P000<0PX+/*- *\*|*X+*X+X+ *x*X+;PC-p0JM M 00@0 0@S+ 1 @Jލ ЍS2 0S! r9P 0S0<PP T0  x1x t1 R0 0S0QY`# 81 0S ,1,K ! B9PY$PX0S 叼@'00 R   R 0 '|0p00Qg5qp P0ST00@[X+X+X+X+O+X*W#TX+ 0 0 0 0ZX+y 0 0 0 0OX+FC-KM MP* |2 Kލ ЍP0`"C8P @@2@<2000,TP 2 0S@ 2 巂. \P0 aQq0S 0S 00 3@P {.d1@0S t5PL1 `T0P <1G-@`pFoᨂ@PP 10S 1ЍG~Y(& 1 ЍYPq YP4Y! YUQR >8@P dPPPA @1 ЍG0P,1PP(qPpL6U@0 000g#T<6U@ pV(PPP 0RP#N` 6|0@0 I000 L0=# 806#O+X*jX+`e}F(A- MPb& 2 ЍPO0S!74P 0 1CGPP 00|S 7P .P 0t3P@h1d@) PP!@4Q-=+`>)P %5P00 0.-S!0RÐp@-@P 00PU  C GPp00p@-`Pp@0P<$0 .0Sp 0h R00 Ѝ0 0S0C B RQ"  *P/0S/0@-@Q0%Q#0S P   R   07W0C2007W  Bh%G-`P(P @ `CP  ZCPU0 00P0 10S / A5Pe v*P@85P 0pS 02P pg*:P)5P p_*P :5PQ p000 SP10S 00S1 @RđU0 pU `BP0 0 U **'*$* 0 011 60Ѝ @p) Pt= 0S000*0S 0PS S St0 0S 0`S@)H0pW ),p*** - BR0 R  P R `O-0@!M M P<@8@4@@0D@@@xBPm4` 0p 0S 0S 40S 0S H尓@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /ITpKX`V <5PUp@ @l0S ;H@P d`P T[P DVP8f (a000@09)@P43P 4@P@.)4:43P 00%)<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU x/PPP @ @ PpW l/pPp3 Q  `3 ` +4< =0 080( S, $#(0 00 0$)0"0 0R S"  c`pPR  0(P0 Z , d0%T00S9 llX% 0S1  + ;=0 00 (00$@0S0S20}Sp+ @/)3P00Y@VN 0SK U +H;+ H.+H.H` +@;=0 00P$` Q(0 A `00+S;=0  0`0@@DcT@@0P/GP0,00(S  Zc@pB%*6>FN{*|**]{O+X+h%Ĭ***O-iM Mh8dLlOpt͍40,xHD@|0 0PH0.600K/p% ,A'@0'4QD'8aO?ⰐV=HLa少'TU01p 0S `PP d0sh0sl0sp0s0St0s tNU 0S V|V?0S a'?0S0 /FPR'O'P?0S 00SV4  0 _ 0 .=0S ~RP' Vi<, )0S ~O)]P$.`>`N0 0 )00 q:QT /=0S-p= 8pR( p $p0p-0 RVAP;0 00|S h4%0S;0t }ILM H= $= ``X[,&:H;P0S000  V$ ::+ 0S 00S -0Py 0Sv &p>Ȫ ܎PPP 0S :/FPR>X :HK?PPW xPx0SV x0SZ +0 0$ Pk$P %)1P  0`!U/1\1X1T100p `10T1S 0S \AT! 0S |@P l VUR0 00S 00S P P &\K8KύU000,! 0!c4 8!0R PP000B84010c/10Q`P VC04 P PtPt0S4 0\QU`P@xTv B 0k_0P0/UGP80S PPk/i@ꐗ #9 900S Xk?/@80S00?o 2($PsP0 QP60S P 0S%P 0S~%6Fp嘆V?P@3x)t8Ql60d6qP 00@T T= 3BP 00@T E= $BP 00PO PM`mElP<Wt'8)NP<J060S(`x@T*4!@'K,' '5uPU<0Q $0G 00 S$0 0A0 0/R< *R0 &0Qp80/000S* !0 0O5P 0, sL0@LsbP 010SsHP #Ph~P xyP  qPT~V ᕿUnZf Z000XP SP P | ",FPY Y V` `T dbU#4K/IR032 U 0S|0#0 0ux#2S 後T$V <$4Y0SK?00 T| V %"4 x}SKP|D4 儌T0SJp40C $ 00 00Q$00S00{s0Q 0 00& h50S0|0 5j80sw858p00 RQ ;T0S50BGpC5d2S & R 6 P D6P P P @F! 06L6`l0Əs l0l0(@T? V  K%PK>0 0 > 2 @R >0"0C?o2? >"0 "0ALb.000 R ;R T<P 000 R RT 0S>0S(0?'"( ,0".0S ?0.T0@.͡!͡!..R0n0"R0.͡0 7$PP#PP0S0S80S#PP Bc(H000.R0@D0$. 0 pwx'xT PpPT \ X^>XP\ #P U x U R90S 90S9yP $l-0S @DT90S pYF1!0S   PZ0S= S Ek#H: H:` T00R0SC rPqJ  K$P  :;P Ub d:0Sd: P _*+ ϠP 0; R#- L;R.sr ZO.!0Q3/Pp;@/ ; R0 ;Q;C.,0 0 S dh lp#0S,|< 0R.Kp n/-0S 000S 000S ݼ000S ּ00|iލ Ѝ0S 03/0S ļ00s@- P@8P  8P0P #Ѝp`P  8P 0 FeUpP Ѝp@1 0S S0S  80PP0@-Mh 00P P10S 0S00 0 Ѝ qQa @T0 S 00S 0s 0 :c*P 0 S000Bp@ T d9P 0|S $00 0S00 0000D*|*$  ***}@-`$MpP 20000000^@T70P/S:S y@P@tQVP $ЍU;7P!@ 2  % 20/0>PP":>pP=@P/000 09@P00(`0@@DcT@@00@0CcS1S@X+%PP00/@- < (0@  000<@般**@-; t0@ d00S X0 0Pp `<0000S ;@般*x*X*ԣ*@-;@`00S T0 0Lp <8 10 10S ;@x*X*ԣ* h0@- X00S L0 0Dp 00 101000m눬*x*X*ԣ** -X0lM@ d @180 0p  M눬*X*,*@-0lM@h0 0 00 0rS sS ld d1d X$P0 0p ,d $ꈬ***X+YJ{X*,*S@-`PP@ @0@s8#80U 0s8#8000@? qP VU 0A0T0Ѝp00CS0 S0 S 0 /xO-pTM|0x0?X0 "? 0p 0:0P`0V0X B@0 @040SD H 8PZ0S= S DV0  S@P*:0S :0#S :|0pS l1 R XaR 0# ):tp uTЍ  ?$0000  PP|:0S x:0#S@DT|0S ph@"\)$0 V `|#L"0 0 "@BȬ*X*O-@BM MU@$@ APL?0a>0 @@@0`p5(`5夵P<($| PP)|50S5W h% 0\U D)0X,U S00H00S 0S  0S 0 S  R 0 00U!$JPP$Cp 0㤴 ۽)@P$1p 0\u`8 4 ap0TS 00   00Bލ Ѝ@3@30S VW@@c3!圽(3 0  U@ L30S.;50G?oV20S4 30S0#3 RJrTN20 CRk2000/ U)U00e@ 0B>W0pXP44220S V: V `2HV"h2000; "00ET1#0 CR5@V-U 0S 1  00 0V #T V00T0ST dT(U@ 1 p1L10 CRVT$10S@d@0 @SP405+( A/10S (3/1W 0    0QR\@\0 RZ P :/ 10 YS P 9/0G * X+*P***X*L*T8,*m X+h%O+<T**-A-` @T 塅 0 ЍAЍ/0p0$ P xc' h0h 5o:0@S mP 5/L*X+* Ð,*O-@sFM M`  @8 8 080$0`30(0$ 0,@F0P SO80 > 3 Fލ ЍF0 @,Q(y.2@@Ȳ@aGT    2 F 0 PD0P|2d w<P `"`dV. LR.0S 00S , 0(d  PP dz@0S00?o2 OPᚾ 20@6nF6 D01@媿p  dR 01 }D0(66S0d00 0d0⇿A0`PS 墄P P 00S t0 |0叻HP@ 0 @0X0,`@R0?(**X+O+*]{X*x8*P*FL*9M0O- WJMMsn0pFXv600S00p  9@P͛X 6  60 9.PX廛JލЍD60 0 0,097S 60Sa 6 Hbн0050S# 䵟0S5 Q S 5R "P 0S 500CS\5|b00l;0S P97S, 5D 58%8պ0S 500CSX0$000(00000 |PN 4r0000S40܀C XSX @4000C 0h00d0$ 0`0 P@ CSP 38w!>\ 0h0d<` ((0#$0#c# $c4"$( <7$("", &R h3U0 R0S R3""44008'P 2X 0097S0000 0 0S  | 0 p弚8'P820 00 0 0 5 pP 087aP0哚 97R` S㸁 0S [10S/ 0S+,0 00 0<0 1, J:P8!81 R  t 0 ) 1Z&P 0S 0097S;7(0:70?70>7='<0S P0s00UX0 娹0Su [X  T***4*8*_ **X**|****X+T*0*#5k0*;K@-2Bp`WLM LЍ@ pPk  pe 0001D1 0S<0 ?!tq(7(00 Q 00SZ=9Q ='/?@#b!"/p8>50S :50#S 0(60 8pp *50S &50#S 壙л p»p 90S0 00 0 0ּLЍP4岻00꤬***Mb*b0A-H`D0 82Vp  R`RBR RB`2b  Q  ,+00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 _9V`@@P X`@P`0V0U0`.S00E*X*@*0@-XQM0MS D@11S 01 ۍЍ0@ , @ P 0 P P "0 PP  @01S 0 T  +p  BPXP000SPNۍЍ0L**X+7P*00@-$M00D 00P@`4`$\4Q00P4@T D40S@ 440S@@$40SPp40S3^f 3 3w^$Ѝ030SCP LPDhB `3 0 HvP@-!/0003 & dP@#R000 00 0GP  t?P d@P  H 2@"0,2P0 S R0S S @T% 1Ao0S3 1o10S 1 wP5_]X10S  P01S 0 0S PU P 0S 0S h01S| 40 ꇼX+ `P+O+O+\P+|*X*vX+@*8 X+,*IJ \*,*P*A-M   dd0 8 4 L(@(<( $ 4( RS $8Q  Ѝ 00-S0S 7 7  770SK0<00@0D07 0@PPGA | t@ 5/PX`7,0 7}P1,PP47`@0 $/P /P6Qu AQ ,0 p,0000(Qn C (m0S 6 @0suD0svpFP]00<0Sp40St5$  0  q 00|S  0DP,,0Sp5@5<0 刵,,0S  5P<0,0p,0PX0: S 5 \X4 n0 0,0'4 P 5 00S,  P 4 440S!@@Ed4@@0Sx4@y pTPݷ@40S 4040 ,4 qLeD41S 8$ R $4P 4P P P CD0s D30SP $30S 30S2P30S Br,03p`Z VvUP I0CS,0$#p,040q403P001!P =<0S <0,3/0,0@44@\2 R0.P00 S\1#0 ? 0!$$P 48 pU,,00@ y000 0400@ o0800400@0 0 0 48 p 400@0 0 0 o$\0 5#2@HD D,0S <0,3/4 Ь*X+zȬ*X+**\*X*`P+\P+F,*,* < }%X+ X+*lTjxO+*$*X+ܬ*@-GM $, 0 0@_$(000E@P+,0+40@@PL0;@; 00;00-oDD0S?;0SW 080< @ + RD00S0l H0PP\KNXL41<S$4,P $00|S $啷P/$ 2@/0SR /0 SN $ ): 01RS 41S $00-S0S : wt:$ tqD0S $ Gߍ 0S ,: <0sa@0sbJP0080S\00S`9 9 t9T$ 9R /P90S ;/0 S $P$00$0T8 $/00%/0 S$%P$ 80SD8Q0SPPP=D0S!0S' J+80S `x(P  7\(080sS|M48  ((Pq00S  PfL000S|P 7 D7 R0SEP41S$@+P_74!(07 7 (0p(0p 0: S 0&0&0 71S ' R 7P 6P P P F=60SP (60S 60S5PP60S 0CSXD0S9 86 5 (p($Q+$Ւ$00|S Y@$f((0S$r<54! 45 580$ >((0S5$00`%p00(0q(0\5P001!PL.0 SE|4+80S 80(3/0(000L0S,4 SDQ  40S 8 4Rc qpz `ĵ%'0$`x0pn3X@$PH  0$ñbLP$FD0S s0 0 @ 0(@兆P`[ T0(0 00xPO sa,pI P @`@#0 ? 0!%0 S0 040  P@ H0S @(, p% (, pU:000@ d-400a-0 S@1(00@G U-,00(00@Tl!000t 04p@ TL0$a0L0 TU0 @%\1 #\坑@L P D:X,00S 0><@ (0S 80(3/0Ь*X+Ȭ*X+**\*0*,*,* < }*X*X+*X+\P+`P+X+%*(*X+FlTxjԬ*&;oIJ /0WX*oQP@-X@ L0 Y iP "@ 0 P*X+@-@0 ᄰЍ]0 Qp@-P,@P@p]P @(C%@-T@0SHP00 0R G P*L'!T*@-T@4SHP04 0R * P*+GX*0P @- Pp@T Wp`W VL\ P  R/xC%O-@p`MP)T oTP ЍOCT <<@DT#Ѝa 1 !Q@ QP ЍO(u 8S 0S P pP 0 ¯P 0 X  " 03/0 00$姯<P* ViqxC%+8($\!\R% R 8( -0 \ \ \; (R ( R 8( "\  \  0 ( ( !R0/\\\0^ (80\ "\0 0(88S08 S 0808P*J%p@-H0H@8D0 (8080$8P Up$80+P**@-AaM(8S GV0 S  E0) P p p $8S 80pP\ UP 0S ,8S0V (8S 00CS0 [0 0p 08! 8$ 0p3/48S 0S 00CS0 S0  P0R H@ Ѝ%P*+Y1% $  P/@-@P$P  -T@-@@0so,00p 0Co J%X*4$0 00/O-tMM JB0 @T(0PPZ@T= P  4 0 +0 \!`Z0 0P P@ !P@0J04 3# 0 0#`.`|Pj J#[3000 0f#` V 6[ 0f 0H#`< E000< 0"f0 # 0` U  S  RS00 "1f 0;#;Z0S;#;0 d*"?;#;0 #5;0?;#;0@#5;DED"X@d `U0` 0$PZ 2QV"0 P NP! 0  !zP00`x!dYP 0e 04!倬P<00@<e0! o 0$ @0S (P0S S 00d Z@00 dTX 00p 0ⸯMߍP@ %U[0DEL갬**X+.AȬ*zX+Qm X+X+ԣX*@-)X0@ R0D00S 80 00p )@Ȭ*x*X*ԣ-$M ?0 0 5$Ѝ0-4M 00 000 &P4ЍO-pQMxFxV(Ṱ "0pᰰ@&0 0P00000 PU08 RPU5"R e0*P\0 00$00S& (0s0S P l@d50S` P%A␫`D5X05t $5t  0dXd@0f$r4`4Y-IP 0#IYڙ$@$壒I $f $2U`0 lğ R#3SPS0@ 18$0@0f;00`p`V 80pPZ`V= p S 3 0 0 "T3PT0@` 0P "|@`0$% T+&`#3SPXK1d$K 00#50@0  "j2 @@V0Nx2d R@0p0,  0CP0V001*x"3\?\ 0'0P"P@D2 0@p ' ~(0S "%+0!P@`0U0!ᖪ@(0S@0d!卪@t1 0@p Qߍ 0 V ," 0"R 1`P0P  bP`<@0p<@|e0 M@ GX+X+Ȭ***X+ X+X+Y@X+Qm !m +.A8MX*D*Zԣ@~g@@-'@6'@p@-Bd00` pd00CS01!p ,P P00 @R0S"P8d`Qd00CS0+ p "P \Pd00CS0p000S 8A0QPA p0 0 `Vsp0 c`Pd00CS0p 0@S P,P \Pd00CS0p `V0 0 #Pp@Y+$J%Y+A-pp@`dP@ .PP Z@P PE "P@OoB@Y+O-,U0mMS p gEPd V&0S Ҋmߍ0P.0͵14PPd'0P0S SUpG Ph4P PP P0CS p- P P P0 PsdLD#P P <#P d0p  P 0? hrdrdp P 0S d0p P0? rp P 0S0S df0 P P d00CS0p\2\P P Q4280 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0\S81Pd00CS0op0 dL\0_p 0 P`, ^0!S^0C0 drPXX *Y+T*O+X*Bah%T*T*\*H*@-0 @0SۥP   P  0 00@ x0 låP T0 L庥P 00 ,履P 0 h%O+ֈ00CS0 S0 S20 /1A-0aS0P0P3U P 00.S Ppd1l刨 `L2 X1P@  H,* P10T0!0!00 (1( U 0 ! g0Aq000 00000P0 0 0pS000P0T h0h0 @U t0{!P$0`hO**X*T*X* \*>O+O+`P+dP+TO+* rp@-@P 0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0pL*|*O+O+G+****\*H* L0@- <00S 00 0(p ]눬*x*X*ԣD*A-@#Qp0S `0S p 00`P㈪n00000S t`0S p s000080uT  #p|*L**X+iO-P"2 AM MR0xB p" R S4 P V04 S` 4S4P  $Aލ Ѝ4Sg1+;004P/S + + PʇpUp儑0倁 00g000000000S L1o981&$1 R100CcSppW100S 0o 0000004SU00o$@oPPTy P00**xY+|***X+*\*FyeX+T*A-Q0qS0`00@S Q`Ѝ0MP TP lo0 R 0000@ Pl00}S0s00T 0S$@,M **O+X*T*h%X+O-쁟a0AS000qSP4M Q 1M4ЍPF P0.0lP00X'P" H@P$,!0>20$A$000 05@, ! P 0 '@ P 0$0垢qp00P0}S0s00U 0S(@<2M C**O+X+X*0X*8<T*x@-,@02 ‘P0]+A-`P㭢`p㩢 Lx@P  8r@P $l@㕢 V,@-@PK+ 0A- 0@0PS0p`0P㬀" DP 0S 0"S0x R S  p`"R"^ 0 00G+**X+iG+T*0@-M M P  @Pۍ Ѝ0Ph4/S) @ P;0@TP/PBO-@P`pW 1@@Pp3:pF`ܰ0X1 0T@1`0 10S 0 SY G0-L Q00S*00 020 ЍX+X*@- P0@0 @p pP0 0SP0 0 @ЍX*ht@X+P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0Cܬ*Ԭ*hج**@-0 000% 0S# R 0S0000S b0C("( R S 0     @    ,  8 Ѝ h%d%7@-@P0S 0t 0p0+p\݄X@0S 00@ 0,p( Ѝ0@˄ Ѝ0$*(*C-@\ᄐpA`\P ^T1:00"\ \ L 9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR%0R0PMU20S2 2"0S0 C0GQ .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10N[00N B B ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0SP ^*0SPZ*@P0LG RX QP 0TJ*/0SE*<0 RS=*9 0S  7*+0S2*> @ S,*0 0 0GS$0P(0&|*}O+G+G+G+/A-p`P @lP0  T  `00T  0@ R   `FVp`00CS0 X PpTD000`000 T00%C-pP`@0尐TI 弢 00@)ax0@P`0 \嫢qL00D P 0 Ѝ+?X*%%/t*p*G-M@ `' 04P0 43`PT "P #T 30S+ ` Q `V` 7pl0@00E.002 "P El"lXE@XՂލ p`0(T $Ƃ p T⻂0q10@S   0$ 0/ 0$ ҤpO 0$S*F>C0S  X4 `$Q(00SZ=9Q =(/?@#b!"/0 0ᗤp40S 0#S Z0AS  T0 0000 0⪥p 0S 0 0 vpw0LT P<00]{8*@Q4S*Mb](p@-@PBp@mDp@-@`00CS0pP0 @ 0S0`000#S V 00p0 PA-p@`pP0 @ p0S0`00h0#S V b00p@-@PP`P 8Pp0Spʁp/ @-@bP @-4fP|@-@Mfp r)P@-dCPeJp0@-PlMQ@00 00 T  40S P x00 P o0 0U 0 PACcpW' 30S @@@`  L P @` PJ P i0 S8 媠0P 00P02 圠 2 PP 00 @T i H P 0 0@T Z 9P lЍqP 0S @P@E ;   P@0 T T0S @P@& 0S @P@ Tw 11@T  0P w0p`VbPP)]000N0 0 0PhQ XQP@*@*X**1A%`/X+"*4G+\*|*T*H*v+p*t*G+G+7@-P 1 Ѝ0Q0S 1 1ğP !0 CRhA R S0T!L1P 0S0,!S 5P 0S 10S 0 0吟@ @0 @0@0 @0 @0 @ 0 00S 0UX+|*O+X******* pdP+`P+\P+1P+P+;O+O+,<r> 04Ѝ0e+PM%@-`0S@ P 0S 0000q20\ @qe+7@-0Pl000@h R R  l R  P4Տ03/ Ѝ0Q PPM%J%e+p@-$A`1QS 0SP ȋpA P00p00} 0P v P0 o P0 th P  dd\O0H@H  "  \ pPM%e+V5Ni~ h%$L%yg+00@-18C8S 0P 㚍PM%j+@-(0(@ g0@ `i+i+Xi+p@-`BM Pt@0 S0`018C8ST01y0 Տ0Pn00x0 7BߍpB/ BR 0J00P y0001Xi+PM%yj+`i+ 0?o2 0/PM%@-AM R 0b0000@000  Pڶ0 q  P 0SS WS BSr0 +P  TsW 0S  1@0S0 pW ⹑18C8S ؀0S R     |P W 0@^S00CS00  S00 P0SPi+p tg+i+ e+PM%j+p@-PH@P@p8P P 1P @PM% 0/@-o/A-@PP" p00CS"u `v Pv @v Pv Pv Pv v `V PP5ݩP0 P00TA$ 0S P0000 !0S0R 00 A-AP00C!SaXp `a0000CSPw dw ,x x ,x ,x ,x Lx `00CS`0p S X0 X 0 "S  0S`00CS`0p SX0 X ! 弍X!Ȏ崍0 0P0 P000 `堍0"S0L0A $0啍0 0P0 j+%>h@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 G-@P2 pqp =`P`pPP2 00PF 0P ) V @P @0S@0S#00@PP?8P PPP P 0!SPj+PM%A-@MPP\1 u u@P `p崀  aVP9u00u0ۍ0 PP 0@ 0000S ᯌ  P00 ZPM%h+p@-`@.PP 0 Y)Hp$cPB@ps@-@P` 剏 ( R ! @T|fЍp(R( d劏0PP O<P K(P tg+f@xt yt j+0@-@M@X0(@,0 0 媮@P LЍ00,5x0 R.PPPP0S 200@SP~ j+PM%tg+@- (,⍮ j+@-@ 子 姐!lP   0P3P xދt܋h 剐 X |Ѝtg+xt yt )/2If@0@-4MP4PX 1<18C8S 宋Ap 0 9 0sΉ L娎DR<P8 堎,0E R 啎 呎;P! 71PP 姉0(0S$4Ѝ0=Rk00ES( ` @ H P X t_h]`\XT HOLPM%tg+%j+ @-0 D@3tg+-@-Tnb-@-Ln0 R   ЍЍ/k+-@-U0 R   ЍЍ/k+A-ARp`P@1T  pP5`@DO-dM@P壄0P0㜄0P0 0 '8p800,@400(P@`@P p0p,0SX ,0S5TX L @@[ X  ( 0 0 ( (c΍psP T+o,00,00娂00T񟗾Ȅ t ؅  8 X h І @ ( Q 0S0$S{y 0S dЍE 3 P ( 0C,0P@ @( QQ , 0C@( ,0u( Qh 0C@( ,0j( 0C`@( ,0bV@_ ( `F  ( 0C`@( ,0R( 0C@d( ,0JV@F @C ( Q @0C( ,0; @8 ( Q @ @` 0V @,80L"(5P6 <(V60S!4 h 8 R0 X (b0R040880P(<[8 8 (b0R  $0 VP $0 P H8 Pß0000S(u<@SX (  P0C S,0( X@S( Pl0C,00 S( L+Hk+b|&>NqO-lM($ PPU``8@ p0  0<02@02 @0` 00M@P h 31@` O`@0S( P @ $0lЍHn?@d χ00 S @. @ C< Ⰸ0ЍC 0xO%$>MT%A-MpP`ЍA0@: SPPT@ᵁ`P00S 0 00hQTP1 p P PU0DsLS<(    ꏹak+ZbsO-0]M-SP MP @p<EP3 00S0W0S( @0S# ` XpPi40S ]ލ ЍO~v/;]ލ Ѝ  @plU0* RT < RP ᣊPP$Au ᯊP ᨊ30v: S+ , 뤳 0P@`P;  lP pd ` 0 0L0 00 0S0S`- QP``_v `0S 0 GP |V ?P `z{ R y8MRK pP \ ⌋P x!1Z[  0 W.T[p`l< 0S'HQ0|!0v0Q P: v?b ) 0S-vԉpP vq W ]ލ ЍO袂P-9Ӊ 0SΉpXP P : R S00 R0S ᣉPPdVT}k+xO%ax /Ty%0 R R /0@-@P0R0  APCU 0APLU aC\ACP 0^0\0R0 0 0@-@P@@ I!P X!IP00S D00S  40 /I #P@[8k++Ly+|e%@-J돞@-̀Pp@-PT@ބp 000/ l+p@-@P0-S@@p IP0Tpp0p@-0@S`@MP0@ Y P@ЍpPU P  g0P0O% l+@-@P @R"00S@& l+p@-@PPp00Spp@s l+A- `pP@P000 PP0 0ݖ@-@P P0P00S@ l+@-`dMqPU> 0S; HP2 @@?T/   `00@ C @ H00 *S 0 000?0`?ZP10HG>8P dЍd 0@-0S@ l+ @-B4M$0S PpbU(p P 0000,p40Շ h$P4Ѝ80S <080KPc 7PW %KPQ P1 2P 1 0,00000400G?000x00002002"0nP X1 KP4 P. P ,1 P 1 K P1 K P+ 0P$ P 0 P 0 P! 0P 0 P 0  0 0 t0 h0 \0 P0 D0 80 ,0<i l++:,7@- 寈PP@0PS 0 P  TPʼP  P 00  0S0 0UhP xP h`6PTP Ph0hh0SP0h0 Ѝ0ht@ l+qO% @-,1P0P@Ph | Ġ Р ` ` ` ` ` ` ` (P 0(  ЍxphP0PP0<l00l0l+!$'*- l+@-`M]yoPuHV0@EP<0LP0$0P00:JP 4Ũ 40P4  TP00t<P00\Zqt0AȨ+k+2bN\y+af? ݖt5?e#+,0   l+0  z l+@-@(=St00S h00S\00S L00S  `400S  Y0(= l+Ĩ+l+L+++0P/0( P/k+ l+0 A l+0 $ < l+0 7 l+0 2 l+p@-D0@0S 00S 00S  <0S <0S 8S0,=t00S  \00S PH0(]0Sp@ lDP 0SpĨ+ l+l+++L+ب+/@-0  @ l+$00S/0 R/ + l+00SAD+0  l+0 l+@-0P4 P1 +P00p@0-0C0LS ``PYP"0-0C0LS rvp` 0  0.S00 U`T  Ѝ0 n @-@P P  P P ЍQQl0l0ѲQQH0H0 Ѝ@Q$Qnn /p@-P4@Pp@?0S +S70+Sp@p@@-@@@    ~0 0 l+n 00@`/R%p@-@lP     <00S   4u @p  l+4+D0@-0S 00 @T@IE@`+ l+@-@0 0 0@ l+@- Bo 00S fC0 O% l+A-PRp@ FqpADFqp JP DPp P`UX@DTUtl@8/pXVt @W@T*U A ) $0 0) 0 00S/Py+pp@-@ P 0s  VD@pO%)O-`0S@p 崠)0   ?990 VY†T00S[  RP q@  DO%Py+>P 0S  R 9  (0///Py+Lo O-ܤM`V 0IS(,  RQ0 R005s: 4) "P  2"RgpV  rq% 4$Q  Q Q 0y#P 0    `  @`   0 PP 0 @@0bvyf`pzVX!SR@ 0?  0qp1vCЍ QP$0 0@R*20 R    @ @  " @@900 SP05:Pj09a2 豟q4   10SO  09ϬRXV |a0SGx^C002NAD10SI T10SEPB  81 09 0 00*b&@p 09c|p  RB 0P  ) `00Sh0PRc0S@00S\ OPy+++O% ^k+d+ +Po iO%+800S 900//Py+@-`@0Sp <)00S000(0,0(0,0Py+p@-@0Sp Q 00h@y00p098@00sp000B(Pp 0 O%Py+l+t+G- q`V= P@=U000P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@Py++@-P \00S @ T S 9(,0 Py+p0@-@TI0 qp0@ @}00pPy++p0@-^ 9 @ 0@&)60 P@ ^@TPy+0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/Py+P00010 0/O%7@-P R I00 0# Ѝ00R$ 0@!"0@@iqp Ѝ0@LAPy+0@- 00Y Ѝ80098<@ q|/ 00\ /Py+G-pP`!@P"i9  `0  P09   q!09 rPGl+Py+@@A-p`VY@  @ @ 0 4xP0 0r0 _T 0 0x0@A;!Py+l+0P /Py+\ -P0S0@  P2:1S0BS /O-@DQM@@@`@|0S(!U  BЍObS9 .S8 00C S 0  ?QP t@cS@U:i@0@0CS000 000C/  0? QP @@\y+\z+p@-@P 0S`PpPQ MP@dPQVL,@E<P0S  p PO%Q%A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SPP@u0C?o2\y+@-dMpxX@P{PLyPHwPDuPT 8S8c(s0S3(3(!4!!!8!! 0 -R  UR +R  >Q @c?|0:S [?t0cS .S bS S@ @0,S@pS wS ,IP ( AP 3wPt@Pp@Pl@P0 0  Sx=P=P =P=P hP ^`z+lz+xz+z+\y+'^iR%z+rz+3:Ch%HNTY 0/\y+@-  01SP R t0 T!WP R HHx@08 ,y@"P0 \y+z+ 0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aR R S R0/0 R /!0 R0S //@- @P $ ` 0#-?00&3?=0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0P@\@P, PP@@z+A-P` @P lpP ` L@P  A< $@sT 4+p@-Pl@P TPpDPpp@U p@Pp9}O-MM`p 0@P |P0: SX#xsX  AP  =@P> ލЍ R R R00 6P P@ /P @P (PP 0"SU T 0S0C0 6/ @P 0mS PF b%iZ b%bP P / ]{+s@-P@`{ "0 00 BЍpA-@Pp4` R 0S wp@o@-P`( @p0` G Ѝz+@-`@ (8R808Ѝ 8 0 CS  8 0C 8z++p@-`Q@PRpP0S  @w$0Sp 6wp@0S S D0V@ ` 0V, wU  p@w b%Zbo $0 (((( 80( /z+ b% 0( (( 0( /z+ b%C-@㼀`p0S Ѝ @oP0S 0S 0 ( ((08x9P 0 PP 0\z+z+7@-D@P@@00S Ѝ0 7Pz+@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08c9 80 8 00S08U9z+l+0@-AM0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS ڧ 0`z+l+@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00z+l+s@-@8 R 0R0` (0 RP08 80 8880S Ѝp0CR80S 00Sʪ808z+l+p@-p@XU N8PE`V` D0(  p8Sopppz+ b%(080S @-/z+p@-D@0S PX* 8P 0( ppz+ b%p@-|P`@_l0 R(0p0CR0R: $0( ip00z+ b%7@-@=@P@P  AP Ѝ00P$ /z+0S/0G-0PS`p@U @0 pP0@@@ X pP00pp @ aP00P+P R/-@-4@$P(0,0P  $8 z+ b%7O-0PSG` 8(hS?Pp $8SDG(R008(h8! 0S0S ] Ѝ0S08R00(hjP080h88S 08 ЍO`0F?oP20S `&0 S PpP0@S   ( p 8 4 eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)0$h48VK"3P( 圓R( B( ( W(PV  PPl>@ArH80S 48PS8P Jo088~80X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 0P0J``` P Q`*ZXP@$ 0P\z+z+ + b%+t0 A-@P `p M!00 0 B R   0.S u3 !` P*HP T 7 Ѝ0 P000C/0 !GP00z+0(8R/z+0$P00 /z+00S/ k+ O-鴑MpW]$ 00! 0U R`PQ qPpi@0PQSQ0Z00r@P9 p vP 0: Sp qu P)d0 R'0 X& ^r@X  K 0G0  x*2%ummЍzP00pk+ b%+FF i800S ,00S 00Co//Ll+Hl+Pl+p@-|PPF@T p@``mT0S S VS 7Sg@ @@+p@-@0S00S 00SL7P p@0qp  ~00S Rpll0P@ XP0PL0@p88 SP@WO%Ĩ+l+k+ +ب+Ty+@-*=@34G-@ eT00P  00`p|| 00ST V0 000S T28 @+Ty++A-pP+ @`0000  "P0;0 A! , vA0PP     P  5X A$@+p@-|@Pp$R0%S!S0C Sp S}    X     0C Snx        , D 7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP xl0S0pqp 0p@] 000Sp p@B0!S $P Ul$t00Sp$dP`p@&L00Sp7D00`Vp(V'p@4p@+l+k+p@-`@P 0p@L@+A-`P0@@@p0P/00,0S W HT T A,0* ~@+}+p@-AM0 70000\0  b0  ]0  X0 S0  N0  IP`0S1 0 Jo;PU0 D<<0 40 Ѝp@+]{+@-@0ˌ+x+H+Ш+++ h8b%}k+)+5El+rR]jk+vDb%~ +t+l+H+B+400S  qd00S`6Pb )P /  0m 12+!?P@H!R0 0!ıP ,P P !R0110+?P&!R0 0!ıP !R0110!R0 0!ıs?`P, aP?qp T2 !R0 0!ıu?`P!R0 0!ıP ^2`PBP 0`0,`?P*)P 00,00  TH30S?LVp`# *0u  PPl U Ui ?V "0> PrPY U UV "0 PbPI U UF :"BP40S %dPNP5 U U.P!0P.$% (P0 !R04 0S40գ?0/0 $0 S00C0 $5 !R085 0SH50գ?0/0 `%00 x5 50iS 0 |050S080200S/\z+p@-@P/!pO-S`PpM``@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0i80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 60P R* 0;P0   80 eP Ff [0J0C\z+0   /G-pȀWY+p S@05PPP @ IZPPE0S`0S P B0 0R R@0`p@-`R P@ c0P @@@ 0ppG-@P `pM@?00C  RT0Ѝ ` ?i>P ?0 ?>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#8  0 L+@l+ +A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ# 0 DPzdP fPP Q gR 0S 0R   R E0 iL+@l+ +@- @ @ꌃ+ @-P@,ꌃ+ @-P@v,ꐃ+G-(2pW pЍjPP) P0`jprb@P 0phqpc jj? SZ c0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Ul 5 P @U(X0jP +k++p@-p@`PP<J,<0SV@` `<D IP +p范+ 0 ꌃ+ 0 ꌃ+7@-dP@ P{P 0S  P Ѝ0范+Po/@- + ЍA-`QpP P P@P%U0P 0 P l @bT @P 6/Pb 4@-~|0p p0h hhP 0X X@0L L8P0@4 4 \b%Td%% 7G  Xet}C-L1M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@Ll+Hl+Pl+G-@`M0PSS003 @ R S0\R% :R R DZ BPp P0H3/0S@@ R0Ѝ4o P/@-)p N( s*aЍ00S @  db*\0PT T J( 8<qp +G-@P`)pppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(Vp0  S P 0F@@@b%Ab%p@-@QP 0S R SppQ0 QA QR P/@ PRP/p@-`9 PPp@p>p@, 0@-M + srp@  ) PP  000Ѝ0l++400S/@-$@P P@+l+@-@P  l+P/ @-p@''0@-M@'gPg00S@)PaP DP OP AP )dP oPiv|0t00SЍ0 g0LP 00Fqpg00@&)l+ KO%O-(M0S 0S H0@S R u P 4X ЍL G@j Pp 00n pPPP`TP DP  PPpP0S P``30STPQPN ((@(!P3`00P0`0 pP0`0 4P T ( _0 bgPf& 20SP `JP   @( YP fY |2 pd T2 +D2p@20WF0b,2P 0S [P (hP# " 1P C/}&0S )/ 1X ;P D6P Pd1 c_L10S Q\_ 010 (0 qp 000Sp 0 &P  0 R  [ R 0 0P: l X l+l+h}++k+l++ +k+l+l+H+8b%0++,e% P@- 0@l+00@-P '@+}A-P`XpVVPU@JTWlP0ꌶ+ 0 l+@-yP@ @0 l+ 0 l+ 0 l+p@-P@@P Pp@7pp@-@`P*PpVU p@] Pp PpA-@Q`Pp gu^q^U:G-@@` PР @PUЍp pPF^7BP ;^8p0SkЍGl+@-W0@0S @yl+0 R/%R %R0 sR0/@-(@0SP00+\jG-`dd@p00CS0 ጘp PP 000 P U 0D IS  `]$p@P@- 0P 7A-@0 0pR`@0S00 R0S@00`P0S U  LP@00@b%Ab%O-M@`DPp!Q Zo`@pW*p%pP` P` X P UpV`PL`00@0H0L 0``Ѝ8fP $`@00@b%Ab%@-@+pFPPP Ѝ@ʉz@w@@`H0H 0P0`] ᳉@ ] Ѝv<A-PPЍ0S `pN@K@@[PP D00< 0`t`W dP\dL{@-@@ 4A-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0r_@l+l+C-EMPPEߍ@ 0@<qp `,cPڬ嬐P ` P:T0S EP @  S0pSI`P  P@\z++A-kX1@0SGk @1RpP? ,%@ 1P|`y`v``P0p000 0`00_ \밀P@]pW MBp[W PR0S[Ѝ 6B[@k+}Ab%@b%0A-0S@`)@P0L W_@p`P[@[[k+@-@@wP ,rP mo}h@-M@P ᇲPۍ@ ۍ1O-0S# 10SPpuP 0 `|R@0 -R` h3P JP D$@ ЍP PP L 0^ J[ ` E[V @T P uX%XVbP ᕈT@@P@T 000d0(@t`<P#@{0S[l+k+}0A-`V8@PVpP0 PЍA#mPj`J@GD@@@0 `o^ZZ@ZT ЍA1Ѝk+ -M IcP  @oЍ0@-@P0MSP  @]] 'cP+!@Ѝ0@T@0: S *@v]꘨+@e%Pe%@-M@%cP͡0 00BЍ0@-Mp0P@u bPh0 R\P0 R\ tu p0St00Ѝ0l+++/<@-@P P0@/R@-@ &(0@0T>$@(+@- 40 R\00S@@++h00S /pp@-qp $qpP@ QPppTy+@-P$P3#0 R/  +O-q$M0S|10S%@AP`\\100CS0S#P`vu @@(P`0S00S($Ѝ|P`@n 0 R  0吠00刐 00 000 0 000000  0P0000`0E (+$+l+@l+t+H+O-M ЍO *O-P@4M(0X0 ,0ut@ P4Ѝ40SX400 ?Q)(@PPpLd00$0Jp P:P  ` V0/ C@p` P P@00Pἳ弃0v V `V@P,0S4 x3X4 @ P6L)X30pW0 0 `P20S Y Y` P P `V@Y*)P `@T_@ P0S x20S  P0 (0 S =  :&PI 20S 0  @ 1 0R00S8 P Pd p 4ЍO V000 P0m 0PA R TA 0 Pp``@P,1` !X$0r$0@P_ V Vj@Px P P Pr P^@Put$0U$0@P_{, 0S V V0$0$0S B@P O`0 ++Ty+++H+p+x++Ĩ+7@-P@vP ,0 R  000 Ѝ0H+O-`V =R+` =R-`8 n Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =ႾPV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` P `` e0S} 0Ps {Lte%+Qv%}%Pdio*x[$0 RP  /0+0 14/0+0 Q/P/xh%@-04 ,    00t+t+t+t+G-P㌐剀,N@(NPT`ppP UOT QO  !  DO BO @`匀0+A-8p@0PS` 0P0aP 0+@-@$ 0 @z0+P 0 R   /4+p00S/p@-`@m!PPPpP 0S8@pPp  Ꜩ+0+@-@P00Pl0 0  ;D0)(<'(8%(4#(0!(000+:̄+؄++++P/0/0+0p@-@00P0 0R 0.PPPPPPPPPQQPQ'H'D'@'<'Pp P0 Q000+̄+؄++++C-阁P0@SpM`Ip`ll!0 0!0S~0@ 0  @Pa00CS7 `PU7 0 Ѝ P -0!0S @P 0R 0rq0 U h Q H S  {PwPꨨ+p+,+@+0+<+O%O%,0P$0 00S000/p+<++@+p@-L@P`0S0000p01S 0p'P0+Pp@-`0 p@*X10S P@@p(1@0PSP5P/u`P0@@S  1CP0 1C%@4P 0S-000|  0p  0d  0@@PO 1C[P \z+0+t+t+t+t+O-|C0M0dwvP1Sy0\P1 0S Z 0 S1C10q&QF 000 00PP20SI 1SF P2!0sr R0l2ap01UPL20SDXO 1R.sr0nS`J j`0F[J 1RKЍ1S l 0C# R Y1S1S  ` 0kP  00KU1 0[0 `0S1& U F& 0R 0èQ0pP 0C001萄 S rI  00+,+@++l+̄+T+A-pP`p00S HP `P 80@0@D@ 0@0TЍ蜨+0+l+p@-P@8 02PpA-`p@@PGE$1S 0P $@@L+7@-Y 0 0R  x00S U d00SX00S D00SX   0+l+X+T+,+t+t++<-0 R!  ^ !00+04/0+0 R 00S P@0~0/0P 0/\!4 0 / B  0/0+|+ 0 /0+qp/G-p`@PpP 儐u U 0 0W 00V@00CS7P P 0P@P0++PG-P0P`PpЀ@ 0@D~ P tV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB0++G-p`P@0@@0W  S #R0C00C0Ѝ 3,P  j 'H 0 CpGA-0PP@q1k`EP q 0P 100+G-1@`p`P0LL0 rS00TD`0PT@l+@l+0+p@-@PPp2 P0S0Jp Pxh%@-0P xh%80P/ R/0 0S 0 /x+00 0S/$0$ R Ox++) +A-X@ 0S0dS 0p(0,`P` p U` m0x+AX0QH0H 0.4 00/ 0 0긇+x++A-@PU  ^"04P4p 04 R0PU R4`40 0 P ^PQ p0࠱`  0x+O-1P0sUPP@PP0⸡p`@` V R0 SRA  0 V 0  W0PR 0*?PA `Y0 0 y W`@TP0 00  0` qp +@PPAp ` W0 0O0  0`qp @TPꨨ+x++P0G-cpPU !R00 RS@ U W0S P*P @P P`@V0 0 0 0 00r  0@P`Pl`@W 00 0 00r  0@P`V@x++G-`;P@pl0Vs 0SP@`(P@tu TUP@l+G-\@P0p`Pxx80@ p 00  0`P 080qpx++800S/,00/PP// +(+00CS0 S0 SJ0 /O-0P-SP m   8 h"MpLPM@P0S,@ 0R S%@T I~ELLL=X   g  0 ЍO`P @@ M@ 0A $ HHEꉕԣv'Z +G-@P $`P( qpP `y w u S [ $@yz  0Z Pp@ ;p Tt p@\r 3o 40 } pkF?ԣ +C-`Gqp pqp@@PP.Y T0 0 Ѝqpp 0  0a0@S@-TA0@S<0'@ Ѝ'P( #P  R 긠+X+8+.Pp@-9 $P" 'P= P !srp: p^P 0 &- &P vD06 p1Ptd0`c@P\0 L0Af&P,@m006pl++@l+X+G-@`pdP4T#0 5T Ta0'0000aP0 3D@6T P'0긠+@-o0@-MPh@P   srЍ08!P D0 00&l++@-HP!sr@ 0! 0&踠+@- | sr @@@60P&6 C0606Ѝ踠+l+G-6@PP`j>T6k.sq 00P6 C06PU p)`CP0PPЁ  G.P 踠+l++@-P ,0 0R = l+l0@-0`  ^ @^TSa04S '005S #l++0@- @P0QA 6R 00踠+G-[pP@P P`PDC`ACp6W @踠+00S/G- M`pG@吠吐qpp6W @ Ѝ 0 z PU!P P P 0 GD++}@-000mS Ѝ 0 Q0 >@P 0 S#  PPP0`0 S } Q0 R pV`PPp Bp00@l+17@-PU0P( P@ P0 Ѝ000SB@PP B^PB Ѝ0@H00S< Ѝ0@: 0 0$04 k+l+O% &2 0 l+<07@- R P(0(@?@ 0 Ѝ0v%@l+@B+@-P M# @0.S Z00S Ѝ ,0S 00 00S000 l E}P0@  0R 000@0,0@v%BX+l<07@- R P(0(@?@0 Ѝ0 v%l+@Bt+@-P M# @0.S 00S Ѝ 0S 00 00S000u l MEP0@  0R 000@0,0r v%t+ @-@PP  @H Ѝ) @-@PZP  @9 ЍF 0Sp@- Sp00S p@t' tl0p`{P p@qpP@ 0p@ uk+j ++P07@- S SKl0 Ѝ0XP@T0PP >A@z Ѝ0@5A0 00 Hv%Lv% P/L0@-0@S !00 $0$ @+l++P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P@ Ѝ04@P,0  0 10 8v%4v%(+000D ;0Ѝ,0P 08}X+T+ P @P/ 0 / k+P/00SL+0/@-@0SH+0/@-,@0S0 0p00Ѝ@+ 0/@-,@0S0 0^00Ѝ<+M 0/400S/(00S/@-4qp@0+l+P@- 00@ ^S00S00 Ѝ0X .v%| p@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0SX 0Ѝp40@0000$ A @(+$+/l  \ P@-P A7 ЍRS+DSSS 0e C R, 4 Ȧ Ȧ Ȧ Ȧ < Ȧ Ȧ D Ȧ Ȧ Ȧ L E C CS -S 1 CR 0CrS dSWS ^S0Sh0wS     0  E000 0 FK N R WR Q S-00 0  + 800S ,00S 0P//ጨ+$+(+$0P/0 0 0C/ᔨ+@l+(+@-PU  @A Ѝp`@PppQ 00S0\Q0S 0S@V ᕫP 00$Q00 \+@-0 S 0*( (@ Ѝ * @. +3 @-#@ #ʧ+/ P/0S/P 0  //]{oP@-/ 0LP/ᠧ+ 0@-L   Ѝ䠧+ @-`MP@ᬺ0-S0p00Cp S T 00ЍU TP PTU $PT00W`> Z O-P$M cLP 00S S03/0L0$ЍeL0 @PpXX 0 R @@-PD &$PP 0@093@!+P0P0U0 P @0+S3P <␺<9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P!  aK[  0 p0 @ =RP   R R tq000SPP000p00CS T l  l l l Ȯ 0U?o 200@S 3/TWU 0 [ 0S00S0000SL@40 S 0_P&00S ꠧ++l+s   @-@PM @PU@`p0@ mTPU   c,A R  | 000CScp $  RzV)00SS# P}U  U Ud0?o20RP 2/ 0RP0 VX 0 |Ѝ 0?o2RP0U U U7W0 0S00S00W 0 0S00S000ES\ RU U U , 0 S0R 0  b R U2/U}00SS 00S000 S000:S U000 0 ~0Kw +s@-P`@፸000C S0 ` 0 B ^ ST00T00VЍp $`|S 00>  000S/P/Ȩ++@-XP H0H@ 0S0S  0  03/$@+i% 80S/S/ 0CS/$i%O-@pM4Q0S [= 0S0 0 Ѝ`V/$P  0P ! AAQ-P $ SQ@ S0 奵0@@Oop B0 R ` 0 0S Wp0pi%@-%PP0 v%/-4M@20S4UP 2     A2 0S 104Ѝ0! R0< "$01 S 10S 10S1 `11S(  @2 T!2 R (10P!000 0 o R  R@0 000S P 10S 1s\ 1P %0S~ !0#Sz ,0 0S P  0!+++++d+v%Ty+v%+@-̊+@-  Ѝ@-P;`ƴ@ô@@ap0 `< Ѝ@-@;P   +G- @$p`P 0f(S%0 [ P@@@0^3#@- d 0 Ѝ,7@-P@2"@? Ѝ0@B@-<0?B3c/ ( 0 0 -@ЍMb@B40@-0@@T ?P  0 v% + +@-@0@v%0$R/ $垼 +p@-x0x0S7d41P@-*'$! k+h $ 1A-@TPP 뽭3;21-i 0@  `Pp{0S0S 0X 0?00a ,0 ,00SA薧ꌶ+h +l+@l+ l+h+G-pl0P`  @ oP 0S 0S S萶+A-` pP啧@y,0Up0P j,p@-HP@T 80   p 0 p)n)l)@v%+O-,RAMM-`\)V 0A 0嫤p0 P c0S0000AލЍ0!S  PA>04S S S ˦0S  0 [Q0幦0S 0  C  Q? 0   ^R000 Q\ S$R 0C 0N0P0000\\   0C R 0 C@v%+O-pQpPpMW My@xcPJTpd3dC  \\Ls DPZ PUA (3T Vۍ ЍpPS@DT2P@  @@ 0 X (| *U@ (T@"0S000̣P ;04P ST@  6 Pp 0Q 1T UP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P? T0p0000,ꐶ+@v%%+h%! !0@-@ᦥP埥P |嚥P l啥P \吥P .P.@v%!!!!}@-@P @P P P(@R!!"O-|1M0S" @`0 ЍObPp400 0 Ppxy@`00S 000S  0P Ѝ D0 000 { ;' 9' 0S @`ꐶ++"++0@- LLPR^0S @T 0 Bꐶ+@v%0@- LLPR^0S @T 0L Bꐶ+@v%0/ᐶ+0/ᐶ+00S /ᐶ+@-bNP .P-Pf@-0蜶+//@-L@ p0 P㌤S0PЍ蜶+\ QR0* /QS QQ*/0000/@-@P &000000/0S0C 0//@- 0#3P Ѝ@- 0@SPR? P KO`Q  忡L&` PЍpA-`pP@T@  A-P`"F$@p FQP ,0 0(000dPЍFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0P00`a0C@S@ $ $ 0 $ ` $ $ $ $ $ $ $ h  $ $ p $ x $  $ 8  PЍp  000@@0 0 0 0 0 0\/\\A-1!0 Sg \[Pa@1!0 Hg[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CQV 0p@]^S @p^404 0 4fp\00++'"oX""p@-0Pt @R RP D D <t@D@ p@ @h%++"C-1`pMQp@P0᠁ `0Y 0 0PR l1@d1`0 Lf\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . C R 8" [T \[R@]S  000TT[T@  \T  \R(0 R Ѝ+++"0+00@-00M/SP M $S+ +S00+ 0 0 9S#\S @P0 0 f0IS@P R00ۍ Ѝ00@00 S00p@++ #"O-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S 0QU t0t Pp0 `eb`0V 媡P0 0#P꠶+h+++/#O-`M@@_.0 0\0.> 0le S \|.t>0 x]e Q      , d  l d x 0S 00@0000 0S 00@`0`S 0S @p#S ;S 0 p00@\ pP  P 0S| @,Sv p0S 00@P 0S  00@[VXS@ / / / / / / 3 / / @4 p4 / / / / / <8 / 8 / / / / / / / / / / / / / / / / 2 = 83 4 / / (4 \4 4 / / 4 / 7 / l8 @9 9 9 = / / = $> > / = SS4 0 PS0@o0P0  Q Q* S  H S 0Q sh0 R 0R0 0R0S0H0[0S 4 0 j0 P^S0@oPL0 R: L `0pH00)0800400S<;8 00 [04 0(<0S H0SSP80S4PU 0`  E☊P0800A E4 0T P 0  004 0 0  0:A00z040 0H:HR <00s, 0P 0S 00S 0( #P2S 0 H⢚` 0S0`V: $S P00@ t9@՚0S Кw 0H \ H0$P x0 0H$0n$0 S8`0V:$ `000 00C 00pP0 `8 0R:P`8 0S `S p 7 P0   R: ` 7B7` ]'1 01S:` 007 |I0 S0`(78 00 tg04 0<0S _P0800 OP80Sf04 0<0S  80S0p4  Hb`P <000F400<0`04 ɇ<0S kV 0400<058 00 V04 0屇<0S S`L0 R: L ! `0pP00pY R  Q $5 0Z4000  ~P 04`Z Z 0Z 000 G 00 00 Vt4Z  0Q\ 04 0 t  PQ8 p0V `XDcH0p0<Hp<(0000S s04 0<0S p PB"000Q0 0  0p V0`0  `0P  ~ P\   p V0S` 0  PX80S0s "p0 6Z04 0_40P0 |WP 0S 00Pn80S0sp!pgp 4 0:40P 3Po P R00`pL<0p<R80SO4XL  0`Rl0&004 0V@*000++L+++ԣl+%w% ht@+ )))+)4+ %+++60pW(p0 1(W0 P0H !  R 0LsP 0 pW* 0$ (1 0X`pH0`0h<Hh`<x0h041 8<0 0R0((vQ 0{Q  ꠸+l+p@-@P`Tp0wS {S sS 0p P 0 D6Y0`@p P `G-`6PPU00Yp01@ R  p!PVCG-Xpp0!S < CQR2B B B @C B 0  X0 0 00 00 00:S 0S0S W00 000 0V 0S`: P 000BS ᓷa+))p@-P0@T P ᔔP1 0S-D 0D C D hD D LD 0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@+:, 0@-MMP@P  PYX p4QX+  PۍЍ0)H0  BR R Re /ḻ%h%@00CS0 S0 / K긻%@-,AK0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@c+1@-01\ @T P#OoB\@T P P P QQ R P\ \ P P Q R  P,+0@-  `Ğ\ @ T\    %R    +P,A-pA0 5S$\! R  (P 8!0  ,P !0  4PP6 Aq<0S 00 <ˣP`p夀0U00S 000\P ᕭP D 屣000 嫣PSP,+ E h%+p@-@0` DT  tɄd lP`PT p *P000ST @긻%h%)+*s@-@P pPg<@P @0?SP@P` p Ѝp/җP@iLP 0S S ;@=0S900VT*@*#*@-4 \*h%@-0@<TQ T00 0001S R0Slp@.TX` T@0$ @H4T(8  @,+**h%P,*****@-N4 +h%7@-@Pؔ  e0S 0@T ʔ00 Ѝ0Ĕ0"S p`@-@J P  p UЍ+<0p@-XPP%0ATp0 "R   DS " @DxApw% 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,0P01p:,-,01//00/00/00/00/00/ 0  /8,' 0  /8,00/l00/B,00/K,00/.00/T,00/c,@-@d%,00/@-@5, 0  /d4,l 0  /d4,B, 0  /d4,K,/00/00/00/f,00/n,00/v,00/,00/,00/,00/,00/,00/,00/,00/,00/,00/V00/}00/00/00/00/,sO/g b @-0  0Ѝ@-@ +@-  ;,r 5@-0S04c  +@-  ;,k @- 08,5, @-+,( 5@-0S04c5,  @-, @- 0a(,d%, M@-c$, @-  b', ( 5@-0S04cyd%, < @-  pD4,< @-  gA", < C@-^d#,< @-  VC ,  @-  MC ,  q@-Dl4, e@-<-, e@-4-, e@-,-, @-  $D,  @-  4,  @-  B!, @- 01,., @-  D4, @-  A",  C@-d#, @-  0, $0Qa @-., @-@D?P d 0   0@-0 |1g:, p@-P ^Nl1 0 z  Q 7Ez!됷Pg[PPt7000HDu! "1 "0Se SP 1S b !ġ1S 0C" !8C8R11$PUP8Lfsps0 yP (vye(`P 0PSY *SG 50m0 +m 墇넥[ Pʀ500xPG qPD >P' dP% <P  SuP 5P 0CP  @@PV 400C`F V$P P P0S t400C``l1SS !0C B/!?1F^xP00 S11W?zP`PxP@a@1S4020/C(PZ( @@P} H 0@S꼁 |  |  | } | } | | | | | H | | | | P3P$0CP?P* <P >P P10!1 NSPNQ0^ B 88C8 P P?@ "0C S񟗉} }  T  } PZvPq P1agF P x}1S'ʰ1 XF P x}P 00P1 RE40S 3/Pi PP i P,ЍPR0h _ 0Sp0W 0[ 3/pU P `F P x h `E}h00x00A<0 b02P 00P000c%}h+:-h%.1.,RSh%,s.d% 001/+P0 R0//+O-p`*@PP [ ! 0P @ Ѝ0孆00 1\$<0/P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @+.P/D0 R/0@-A1 P :h@< c+O-Bp0  W j0p 000嫅 Ѝ`440S 0S qP Z000 @  S" S0 050S {qP Z Z 0 0 0! R @ S0 0 \qP Z0S ~Z00000 00` S P0PS PH0SPP9q0 00Dq0S ?qt ?C S TZPU  m0X!0C0S;3PP0 PEAZ+h% @VUUUO-$MHZS  R0P 0L`Dp4B :0Y0 0S 0g |+jᧀPppp@`0p@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C 0DS0  0mjpX 2 /j0  B处 X P0{ P>  PN P P!VUA`E Di@DP`4i i i@`"PD P AP;  JR !   ` D0i0@0!P`1 V0p00@  ``]|`F`FV0p00@  DPEi@DU`E¨` Y @ [{@T`— R    B1Y00000S 000 0 09{$ЍOl0Y S +G/~h%h%A-pP`Pp `o@o@0T `P@ P CP0000+@-P@p 0 0T0* M p@Ѝp0 00z 0l` 0@ iI @t 0ҁP ⹤ ꄎ%+/h0p@-P@XP0Ps H` R :ࢤP 0S@@Q@pu%+@-@C0000+0dm+0xm+-@-@00t  Ѝ@ Ѝ/-@-00 e Ѝ Ѝ/-@-  } ЍЍ/@-@@@-@@-pP@`M,0 0(4 0 00`Ѝ@- ЍO- M P`@p o@oUkT0 0`P 0D0PSZ 0SW L00SSD~PPL00PTP^y@DO@W :p [qPRWpV`KЦo`0 S`K0 s@PD@0 4>PT0 0P00L0D 0H0T CBZ  t esy eeЍ00D R00S 0S B~L0X#3p3z8tP 0 t똰HHff  B\0 EGs`P`HoH`ff+/,@-,, ($ *Ѝ@-P@`$0 0 C 0 00`Ѝp@- Ѝ@-pP@`M,0 0x(& 0 00`Ѝ@- Ѝ-@-00a  2Ѝ Ѝ/p@-Pm@mp+@-o7@- V@tF IB}$a[PU {% q<00h@PU k%T q<00000S$$í Ѝ0<,4!-,3@+h%JO-DAM@PP4q@ &@ t ᐛ@pPࠟ   mPE<Aߍ`V 2} ^]`PX Y  h =R@`@01y `xh% a1@-p0O-MM 0p@x`P2  }PP* P ]P 0S0 0t    HPPCP 0 Q0 0PNvۍЍ0P 0 !0  0! f,00S/ 0P $H@-p-,,3,@-TsP F P <B EA^(Z"Pq@4A-@M @]0S0{Q%P,  Pq0S#|P  X0Sl Y0] )PeoB@PaD'D*hB^&(ЍP@R @빀P( P'20S gAP'.Ap 0$!P?돀 X  $P 0)AT JPP AP p`ePP 0q+Q Sp 06&V`T(p`AT-@p0T-:W@vQ  R@4Q p0Q  R@SAPV`003/P 00  h0S  R l 10!84@/AP-,:,+,@-MM+@(v+(iB+(vB+i(u@PލЍBl@P 0 T @@@@@ @@@@.$'B(I?ꕥ<{-MM+ v+L i+ v+0i :@P  +?ۍЍ䕥0@-@M 1@@"#P @! P A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*AP3>P/[P+W@P'AP# 0P >   0S 0_ Z(P @P4o0m'&)z*00-,:,b,,@-@M 0@@N?u#P* <@}  P 00*!R00$Q 0*@P  q0S 0` 'P%(3*Ѝ-,:,O-`M  0 0X#*0S ` 0 SS 0Izp0 S00C `@:z0 S:|PP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 th%7@-@ 5PU b! mx800 Ѝ0llP X J!L  m~*( 0$[(-,3F¥ͥQp@-P @<00S   0 p@8 0@-,<,7@-@ PU ! Aym$800 Ѝ0KPP | +cmd00S -~L 0H[$~0 ,<,!y,,)h%s@-8Q`@<l\ZU} ~bfxBbft sbfp8f4b!99}h 0 A3n@Pxx|(8P QCCuaxa H|Ѝp,bNh%<O-}MpP`4o 0!p ԕE 0S  P R  0S  `\P lLP l`p@T Pd  U0B? 0J.P "A&7@P "8700l|zP\wzP; P  8; `;0S \;%P X; @00h|3"0}ߍ3yZ3 4|0"!03140`0  400 ,T40    T(0mP,00P>"!!0 # c PL I YP U $ twP2P tt=|0S T.PU |O8 P0 T0  SR CA1P k 1 W0I2g>0YC0P0SP @ 0V0 R0SQ {k0S8 /P `Q{u  PS 2-,\%ptbtf@<,-,B!,hv,3,4ӦÐ00@-,M 0000P00 000 0 00\PPP@P DD@0Q ,,Ѝ0@%4 `%h%<, -O-piMs?!0WP 00iߍOЍ/lx@PX1P L!L00'@P jZ` PPW0FSV030#Z0S 00W"r5!` ,P Pp0W0\5U80P , 00kL(PI(<,h --O-p0MT@X   p$p# `V X @M'U` hPPvP@P <H E0PU 0'SP0U*S/ }P q [ u0@ 0 0H0 uP11Z fo0!p`PUQU ( 2S022SP0220C2   S`` hy$00 00( 0p|W  @0   (PU ee(c0U : 9_W 0X0C?o20S ^c$^cfy@0Uk^^y00CS00004U0U \$0S  r;9Vviyi 0%S @SJ B* B*zD0 0p/00L 0.RP 0 0wPH00Zp@P 0A0 0X-3 4Q87iVy00X ('SGe@⍃0U e|yz  0UX ~ce^ciyhU PPW  WK0ЍO Ѝ/@\hqBht@,%ԣt0@-CMlcPP 0S .Qg@P 4%pCߍ0 Pp D+C+G-p@ 堀堐PB`AT:00Z W ,/Z 000 SgP EQ 0 @{h%A-`Pp p@ Jy ,po P;@B+A-PSt@Ptopl o0S DQ0Q.SNP @$ $b bD+C+@-M 00PDP = o 0PDP / o )p@ ( x qo HPUx@*  `o```p @A*PPЍ Bb >b`!iB+%i`+B+8i(t+|1O-8MXd0 @nT400`s0 ,uP40,   -8 4d0 w=C$ CTrP, 0.̟ Q(<P 00 ( 0 0uPPPPP<@<,`0tD0D,Dq,z `< J /  0p>0a Xvjn  XuPP\  RuPP;U 1sS 1lS;"000 VP p@ v w! HwhH Qp0TKT[T{1D+0~, (uP #uP uP uP uP uP  uP0:4: @p A*0p 0HAump H0St:t*10ll WOP 0H0 H0A]mp 0 AP<PH , $U f bVPPP@;tP@- ,m)0xa)0w\tP\8 0\8UXLy0 yJT. 0)0zC ;t@PEPS,PN X0 -\6SE p0 A=@P: d5 %"|t h[7S'  PH @007@ P 0(AAP\XP@Ps:4S 0 zP 0'APPxyP 6P'`0b@Pal\80<'8\8P,W 8l81 SdP0&08P 8l8 AdP0060&S\880\8P 8 l80S d&8P 8l8 dP000S\80\8P0S\80\8P@sT %0}N\8%0|F5T$A Q0:$R$ Q9ğP \8şWt^ H4   >V4SP  0@?S @P Wl4{ 0Q0:$R##\ğR#$R#W%HR($ 3 ( Ts0S1 `P 2@T YUH`H#00S "0S <#|d/3S3 TE 8"DC?00N?C0C ,>$P0  0@F0@Ph6XP$A?Up@Px080Ca@,0,P pR0S ,Mp  X >0S@0 <X+4AS< ". 0 0S D+pD W5S !,o0 0S $ pk XbdXzD+<,h%է h%%< u@+43,i~+?v:C3VBp B+-0յC+B+}+5+y!NvzwǨըبݨȩJe"թ+T:,ܪ^+`+@{T+B{F/Li+ج'B` P 01/p C-鿏P@,MprP3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ߍz@-p`CM|@qPlP#d0RXPP @ W<0080 `0(PCߍ@#,D4, 5,@-@ @.,@-0  0 P @0@ f28 0/P $  .Ѝ@4, B!,,,)0@-0@XMP0  0@ P x x0 t0Ep@;2P0/Q   LL /2 0/R@, ,@Ѝ0D+ @4,.,B!,@3,)*,-MMRPqP  j j0 00SލЍ\0\ \TP L0 (0< 0, d#,յ@3,A",*,D,4,h4,@-RCMX6S AP \8lP XT20S HO2\6S 8J2020"(2`Pr\8. x^10 eb:4S ![X\@10 O:4!SO *00 0 BDpAttJ2@P) v1d 7T4L1<.0S ,!,'$!$#0S   ,oP\6S  V ,2bCߍ 0 BD+:,!B+F@+ U~++بT+yDOwzC+iB+Y1+Ȯܮ5@-@T^ S C @TR00S\0\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-p@PhM 0S'hЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/ 0\ P0//!01000/ 00#0//O-ap$MPA@T m `oP00 ` 0S 0S0S$ЍP P00 S LoS, R ,0S R : 8 80R:P#3///@-@MP Mp! *0 `p Wd5\\ SS=S 8 d3R 0 ,c0 ^ڍ ЍTT@-`QM p@ ○P PP 'PЍnPTP0 p1P@$U@@ T @ @U0 @3P꺯ȯYO-Pp 0@0M'"pPP `ĐĠ0 R PЍ 0L03/P 0 k놁0 k  @ $0S P @oZ @kZ`-,ԯp@-P`o0@0S 0p@+@-0MQ!p0`L0 3/P< 0t@T 4/@0p0 k 0k 0@$0S @$Z$0 @ZT `@Z @Z@k0S0C@ ,;$@ f+Ѝ-,BG0S/p@-P@H 0000p@O-p@P|M Y0P,0+`&,$P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U00 0P1 00 0<00000PpP ,0<<0@D&@0S P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0|  @-Y P 0P 0Pp PQ` QTPQH "P <080P/,/(// F(Lp@-8@Q0@P@DPp ~.Pp記%p@-P@P  f X00ppy@-  輘%@- y Ș%G-@PMP N/[o e0 0 0S1 0S XP a5-P ލo0S o0S1S P lP @l0 1h0$1d0(1`0,1% 1S nP >4%0`>[@`pԠ( opm$  t u$0umY 4 P 3SG ^ht n n00? 0Ԁp䐍0FP 0S0)#0C?o27 #3RR  0R6p7P 'SH0pA(\ C~ QJ NhP XP H/P ,0! 4@ <#2pi2P  @000@0"0N?P0'SpH0AR 0 B Q  > 00B,0! 4@吀<#0!pJ n nKR n00K?(0811~$10 100 d@0Eo`YG_FPEjP 0000!X9PP 00S 3/pO003/No-P4yjP (S("+"_V b+bWV`gP@``VB!aV>+"GV+bBV3\QQ0QUh $P 00S 3/p $QUY ` p0 `` pxb.;8/ 0 ``px`;".6/0S3 7  V c0 0mo`PxqxxU" b ,`P  PbdP"+"Ub + "`P iP# iP iP iP iP iP VxT U  U` (oP 03,:,(8[{PiD<00A-p$0p@` PAP0 @ p> C 01/@P00pЍpP@00003/003/$AmAO-PUMM.`h(@4Pk.zkQ_ x`HYk#W`V`$Z^  UݍЍT  n? 0.07 00P00@P#Ppύz`40,Z^4S =,7h400C27\4=1 V =V?h400C26\4=1 0 000000000 00pp`d ( B0440\40s -1yv0 00 00000 0zcp` 0440:40s -1ଔV4 `v00/ nlE "a\5@[^ =2,XL=1pP0Nόfph \  lv00$?00,Z000Ӧ?%N?@/&"`H`T( Z4@0S N?/$"@44pW(4 0}10  A =a "8a 4a4!0p  1$,01(L!!,H48> C6$ 1^(1)04 $,10 (q,1 48qHL$!R  p} \ z^x #@p#0"$1H00 4;$ x2P p> C  T$100$10H00: 0 0G80 ,! ]6$H(@GS  GPn<PK <ISG 0$10! A04!8C0(1}1S0}1$1S `4@@-,,%< ZИ%:,03,`#,-,<,_PP$030/0@o//BO-@P MMA E0*!Rp0)Q`U0 $0   P y Pp ,Y* (0$0 |$(pP d4\,N ܍Ѝp 84|U0Spp0 @0 4p0SW00_ , R\  000x;8,9/PI 0  x8;,;/ 0 x8;,9/T08SS0CS񟗕 D Sn "Se S P0~  R{ <pWv  &P d0S P"8,H8 8Rd0S $"8\0S  "8`0S ! 8X0S! S! 80ւL0@ \Q\0S ` R !8x8 lQlh⻂`Q`\ⵂTQTP⯂HQHX @1R<0Q0}5P00P0)0YP0 U @ ' 'pPv 0Q  c:,2f<s U[jqxe/ ΁ $'ñϱױ"۰ð)-,O-UM0M*a8V"e&k'@& tetX pW &0 X0IT 'Q 0rލЍ ; )qWd ^P FP' P % @P @p`H唴 XBT0SYh ` X 0S 4$@ 0P0000P F]P14s10#5:$ R&P&N&0S I&G& ! W eP04JZ@DPG@ pm `>V  L `p80  P 0 0 ,0ST0 S00 P0p800SS0 4 0  0x; 8:/P00400ST0(ll S S l ` < < < < < X  $ Sc  SV 0 <0dP<0PL!@  PP ,0$  40x( P3 ~ ,1PP pdP 0005S0+4^c] 14  t0 S r0 io%а 0İ 0:,1F<,6Ojϲ-,γ rCIOX_ب%"7!)s$Glϱ'O-@AMT MXp P`L @P`T $P```PP@Aލ Ѝԃ̓C̳ @3 (4@$80DP@<@T@X RP \J430$3 00 =2 $02(408@Y *P "z딢娂  t20l8@d2@DDAT P2P"PP$P <2 8&PI,2 $ *20)ATp !0# UP'!U%0 Z@0S #P 0St H0@4 000@0x;8 8/P6  %P !%@P 0  v @%$0 3@?pW:84p@( hϱ(w oǴ m۶۴< ,1:,sb0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  PB++ $0@-@"!P(@+@-$@2S 02+O- v@P@Bi`P@   iPP@  `@p0Ec#రPU* ЍI +@P  %@P @BI    R0S 5ph%(@-@00 ]P Q P 0PЍ C-PJMM pbd 8d@4PTbH*PhP8b Yo`GFWI  bP 0 000!00P < 8<1P <08 <@XNo<0S0 0< 8`PX 40,0"1@ 0101@00 0A00000@ @@v,S@0S8 0S(8JݍЍATP0 8`$!QQ@0RT<0P 0 003/@<08 S0 S(0S 0S8(0S003/@<08 S@03,0 X% 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> ^o5 0@o/b0 !!/+10/`p@-@4P0 `Y1111p+O-P@p`ԐԠ԰0/ C !  !0  P6c00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ+,&    0@-P@M/.c1, 00 0d0@00 0T0@@@@1 0 000@P,iߍ0 +O-P`@p4M 0Sp_P pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+   Q 0S  +Y0 0P  P  $04@H0080pS,000TT0 0X0$0\0(0`0,0d0A- 0R 0  DQHa@1QRpB   !LAPAP'0 \A70Q     TTAU @@+T*eO-`BpX1MSL2X\1S,2\X1S \QUЍ0C`1`1SX`:]1PS \1 XX1! 0`1V$ 1x C H0C 04]P 0 S 0.S  X8p `Z!XP V0X`0 0NX"a\P \!a000: SX1x 2 \1` 0+ 0 X1 ` SX10 2 $ e(K+% +L . X p@-MMPSPoۍЍpP@`+X P*+pJ P*+J P*P6٬P-Kjˌp@-&Mvr@m(<L`P8 k<0 0m[\ P (&>8(*> j` <@P ލpbNanb,,H H @-X@01SP@0S01S0  +  O-@MNP! c0   0p`嬢Y pP 0 09P0SߍP W%]P0>^P0 a0CS0S p `Vp08Sڠ0S' R$ S\0  0 a00 xp 0h1U0ſ0 0s0Z+ 8p v`p ;0P![h!R( 00@P(O  00O0 0S* ?0!C R 0d 0_0t00 00S 0xVa0 4Lꦵs d@edA++jC-L1 @1 R0   A h9&Q   R 0<1LPDTPapH[LP [U `1DP1 [U `1TP1 [UP1 `1ZUp!00, p,@ ЍC- K P +q e@-M@ P @oЍ@-| 0S lP \0 T0T 0PP0L004 80<( Ѝ Ѝ-,h4,d#,)@3,A",*,@-p@Mp9t)0 0 0T00.00 0p $0t !Ѝ+ p@-L6@0P ?'p@bN*<ܵ-?@-P @ _y R , 0$@"Ѝ0@ Ѝ/@-0  0H P L0L L@ 0< <@x0 $@qЍ@4,0 B!,)@3,*,-3M M T6>P0  4\P \o3ݍ Ѝ(B-3M M >P3ݍ Ѝ00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PD@00( (0P,-,l4,1h4,C ,d#,R@3,A",*,@-0  0 P <08 0440000 0 Ѝd#,T@3,C ,A",*,0$ 0!S/ /+0$ 0 S/ /+ 0( 0S0 10 1/++11<0@ Q !@-0 " !/+0 10 1/+@-Mm/.D^, 0l0d 060 P000@ 0b@,>ߍ茚% +0D D /Q/QQ Q/+%@-@0@ 0 0 TPЍ[@- @0S00h4,o0@-pAMhPN @pT  P<04Px9 /K0Aߍ0膶+;,@-P@ ?0P  8Ѝ-,-@-   Ѝ Ѝ/-@-\0X0@P &D  Ѝ@Ѝ/yب-@-\0X0@P D  Ѝ@Ѝ/yǶضب@-4P P P(2@-@sXP@ 8oF @-4@ZP 0 P zd#,A",+,@-4@ZP 0 P z@3,*,,,QA-@@1@#PP1P#T|p|` nbP (B(A d""@@99X\AU\,,,7@-@q*P @9] 0' Ѝ0Uh%<0@-EMP@ _S JP0000U ($$0x:@Eߍ0;,]{+J{@-xM\pA =SWP1^ P0x 4!  *hX<U!0 01P00 0H0 0 00 00 000PP`P;!IXߍpb02+!9Xx:X JP  (R((Jj|+;,/  %@-@P !0`RxzYP PP xZP`h 1  T E*01G@0PN@T 8z[ Ѝ+t%@-@< 0@- 0 Ѝ0@- 0 Ѝ@-0@M00 0000 0Ѝp@-P<@0/SpQ bYPp@ꌚ%@- 0PD4,@#,O-$M@lp`P 0 P( 0 PP0P00P p @0qPP0PySa00ͅ0݅ 000͕0ͅ$ЍϷ.8,-,ҷh4,B!,rO-,M@V$PTIapYPi $GIp`V30S` lVppGWT X1X!XX:$ 0 `   $ 0VRR  S  R KV 0B0EPB$I0! 0$000 0  $0 VSS00P0#02S `F :V ApV @p$ H`,Ѝ  2A-`pPv@P!V hPP 6/AG- M$HAP`pP Ѝ0 0 @`m0 VSSXP$ H-@- 00Ѝ Ѝ/d -@- 00Ѝ Ѝ/ጐ A-p`PMMP\' pPp@u@ FV ,(($$cp#&  0Su 0CS2PJ{S0)  0p 0S8 0S r0S 0S QN@|tP$ 0 \R0 L@nD2P} 00b0C?o270 墏0<(G70SލЍ!7SWP1Q! F?p@Foh!H1P>0  0M('  0S q0Sv 0Sr 0So QN@P  00 @PYF? Q. QRFcHneqt;,oø-,l4,)+%mbNθ4,D,!-MM P  P  jۍЍ/-MM P  P  UۍЍ<s@-aP' P]P K%Px0S : l: t: |: Pu @D`CP "Hv@TT%ЍpTx0|+R/ @-d|+\0XT0PL0HD0@<08|40+o;,w?,;,8?,;,'@,P@-@ -@0`X,,p@-@M L(@H@X0 #,0H ,0@@018h0Pp0: S H`VP hO dO܍p,X 8XQ @P@PڨaO <PT81!姢|8 <sDQi T1 08808PP oQ AP00S ny < R t00 00000 00l0p@ m(yt(0Q!d#,@3,A",*,(+  '2 -,h4,8+< O- 0CMSP0q `@j0!`/0`SPW!000 @ @3/@P CߍW! 000Z 0SX 0 @T W  00 0  0S l00S \  P0W0 ! !  000@4,B!,;,Ĺ(3,+7@-PQ@0 SS 8`0 000] Ѝ02S  !O-0UMp(0 4Q  W#ß0/SCP3c0ԃC0P/UE_# 0SPFFWC1 hGd  PPP$ 0RP iP +a^ 0 10S 0S7 0 1S30S kP`F %p2p\F3wVT 00a 40 0 0R RP 10 1000`yRP 1R QA  1S Q00R /RSR UߍP 1 0000$0000 P1 PKP 1 6T1 ,P -,&;,%+N$CM,,@4,:Ag׺Tp@-Ph`@TU_pUP`gP  Vp0%O-`MMp\` `P ypPP0P  7-@ڍЍ ^pP VpP #P wPP #P@tl@PI7 @ < ho0Q {SP0=S`  7 9PV PP  Phx@  D$P@Ꞷ3F20p@-4 P@U0 Pp@@-G-`P4 U@T$ `V! p0F&04 p0RSP pPp Pp40Su p PPp@T/0 R/@-`p0LMS@`aP 0S0L0 3/P (0 ! "!P 3/P 0S00LЍ 0  1/p@-@ P+UP  p@D@-@ (@A-P@p`p0S 0pp RA05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-8pЍP<@:` Up FGGp => 78 08`0V@ $t@ lRP\P LP ~@T _n}}D޻лp@-PMM`; p  @p TP]TPۍЍpUA-@P OTpP` P  0Q&P|d zd@@-PM Mp;P ` p  @0P,RPUcTPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPO00/00/40@-\80S0 S0010\80S  0\\@!SR0(SS QU S!0$0S\  0 1Sp@- l@$\ 0P!QS:pQQ   P \ Q0\" 0 ,04S008 0803/P,000403/,, H0 , 4 T 8 X  40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4  B(B(Rt01 408 00803/P,000403/,, H0 , 4 T 8 X  000/O-0@p 4MPPp`314ЍO%0 L03/P% Ѐ0 \ p* D@ Z["H* 0*P T P , [p M8``pp 0S0P 004Ѝ043,O-P@4`崁崑崡 Q 1SQ " 010 r 2 R  R V V $R RR 0S 1R",0S 0S0 0 0S 0`0 K3/P p  0!"0 0  `0RPH P00P0 < Q Q  Q R Pb g ( O c P O O-0c(0M<00PSp@p`00 $ 80s!3r 0Mh0@l0 S@3` 0X@  H3R0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0D002 p0 0LHL048  L0(0,(, 00 0LP23V 4x0p0P<0SQP0 N T00SJ0Sjd000q p0 0 Z0 000000  \0 O0 00000PX 00808/L0 PpQXQ Q(00,0p 04 80: [`\p a X0S l^ 0$0p0 0(00,0  04 800p 80h+-,l+C-F`0pSPlM^x?L0S 7L0 S</L0S$(L0Sk!L0SGL0SHL0SI L0SJL0SK0SaK0SLK0S000$ R(000 "0A W(40S  0$S $SS $S)400 0$4 0K0E( cK0SP4 PQQ008Q00S (4Q (4 $lЍC\ W3W0] @^ ^ ] 48P Q Q20 L3003 0JK0 3 lЍX300P3 0:K0 0HS(0p`@ 0  SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@0 8"M, P0   R>0  H0L0  H0L0  H0L0  H0L0  H0L0 h H0L0  P H0L0@ 8 H0L0U lЍC !SH000050PpG0  d 9/ 000(0P0h+Pb ( g +,-,#,O O P r :r d @CJQZamu}c C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``J0 0pp07/@-M0@ 03/P 0 004000 +003/ލ@-`,MHP E@0 0 0PP@00 RS THP pW nLP00P00P0,Ѝ @T@0/W/0  0SEH P00P0h%}0@-$M@D0X   0P 00 00,0PH0Dd$Ѝ0@G-%p(M)@PW \\a `TW`HSP0< ,`SS0 Q "S `P  P !X$U0+$U ` 0 O0 00% 00 0 0000M0PPZ(Ѝ@Q  d P C-40PS,M80S,ЍS S S !S S @P `p䐟`A`X 0 e000 00t 000 0 00 0 0M`PcL R Te hR O-P@0p (AMP U  ! `<#w0!(p<#lUP <lP 0D00 P bP 70Z0P0UX@!O 0 0 p `@ABBA0  0!C8 @0  X!-. P0  0!D$` !puHP@!@3Q@nHT -`HMT@D@`0@@< 0 0K-:M0 0@`0P .㨠嬰l 00@p `wHAߍ!0P0RPN+,jh+ʽbNO-t5AM0DpP$_PQ 7@04`PF X, @0D ,`0S40  ,0 ñXT,  0$ p0pC 0$<0@0 0R80D <0 80 0S d42@@00,4 0$4@00 0A000 00@@@&b0S8H&P 0P40 0H03/0S,0@ p p0C @@0D @000`pH0SOUP p1x'x0(1F@P ! B B2@"A$,0 1 ,0R B1"AL, =L  P8p@p 0 Rp#p0x1Gx10q000AߍD0` ⇁0L03/ 00`0:x  Q * Bq Bq BQ B` B  0~K 0@ X@@p0 0,(0 @@@@@ p@@0`PxUߍ pv'0 pD`∀O Z00*8b0A-0<0@SH04 `pP"HV09H?V090VP:0A!r0S/A-@P0\03/0 0    `0V R!  B B" /10C+Rp 0!"P! 0 `PPp !@` B"/00080000$0 01P0100A;H{ qO-P@OM H(Ja1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,(pP5Oߍş[@P XşT0@0C0p0NC2 VH0 0$ 0 Rд V 80L0TX 3/P1 0 00H03/0 T00!!  003/P#%#& 00t80x 3/0lPp GE̍X 0 030x300 07000F00, +@ t01 SH0 V p .4t4` PP00P00X00 3/088q0X 0L03/%$& l00,0t0T0x0X0h0H0 0T`X 006/P `0d Q 10  0!s"D  V p0 BN.D!2 B"D.1ᴡ0C100C0 D `V`s`V T00 03/P0 0D 2#4`0Z5 IP0a 0` 0d0  p D00C.D!2 B"-10C10 0?o2100C0. !V 43,x Ȱ Pb 8 [ T A-Pp`@a!0P  p0Q p-p I`P !@ B"- HT0 01`0(`10q0000\t 0S/ LP0 05/0P0 8p<  @  L 0P4 P p $ Q:  BS:Aߍ L`0 (06/P(0f 8< b @_0`4 V  V  R U  U  RE ,A0  ( iC( P0 bCp $, ( ( ,0P 0 pP`p0  HC 0P@ACp`LPP\ p `P@0` O-0@AM-,+,1O-@`4M0P\03/0 X ĀX p ppP(W 0 Y2 2 Z "00 " 0  C" 1 " X "0  !" " 0 " 0 "  C" 0CCW 2"ґ0E0 0l20d2 0\2\ 0J00000P<1,pp@12((4Ѝ嗓)08q P ,08EP,0ZH D00d0` 0P P`%0,00埽0P8 @ 0S[00S[ ZP tP00S`(+0,(00V,00 0 0i3/`t L+qH{ 8c k uS Dx lV h rl+@-@P0DP/IP0S0O-pMCO TUtd4{ 00 rs= 8b0  * 0~ P  0@0 B )R RC"PQ0R r Q0CFS0TR000US00Ѝ@0  ||&"PT00U00X@0 \%D1R4 !8R0 !R, R-RH T00U0(A@ P!P 0R 0R [X T00U00} [XxT00U 000/SS<ꐱ +++T8 T,t+ 8T+O-0MS@pأЍ`  |W0 @00PS8 cSG MS  0 mS  sS. gSR  0)A 0S cS !MS @MSCS GS +0C?oW20S 000 00SSSR mS @ R O-OM M<00(00 P08 @0 (0PP0@D00P,0 P 0H03/800<0 00!6 0R 0  0,3/ 0P`` S04 D&408&XU\a`0$04000000$0%vp`0,`LpH0WX0h05R0lp0fh ( `pV S]h `U TUh PUOh VU 00 0$PT_<:씟750P`080dPS<00O>0=C0H0 08<K@$xU 0S  T0P{_0 000H0P0 F0]PT0S xBP 0S40Q00`Q0S 0L0 aA3/P 0P P  2/``dF  X!ZpBP0??UP(0 Z [ Q PD @0    SD0 R8X' a`0"$06$000,000$0%$0t H 0?x 0 \ܪ0  0? 0(Ϫ 0?Ȑ 0 Ū0l010h Lt0hp1+H.+ . _ Z`*pV 0 T^U 00 0\T^0 4T^T0P0($00 Q030#Q0S $0A,0"PHdp 0 &(PA00`P3/ A0``PQ1VP(0 [ J Z C8 p0 >pW U Tp 0>Y00,@8000P<00,0W04%000008p<  0` S04 $i40$LL0d00h04O0l0hd * pW P_d !pQYd WJ 0 \P] JpFD40 0 X0,0\p0p00@0800<0#0pW- 0S*  P0T]0 0@0pT0 F0ppTP0P p@PP,0ЍTL0 8Pi]P0T0 0S! 0S40Q00`Q0S 0L0 aA3/Pq  0开0S S 0%@PccpJ 0U%@PY003/%B[0 00  $ pPY([b$ ( R [$0W(0$ 0R( 0WP$0 S(0 00,0 $00S,0 (0000z00p3/ 0pXI1%WQXcrp50 S00 ᚳ+Dzp  =pW0Ipÿ  D0y= W0WR 0$Q(9$ (0-,w+,"0@-@M0@L0 3/P" ! !AQ 0 0 SS@Ѝp@-`MMMP;` @P 1B 8 $MލЍp{dЀ@-@P H?P 8?P (?op@-0@ 8M! 0`P@@ 0 =P8Ѝp}?PUJ0 00  0 $P@oA-T1MMPM C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a:,H$0pQ@-sqa #"T R0//s@-(@T@ЍpH0P0 w{003/@PE5/@-tM`P @P0 p@@#P  30@Tp@tЍT0 @T|0t dl0l p6 M`P L @@4,,̿,ٿ/@-P @ ///@-0@Q sϺ@o?0 \ 0P000@-P4M0 >X0@T w; 0    @ 0&4Ѝ0i;@0,//G-pP@`ㄐVT0S0S ;P$1H0PUF;0 X ?;0 `p@ꤿ,0SR00/p@-@P,9<0P4`" 6D0# A@$!p-,+,A-<`P@;Pp( 4 A,@--@-p@-@M @>0 hK0S Y`L0LP0 V 44 0 ܍pcK,d4,?]1G-1`PM@1P1!!  xxaxaut"@Pl7TnP>嶿P0 [㴹ߍ BWB?8 +;pP0=SB8?q@ B?`@P ; B؊Pt@t P 0 T,D ,:9rvj<,x1A-1P@-dp1P1X X T`T`  P  @, 00c<,:9@-0M02000`00Pp0:@P k@T 1\ 1TO/11 PO/11 ЍzR; 0@- MP +C-`CM P@ `<;P pܐ܀0 `0`0SO/11 Cߍ5S  xNl lPX \\qT0S  <41, 1d%,c$,A,GXgM;̸Jp@-P@1 1  p;,1p@-P`[@PW0 p@gp@-P@ᨸtP `PN/1 1 pVp@-P@1₲1(1 HP1 1 pV@-}@8C-@aM.pM<T[BP`ᤂrU U.S20P$0 _PZ d"0(@80UPW D",PU , @7 0_,P@77PKۻ1PL0P P110PU)!,`pApP0S7 S1  @; 0` 0P@Pd1`宷 PXP aߍ@\0 !90P ;pA-@p```P匀0S`T 0@P"Rp@P , 00S@- /,`,C-麋X@(p,P0`$ 0АYĐY T  T: X0WaU U VP P 06U Ѝ g/V0  @-@P 0  幂券@腸li  p@-P@0S|T0p 0 Tp0"S @0<00Rp( T4p0 ,B,B,G-lP0`Sp@;S S 2@1+1:X >p  QBp\T.@T&RQ0000(Q $A5 Q 0S T v. 0@1 00 0TRT0R"1 B,{p@-P@q@op1O-0@Sp`P 0 PRQQT SL0UȰС0r 0 $^0 0"90(Q $40, 1QX#  E vQ 0l.0   R pR `0` ` R [ R# Ѝ 0W1Q:P ,Bx p@-P@P0Ss!U 0E p(0"PE0U055403 0(2#p,B,B,40@-0@SYDP0@0ӕ, A-AP0`SG!U 0E p0耟@SV Ѝ 4 U(@0K`P `4p00 0@0V7Pp0P ᣺H p `00 P噺0'p(0,0`,B,B,@s1A-0PSp@` 0 PQQL SD0 7 2r 0 !Rv?000  (0V$0X3,0R 1RP0 0000 1Q\00R00S 0W1S` ,E@- @Ղ00S T ]ㇲЍ2O-X0MSM2"墀\0@S2"`0Sb2"d0S2l"h0St2P"pH -0SH380S 80 SRN80S 嗸, 70pHPASTPPEP @y@⹺`P. @ \00`0d  00|h X lh;S \eL!L@0P@_ouRݍЍ 0:S 000a 1 00 0 [0 0C0 O;0CS||HPp  h%F/>by بԣp@-XP@0S !R+)r00 S @ 0N Dp B,O-BM MpPTL@P 0`^ ;`( ppBލ ЍH0 Pe ᛼ Q 0 0 \0 `pp0 $0!X4X00 (00Cv$0;S sP TPZ +RQ 0P \P SG0Rpʪ0S S 00S 00 0`S0S00000000 0 P 0S  + 0 R$ ?! 0$ S 0"0S 0$ hedAO-DMhPl`PDЍ㏳@P >$6#Sp 0 /P` ;#S0/p0 d00\ `0h0x00XC P$`P`t0 (04H000 00 00p;갲 @-`X0Sg0 ~\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP S &0W Ѝ O-0TM00 0$ 400 ,00(0 0800P! 0` @@xP$0SUppФ Q 0U U H0!<01PRPp+/PUp<0L @P PUDp p0S H0L HLPp00D S400@00P4p S 0  S PS p0SW ;S S 21+1:$0S LƯ$0,  QB\X<X4RQ2ȠP,$0($0(Q $0(0 S ! 0S H (v\*80ƀ1 0$ 0 0 0S0 0S 0$ TЍXRX0B"1 B,{O-P0M@DTЍp`ȠȰ@D0S W0@  0 0 `P1/Y  S      Q R  0@0Q0 0`Pp1/P B, A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-㞰@P`p1S 3/P @`VTd0@@ᇰT0P0S@000S4000S(0000Aɲ갳 B,B, ȷ p p@-@4`4P0Sp@蹲10S 3/@B,B,0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp `^$ 4R R0 0`40$ Rp `083/< 0 2 P   ` 000 0S0\000 P 00//00/00/00/10/Q@-@@L 0A0003/P@( @- C-B`0SPEM;0Y-0pSQ-0 S| I-0S B-0SH;-0S0߭4-0Skح--0S00$ R!000V F 3 1 &>0!C> f`'0 010@0`],-,O-PM徬0@庬0` P(" `b0  500 0+p!+0@0 0+!0g0p@勬 M@.ჰtthl+@d| 0 L!Hs @p0 $!$i!p 0`쀟P0 R   P Ѝ 0p!H0i `г `OT 0-00@p NR S3#:@`0+,-,2,&-,\?bNA-@0`\03/ pPW@@P@ӮP< 0쀟DW  \-W0 U  0  !   0 00$ 1     t   Ch  0SJCT T0T TTy0B@@ r,q  u Dȳ yxs@-P,`@峯01Ѝp,p@-0(M0P,03/`h0@ S:000 00 0 0 0 p` ӥ0A0@|(Ѝp0 < O-PM4,@PЍ ხpP 0p @r @< / PZ0H03/0S@`H@`A0 0`P p" 0 Q"d2d" 2I0C 0 0 000 0A 0 0 0厨j٨0Se'"0 L0P 3/P X0P@T`@\0`0 S8P 80S ,3 0, S001|40P ∡0L0 3/00 P0 % 0 F   0  0d 0qȤp`Q@N0,J0GpD` 㐤80$4@`1!0 `*40 000 f0,0 p冧0$100\$10\0d00h00`@ pl0C+00S< p0 PÁt ,l3 000000 000 0 080pOp` ?3d,0%ᔤl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV 0P2Q >VЍ.P00SZ 3/@@OoBS i@0&00|10@!Rx!@!x@|@pPpt@岠t0S|0X*@GP PQ 0!@x 0T:x0S@ 4t@OoB@|0xT:(@:, x-,, R08bN  B, uu <,>O-S[?UM< 00@48@`D ĨP ῨpP Uߍᴨ0P40 P,Q3, 080S 0R@ <0S6(1SL 0L ,HLAP4#0C 4 8#H@; $嵥㲥 0@PPS @T "2B 40P 0S 3/P,00,02, 0SU@`PD`D@t w T2R}% Y0N v s,H! L@H@<#_`P`T@_P !` $@ $,$,00 0000 @0 $   , % $, 2$00P1:1!Vs' @0 000000 0000 00㇢p` DaD0U4 Q[T Y 4v Ḣ`B,B,, no  xO-/0@JM M`0PP+P) 0S% 0l"`R!`\r\/+0P T  0CT *0C/Q 00岰P.)@ٰm+i P:#)?0  $P+0: S `V)>00ꨰ  ᠯPJ>0@0/S8 0+ : S sP+ . P*!P 0/S`0oo`bS #p#0&000 SV+t P*+ P*nP(@l(@]gJލ Ѝ)@-MI*@-M @ᛰP(0  5@P * P AЍ=0S:$c(#"c  8#8S O-M` PPp X`p㴠崰S#PЍ0S @ %P0  6BpLӌP Xp0  @ڬ廧)N G-|M `P`P PP<+f'@P@x 0 ᭬@ @PE+JD>J.0㐬6+J5/J.0TぬT'X zPP~D4 qPPu$3+J0J.aPPe#+J J?` JPPN +Jtpll40 0J>⦪P 0 .+P UT 1ލP@Y+JJ PPp0J.@+ P h lJ>PR /8CIS_02%)+>irľ|/00/00/00/00/0@-0@4M#|0$P 0!P\ %P0T0670 P叢 Q@P Oᄦ4Ѝ0-,w+,,O-AMAd2 (000PB(0 0000= 80s#0(0`p[05 0!%500%`ݩ0$0 0$0S000`5_` @@`厜@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0 SW`vp 0 h T$`⁩0$00  0 0 0#4P00 0`0000 0^$0Sr D% 3D0Sa @Z%S[eP*%0C?o2 00;0, 0H03/$0`Sp, H0LC +0V   0  X00;000P0 pX00  00 (00P 0 00 0S r(0 8DQ0v1;0 H0$0L010,!<1H0$00, ` #P,  0Q00000S p, "P0, ,0 [wR0,4  "P4  Yp00p,0Y08pB,  YP P 0,00000;0(\cQ  k,00Z-,+,fTh%:,!C-pQ|MW0PSSp`0 00 P  "  "D 0@T0 S>T2x@&T"@(3@@,0S:0垠(0$"P'@P  00+0@080s=0 0( T W|Ѝ#x!@&(00\1 0`!00 XTʹ@!0(P R P@@ O0! 0 h0 @E0 400t0S00XT头00P0 -P@0(l 崧@h# @8q 3/P-, \g2j0@-)M@`0p \*3 +@,P0 }?*P 8- 0 F  j.ڟ0 0aЍ0!0P8q0 S+P ,㿟P ԣbN+,j ,A-@  "(0M#( 0PlQ2d2 5  L! D!@` ЍO p0H03/,0$$ (08RPP0$P(<00WS:< R4*p,0, 0$` 0S `0S< $`Sp $ PR( P`$ (0PU` P0 Sc@D S \0S 0 `p8P0VU:00S40000040,0(pWs08`<00< R:pp8`]p< p 00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (08`V`P p0k  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P}0H03/0@08P0D00Z|*p 0 `<080sb00_ <0 0SY04 @0SD0  0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0   V00 400P0 00 Q40 pp<0Pp80s00  h0S l Y* 0L03/Pt !0 儐X09/Pj 0$!000400$00(0 00 0S(0  0 H3/P- X$ 0 03/p<  0L03/0p Pp$0P( 0S pP$ (0 W00 40! 0$!000400$00(0 0$0 c(0## < 0  00 H3/P<00`0<0l0 S04$( $ 0S(0  0 H3/P* $ %P 0 0X 0T80,3/00T00X S \ $ ` ( d , w ,0St P0 P  R0P0l 0$!000400$00(0 0$0 c(0## < 0  00 H3/PP80s_ 00\ Q W 0 ST 0 SL0  3/P@D0 RP RP0{ $ , 80X T3/00T00X0 0\0 $0`0(0d0,00Sb 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQBPp`,0 0UA:8כ  0 0S$ p0p0$  S[p᎚`P p0Pj"0RZp YZ Yk:PpW00 U0#S p`Ѝ茀 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0P00  8 rp08Hp0!8p 40X 00 0S 0P*p ` 80s0 L0 3/P 08400H0, 00,0+$0T00X0pPrm۶ ]43, 00 80sh p Pcp@-@P(MG(0SΙ(`,`M0 00P0F0 P P`0(P^P,((P(Ѝp0000,埔(ۚ0,`(P, R,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1\!S<1@100> C @t70Sp(0 ,L,0#0s@ 0'8l 0' f0 W &%, b0^80000, 0 ߿0P0L80000  0'ٿX妖0<0H8H0P00T00LP (X0gW0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000epp U85P,0;᪓XpW( 0GSC(> $P A$ 00S H @3/Wv@DpH L0] YZX03/ 0 05@0L0 3/P 00S 0SpW+ WP-0pH03/ 0! P7/P%$%$)@0 Q1XYK @1003/Q  01/ 0S 2"c$Є  0:P  0 Hp0  @D@0 ᄀX80X> 7Pn㊕Bl,0S pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P~ 000:,-,p408bN$B,4uu 5 | 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-Yp@P` 0< # 80s#   002  0 S R( 0S%  吁( R Q0 2cT 0 < {+800 r"000S   8z$ 1 SR08C81/,!0 /,$1p@-S@ x1SP $003/p@x1P$1 0SO-@0`PKMM0((0DpH0S >I @ 0 0<0o- %"{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,ppK܍Ѝ(a(0S*< o !8 ;c&@@< u-O-`0@PMM,0d1d0p 0S (0 S> 9 H 00 0 <0.%"@~40kP`0V,p0U 0000000 0 0000000 00Ðp`ލЍ,♍,0S*< !, 00B"X R00C0C0000S0 0,0A$P,< u@-@-_0  !<$10(10,1P001.@-@K0 0! 0O-,MTTpPP`0 R",Ѝ "P9 @@5/᱕P`K ` V`G2  0" 00 0(0 0 02`}Ṗ0,ЍO/@[;p@-@Q-TDpDDDDDP壒 0 P㜒40 Pl喒 <0`p@PP卒80 P<凒,0 Pげ00 p'J)T*+p@-PBMH`@p 4  V|EEEEFDFFFFFG,GTGPY 0jPP `Bߍp`EP00S?0`:40Pl`480PS<80  0X0S,!ⱙ@   0P\0 `0S ⛙ @`d0Ph0S ⋙@l0S ⁙@|p0SD w@P`t0P^9^:h;=e>?t~AYBCE@-PAMH`@ȑ  V(GlHHHH0D`qK0 @0S  f  b8`V@契 0 #P坑 0Aߍ(0S l @d,0S D @@00S ( @ ^B/^Y12~30@-AMP@0Q*xIJJJJJJK K[     q0`N 0S (0S    ,`V DQAߍ47   q0`N 0S (0S    ,`VP $0(P 0 P0 Pp0 P\0 PH0 P 0 GB   60S O-@MV M<Pn 00x R# R0`^嬵嬅adDp80  @Q D0 P͙  șPD  H\  V`V8p00(0S% $BE00,0S$$B80000S$$B+0+ 0 p0B/↙Ppὠ C"U0S1 `F` x딣0p⇞ 0S 3 /`,pYV o$ @x8`i +0`0"  Zߍ@V 0  0S  x `pV A 0  1 PS d2 0  0N 0S @0S@ ߍG/<0040!00➕@0Fo$ 0DL03/00 Eppqr0S !0ℕPD` 0S  p8` V0(a x Q0W 8 < RFO   T 0@ /,@弍 0  d R0Vx 0;  m}~@B@&w.@-x @+0 @0p0啙d9 @w@-D @000(0,0000候d$ @wꐯp@-XQ`0@sJM@!   01S:YY ZZZZ咇Jߍp0 00@ @@0刎P(@0 (⺔0 0(0000 0u(1P(14P,@,P0@00%u5Y670p@-QPM,0$0`s@|!   0(`$1 SIl[[[[[0\<\H\T\`\ 1$ *PЍp 0 ,!,0S$0P@0 0P0 000000 0 0i1P0e1!^@HP@@P@8P @00%u, YO-P`0@p@d 1S 1S,1 .@px@d 1S 1S01@ @p<@d,} -,wY0O-@QWM0Tf1 L&0P 0U&4Ȣ060S $$000S'6\PUP| }1QS 0SP  1P11F$P |qW003/$q}1S}Q0p 0x 0 01!+Q8  Q 3p  0%X⪑0S.W% 0΀} ΀ L0 006)<1, X X"0S0bq0坋b/+ 0x0S 0W p1X0  0P}! 1[T<`I 0 P2# 0`00 0)1S080.0$qWp80P$P! 0SL0X 3/P h U PU 00$%1/Pt0S _PqUp0a00Vp0  0P20S D0 0D0 lR0 00 20S >D00H0$20L00PP00 000T0D0 10S D0 0D0 P 2p !b"`!0  e }/,1 0d!S0C 1ġWߍ  0P  0" 00$! 0 0D080l0L0X 3/Pp 0Slht0S 0_Saʚ  % 0 2@ 0` 00 p8003,,?,R,`#, 8)8z;,@ T R,;,| ku L0G-pP@㴠崐(M0T 0^ ^ 0S 0 @1`d P aV@(Ѝ@03,C-@4MT2P`p!PP 0 L0T3/P  Q000T0SX0`pS@, XT $0Sb S H H0S004Ѝ0CS@D&7#"dR, 30S/O-@SMP 000d#ď\Đ`P HH ⧐@3P ( ⠐ ⟮  000 單哮,pP0S* XZ'0 PP Tq 0 x0.0I1P/S X(0(0 00%R0SvU ( 0S `Pp 㺏00!15:% p ⮏P q Q 0, ($!p p $ ⚏P^ 00 8a4Q101T/?,DR,03,)0S@0@-S@00 0S/HR,$0O-P̲EM 02@T PP0 2P |1S$ $P| 003/P `2P X ⟎@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 pPP2@0S- $P* 0 x0D 0{tJP 01h1Pd1P X ₍8 0 BR { { {,{{d{{{FЍ0 0  00 0 0 0  00 0 0 0  00 00 000t 00l000`00\0,:,<, dR,BZl0I(R,DB_qa R,X<PYGR,]EX =@-P@ML d`P<2P0S%  (EP2 00 BP P< "0 4 P 0! 'ЍH0S10S-  PP'a000C R  R41"$0  000xpP0` 87/0P0 00 !`0ˋ] U00S-  P'000AC, ^ ^ 0!P^ X^ ,0SP\ $0⛋ ">S;,$R,4?,DR,;, R,AA-$A0MT@ QP` 0p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T  @TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 ;,R,;,R,?,R,\0p@-T00P PDPPp0AS@  1SAA`#,:,03,0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^@ ^T 0S"B,l0\ Q0/\P ^U Q0000@-B,0O-`GMM40X2@TL2V 00 0 0000000@@@@ 0h4p@c<   G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 x0@W 47 `4|4 VL0 <0G, ,"B03,u< ,0@-PDM@S P08 @\ 0@  Dd  0 0DЍ00S,0@-@DMP. P0, P\ 0P  0T   R X  0S0000000 0DЍ000S,p@-@Q`P@M<㉃@P   T0 0SP@Ѝp@ȅ0 @00 D0U@Ѝp,17@-@SW0HĈ 8Ph Ѝ0!{P4PgP<<0aP0<0ZP0<0TP0<04PLP<0 S, 0<0AP<0 S@  0"{080#{0,0${00000f,n,,v,@-@PD x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍp,}f,,@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P <0 $儯< 4 <Up 0$QP 0|! |Ѝ0:,a@-80@SP`4Mc00 0cP 003/00$1U Ut  4ЍS0 000 0xp 7/( (0̉ ꦵ7_50p@-PQ0M0@$ 0x`0 6/8 ⭉`Px1狄x1a1S0C€10Ѝpip@-@P 06P  咉Pp0S@}p #P Pp0S 4! B! P  jPp0S hP R 0L V 4QPpp${ O-uM Mp0 Z-WH0cS_ C0SSzB0S ӂPBؒ0SzȲB0Sy2 P     P x2@    PP2 HD     P00002x @@K @P@ PHPP< ,h@ ,D@01 01P01P010R0 0K000 0 }p@  PfyM} 0S10$1S 10 0Suݍ Ѝ@P`H9Pj2Pi1S |!R ㆧP %,;,R,?,DR,;,R,?,R,dR,(R,HR, R,R,>R>:,03,@-@900S @PO@,@-@PЍp$QU0 `P PP> C  01/P ,00 H$L Q>:,80S @-0 -M/῁ m G-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  T P $Q$00S U 0 |1 08ЍpP sP P Q " ឺ P _ ᨭ &P ,A-M|P8 U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `pXDD2 08 8/PD> 0!! 7#`  0 3/P"#"#00 03/p p0` L03/E⣬ .` 0SWp`?`B414!445L0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv  0 |1 0@   ,G-`RM@Xr PP XqP`H `HWP P7   ;p 0S fߍ<08 H(00,0 000040!04 04$0D0(0P ;|WZ  pT h p* \4Xq` 8  4W (W W W W 0,0W0 W s ⶉp 0`?`a8SPb 0  0**0P0?  0* d@edAzd@Q6-BA-PMPp`;@ ᝺p@P  P06P#U00 ## ݍ /O-B \@-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p ,R,08S^,/b,k, p@-@ 0(  P0R0PS 00Si mppC-@`PNMM< Ѐu0 ` P `Pq000 ;$@PD vptNލЍt 6ydG-xM` @pᜐ堠KP! |!0@P 0S PU 0 R<D1D!DDv700S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZL   YZ( ( pX \s8O-`p@BMMP/0 ;@ Ω0P0p X@;$  m P) tz BލЍjjP (0  h   im0/SX l0H, l!14"So[ 1 SR 1S  RS1S1Sr`2pB@?↯0Q 0 STS "0SO[@1kpPI P 04 8 < QR@ Q  A R !Q Q Q "r " 0Jދ500 " "ko@ ^U01U01VMKURXA- 0MHL`Pp t1t!tt:6Pj@PP0ЍT00始 0R`0 !?020 2002p004 pk 0PS" $0Q00 L03/P Q P0Q    R D0QR003/l \>R,P/A-uo\vwR2UR@C0B0Eҁ@0$H#8@ 0A- @P^U PP0 8^ @T vgP ` ` `b` ` p Sp`" 2 `q`!~``Pa Jk00`U08pRP08}/ ^Q 0S`P82S011111111108 m2~/P/<`0Xh40S0Sp  P p2S222=040WP 2SX/O-bM M 00 QP $00/;0P0`bލ Ѝ$ ssp y?`x00@ ,(0Z 2S 1S,2,",,40@0 Ḁἰ        0S@!? U㪋p ኤ< (BkP^bVqT&PRQ 0 Ip E W p!p'q ?p? @6p 2 W p!p'q??p0g@P%  0weJ  pj?WU E ,( pj2j?W U `d@ \Us@-RU0 K4@A`d0T `Š"; P0H00`04 oЍp \@-@ ^ @ T@@@ Pp` TPPVPU Sx   D L"4 0"8 0.4 0@.800 0",<< . 0R,43,O-P@dM0p4005Q 0 }Q Xg QP08B^  RW* ,50'D0Q   R0RS 0}υ^ @^TX 0SQQY WpdЍb004@F@  0@TT0@ 0@4P SI 0`P P\ X 0`VBT`@00T04^21 SR8080<0 0Q"80 0<0$0 0,0q?Ⲡr?0(2 02S01 (0 , PO W2m`!R   R" 2S SP 2qrⰠs?0 Ȍ \ 00 0 0\ 0W<2?h "QR 0S2"202#38^0WN dJ,0 (S$ 0 802o0 <04pP6 @0 Ē2Z02H[ 1P[ 0h 60L0S 1P0S`10T 80<q?r0 8Z o 0^Q  Rp0 ~/O ` 0( R 0C0#80R,a T\0 lO-@|MHX0(S S|ЍS S7 ( [8(@2D S0@ }(00$0,,QT@0S4000(S$0000Q 00S 0[SX770QP"~, 4š $(( (00) 0P00U00( 000$00 00 U00040 080408 0,000, S 0 08B4X6wu? v?( $R BT@2r/00q?`0sh00`0 ( R   T R,0S0u0<04fpP<0=X50~;\0o_P0"H```V PV Pg0( 8 t@0o/O @0S U SQ0-  T 000 0/ !o/ S㴲< $ 0 A,0S00@P0PT000S@ P0zh P0\b0@SP0 0HL R   ?  ?/Z[d0P `@10d ἐ 09/0P@\ЍY:,G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/:,>0@-@0M 410810!`0 P0u0 0H`0 H0PU ! 5/Ѝ0:,G@- PIl@ gk@-,@ 0  hZfh%@-@@0sk,00p 2f0Co8%Ԗ,-$M ?0 0 k$Ѝ0-4M 00 000P4ЍO-pQMEU$Wl "0pNl%0 0`000 `V0(08 0R(0`V0(0"R 0*`Pş$0(` 0  <P  0 !   fp0 S 09S 0Ѝp0 S   000 00P0 PS @ d0  pDL  Ѝp@ pc - \p@-@$`Pe]Pp0 @ `P0 002 0pp@-SP@`xM  j0 0fp@) fp'  fp! fp  fp  P  L0 6 p,4CxЍp? <fB c\0 0 s@->@P`Mp @ p0 p`` P0:p @ 40 pЍpx!R h!p@-@PqP 0 Tf01pP`qpJ Af0#1pp@-pM0 p @M &fp%f@pЍG-QMj700ۍ 4  Y F @`V e@pP`@-`RH00 Ѝ@PTp ]@P  Q*@ 0S0S0 S   0 0S0 S*]P ` ^^0ST   00000`0 @@P0  5 \@-@L@ ` L1p@-S@T1S#d1S.RU9lRUppbV:lQ^lbp1CL^L10CL1L1PSD^0P11C>^T10CT1T1XS6^0X11C0^d10Cd1d1hS(^0h12,P0C2bV^bp2,P0Cp27@-@0 PP" H1 0D18<80@ 8@   (   )     C A Ѝ0@_ Ѝ0Q@-@    bdP p W00` Ѝ@ Q @ 00 pЍ@ Ѝcw (Q@-@    dP p '00r Ѝ@ 1S70|]7[P| 01@ 40F pЍ@Q Ѝc +@-t0M0@Q0$%+p= Ѝ  081/@-@d'P0S  P 0800L0S S@ '@-p!@RM Qt0 p Ѝap1S0@-800@@lA P@-@p t10cSt14 Ѝ@M @d 0 Ѝ*Q7@-@  ,, _ Bdp  P1d Ѝ0@( P 11P,|1@ R  |'AQP |`00CS`0 Xa@ T0wp 0< Ѝ0@ X0 X Ѝ0c %% (p@-PDcp44p@S @dpK p@cꨧ pp@-P@ `3 08 l, >U\& 0 0 008 , 81pp@ p@-`<1P:<1x1S0p0@Tp 0S    0@-@T 0S @C-`P#.H0$:0@0   10 &000 0sH00,PQ 0a(!"4a4# 0s0 >Q & KPp ]W  g!080`P040 Ѝ 0b"!4b4#@- @T0800* HP  : HP%p@-8A R>  **'X K 0S 3@0 S   000x1  @  0SP P0 0 ,0 S   0n 0C-MM000@"0_p@00FP؁+ }^P`)pQ v07S 0 S W h0 0\!`1 1 `Px1 (ލЍ PpP  R쀟쐟PU "Wxx x  0 S   x0 pP 0 Px1p  P  0S 0v0 P  98Q@-@  ll|+pc07S@Y\0 S X0VST0S@c A-`R@p@M PP U=70l0h @ЍA"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *P 0S( <0 *3 2 <0) |) 0S 0d !r 0S>0 P 0SV>P  *@ЍA NkO-p@`,$MPP    P 00A $ЍOpPy P000 p}p XSP  k   0pG 0pG0 ZppIU3#pp pp E^p#3s 8118100x1Z* \Px1C 81181kP NP  6Pp4PpUPpP xP nP p 0S 00 rP  YY p 000 0SZ81181$Ѝ PP  YY p 00`` 00T0 :0G [W 000x1 Z R& ` @P `[` @H0` 0 00  WB W W 0S 0`0 7 0S [ xx0P 0S [{0 xr% @->@T( "44p P`0["@"44 0RW 9L L0 b"!4b4# 0C@> *>>0@D Ѝ耼p@-p1PSM"`! M%@P T 0p1!V T 20S X\{MRP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   {0 @ P 0  @  B.(0$p ,*l1S ey8  0 R/ 1/,/A-@P 1 !  bSXpR0 qP 0`0S000S \ \QP0 S   00S000@00P10 paU0A G-[0P@-p0p ppq g00P R\0 U  Q -p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@P[ p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@P@P0S 0S0 @@d -xʚ;@-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p,p0 000"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ x -P)@-0 0PT0/ -P@-0 0T0/ -//P@-(0( ((@008< D0 -@-,MP` 1U0@0$00 0p@000 0<0S eYp,Ѝ8010C>S00@( ( 03(00@000 0<0S80 p @M Y-@-XP@P |Zp!R@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0QPU `0 P  S   p0 Y00C0HQ0HPLPU0 P(P0P0V00 S   0Q0 S ,  0Q0 S 4  0Q@-@@QC-@PM pbĂT0SY 00C01@0S D3/2"(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0SH- L0 S* P% HLH R 0|S0       @@U 0 HQ0SPp0S} `Ѝ\ P RUk Yh T0e0S 0S   PE  \P 03/, -@-8 0h(@ p@ t@Ѝh%A-`M4PspM Y0 ETp@ W@ۍЍ4F P ڣ# "P  RP@@#C 0 ,$@4   R@%h%-@-   Ѝ Ѝ/@-MMP`@p0  TR 0pۍЍ-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/@% 0p/QR@%p@-MM p !Wp P@;00 dSV ~00@ۍЍp P0 4Od@%0/@%@-$@@!R4 @R@%p@-dP@O; P4 P P  o RT DV00pp@%h%Q@-@P:a@%@O@-q@ V01p V01@!5Xp@-PM@`   M0 T#Xp 1@ R! 0 p`Ѝpii$0 /L0s P/0 #:60#//A->PXMUV0P0XЍU700p@ `R0 PU B0>000 <0  ,> z!PP> *@-@T?@Q/8@-@T?@0P/ R R /0G-`P Mt0(0S @ P P P:`P 0!00 0   :08S0 J00 Ѝ080 00S # `pP `P0P 0iS.S  `P04S 040:Sh%0@-@PDM QP@T 00p@DЍ0U  2P @0S@-`Pp@MTЍ 0S P 0S Q 0  pM>@P @-000Q/Px1P/$0/@-@M  X  0 VpЍ~iO-YM `F/@H@9X0KpP pYߍ0pM 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 PAT1S@\1S`1 ՌP5\1 S S R@L1SP1 ČP&L1PC_oSRPU@g P0HS 0s0EP 0*m81 T48#88 S R p S 0 S T X @@?@0?H0p 0P0H0}>H0 @k000L0PPP >3iK%A-p X`0P M0 @R  RT T 1 #  0@ @ QPUx!@T00 Ѝ S @T@-@sp !p !p`TȀ %0R% -@  % A  !@   + "*  ) Q%£ £    + "*  ) Q%£ £ /A-`Pk@P─@Ѝ ⷚP\LLP0 qP kpP  A-PRp@ M 0S0T00 Ѝ/P P&`0 00 0  40S TT E8PP/00T S8WnO-P@0"S0Z"SJP Y pgpP w70p0 ЍT WUYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8rrrr4rrrrrrrT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: 0 U*`XJ:0\S 0}   0P0N[ SP0Sl  0PTPp@]ph%P /0 S S /S/P0/S 0 S S/0/O-P9j@P ЍO^=㬸`P hha ЍO}J U qWpJj@P  P 1 A Ѝ=ၸ0@S- P'[ i`PFJ ``[IP 0 0  0 0 p@-@P !J` 0SPJ$` PP(0S $J0(0$0p,` P,` PO-4M10C`p@XPSlt܃  4yHy؅yyyLČ<yyzzyyzh{{{{h|y|~y~D~dtyDyԎpyXlyėؗ̍d<P0Dp}$ؐ8~Ldxę`ؙ@pHU- `Pp $uP@  P7 7  '$ !P`0@T\0S @U0 @7 0H050U- H0?0P 2I0 @PA t01x4ЍFP 0 pp 0S 0P I01#@%U  ChUH070 0 JpP! .R 0R77@0U h 0/pPL H RU H0@1Soh@H000{U P0H0q ,0 00 0 O,0S ` {U ,0!00 0 ,0 S< K Uz <1E80w40b儒000 0 PPP00 0 P  p@0  @P  UL <180w40b儒0p00 0 PP00 0 P  0@H0:0H >P 0<0UH& 0S# /EPp؀  &P00<0/3`P 00 /0P0 000H060U ,0 00 0 N,0HS  >h 0A  a/ph  P 4@AK0  U 0 U ,P 0S U 0 p H0 50d h050,0 % 00 0 ,00,pYT 7$ U}PPeU700 5 0 $ 5(@p 0 (  0 p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 N,0HS 9U H0P SPH0;00H090U ` di`,-pP\ D`P 0$'J C_FH0Q7;0UlQ P0l1 P0l1 P0l1 P pE0P p1tH000|U10H 2v|P0H 2n tP 0H 2f lP gPH X H000RH020MU  0pPl] H0 S;70:H0205H0600H0;0+H080&UV <1!8b0w4儒00 0 P000 0 P0P0P@U2 <18∂04gr000 0 P00 0 PP00 0 Pp@0  @U =2P dp PWH0p000 SP0<00 P WH p P  PWHp   P  P  xzP  dtP=WH#  BjP S  ($p 00t ,p 00qpPh $ ( H,8   P< B7 \0PWH B& $rp= BpP9 ((u (r H$8n  P  B<%  :Mjt ]V$ ;D_kx1Z 8AdZ3pHSc<(@_$*29A{wp6Ti|j b  %GAiOT ^e~ $P  8PW ,0 00 0D K,0HSu  mP /o"Be ($P|/òP0H (0?Pl 7$ ! (0'0G ($P^/ᥲP0H  (0!PN 7$ ! (0 '0)UY H0#X U@XH020H0 0002,H000 H000H0 00H0 00(07600R 2 m *h350S00T01=5 =50H0U <10@0P@(470'P 0S@bU H$DcP$U 81 800 (0 00 0 J(0`S, 4`( "4`4# ,,0FH0800 "PP0 0 P 0 0XH010vH010qH000lH050gH050bH000]H,';,WUUH090OAK3O0\ U0` 0w ZP31Ȁ0/H040*H030%H, 4,H020UJ 0 pH0  (H000H000H0@00U- ,0 00 0 H,0HS U ,0 00 0 H,0HS rU ,0 00 0 G,0HS` ] O-pУ@`P8 P ᰾P `nV<1T ЍOR$ RZ4 ,0840 ЍO Ѝ :@O-S$M04 @ 0Q`P  8Ȁpz⨠娰<1H0  00Hp0   h    P U (  ' $Ѝ蘵% ,A-PQH 1`Sp/1Sp4x1pS8  m@k@$i@0g47S90c@8g<7S:8]@@gD7S;@W@HgL7S<HQ@(O@AL@K@ 1pPD@B@1pP;@X  6P T0 ST47,`0C47<7,`0C<7D7,`0CD7L7,`0CL7O-MPhbX@ D3&7 D000 0000 0P70P7} G000 0:00 30000% Op G +8 0 D 0p0 D+ 0 P#Z 1H0E,w>P0047{(8kP,:|؍<Ѝ80Ԕ$080,CP(/p,078247024<7囗 SJp,8|?@D7囗 SD@u?0H'87l"L'<7@7D7p"H7L7808 p,20!3 ( (P ((pW 400000(0 00N᛺@(0S 0 S S0P\S @ p p8000SS ,38 P,,00  CP 0?o20804P0P$0pB( (P f((0S0' & Ǽ PN(PI Z$d h➍PP78=0D0@(0S 0 S S0P\S 00@ :0P  }pPpP80,C P(0)S YL 9C00(hQdq`^Ppdq P DsP0S (P i eP 0S (P [pPP| 0)R00S LP W400000(0 0  0}0S D:$ D000X 0,@  ps0Q//Q *///G-p0@0P `3P Y 0 0 `R:S@C@3@D"X HGaU( HG萹A-TpW0 @T`@V0 L0LS @sP X X| |00 S HH0P 0RS  p@-P ٳ@Pp=@-p@-@Pp PቲPpT0 p@1@-0@T 0@0T0S@-0  u A-@QX2X"XXT0p  Q081800` ေPPW Spb0S^ U @@&P "P @T T0Rt0t 0SP t0+ t0( 88P) W(( tt0 . p0S  px0S@hPT0$0x x0R lD@ t0 pO0S ( ;A-`P Pc_ᳱ@T ᬱT0pSȱ@p@-Q Mz0 T0S0 PU|0h xPc_`Ự@P ᢱ0 @ ?  Ѝp G-Pp0M 唰⑰ ⎰  DP &@81A0 81(P  0Ѝ |B <@T{   5T0 R0 0800+ P T8p0SS90SSJPT0c B`P| 7 |0   P @T T0R88tPY0Sx x0R   mT `00XXSP  P T T0R88BP\;p;0VS tc_ ᮰@TG ᦰ0`SS-90SS)ὰίPT00S8 00 H*: S R   p 0S 0S G@⑰T 00,6 ^@P  (6DX QA-PP@pQ_`  0t0cR0a100FS  A!/kP@-;000 0W0S /00a lP@-Q000 0B0S /00a lP@-}H0H H-0S Soz/00a lP@-D0D D0S Sp^/00a lP@-H0H H0S S,0@oC/00a l bp@-@Q0 RP_0 0`S0 SQ 0` $=p@p0 p@9W0 p@ {la0P@-x0x xxQih0X  P R !P BR #@@ lp@-PP M0 z0S@T 0d($"4d4#@c@Ood@T $S 0@0 Ѝp费/0h`Q `0000P 0 a" l8,'A-0S00@Pd` pW /0000Pp 0 8,. nlP@-808 88 Qv(0 !>000a< lp@-@PQp<H C-`TM@ P `dp) 0 d ````d1pWp0`V& d" 0 0 3@@ kdT  @TЍ00C>S 00`"P!@03@000C>S00p"P!@03@04  , 0 -3@- P Pp@Ѝ0@ Ѝ/@KpA-@RP0p`@0S p A-0Pp`@S:0SS 0  RS* R0 M`V1S* ⻆P a 0@DpR: Q Sx $O-ATP` M zyC@PAD@081 Z  wp 00圵PȀ 喵P 呵P 匵P 凵P 債P }P xpPpZ l Dp \61@ R H:p 081#?Q0800 00 & &(p L0S% S% p H p P p $  p E pw P0S t0$0Q0p P pe x0SA 8111z0x1[:;p M ;P> )p@ hPH 00 \d\$k墩P|$| p* ?d p-"p]@x p 0S P Q [ T  g;p  #^;p壴PO 垴PJ 噴PE 唴P@ 叴P 労P9 X00S 2"Q`` Mp  Gp %P %P0 x1`$@ 2p X00S!XppW" a a!4p%P `V%R  p0S0S"0h 1SPq2zp@0-j   pb 0!`pZp  < pP 08!pGpPA 1 RZ  P4 ЍZ p pk H uT*PF- %KjgB6?hJZsp@-P@pp p@RRA-P`@@pL0s  S  U@ p@@@dW0S R H R U pQ p@-P0U@Sd` +00p XP@@T:Gp/z%@-P`1pSMAT  p@lLЍ T+PЍ@!R 0$ 0 0 p@ *@aV 0 !p@`P @p0S lt00#40  LLD SP [7 0 (  ; p@-PP 0S @0`0S @@p胵00p SU   \@ .S0.Sk0_S-S.00  @RW"0T0 0D0ph% @- @0P P9T00Q  tDP `00CS`0p S00 P0S X0X /X9긻%p@-h1@SPtTPPE @p ;0.SSPP X0P H+P 4P 0  .{PP p@-@P'Uc 0 580 t080 d+80  T&80H/@,8)0& (#@        70  70  70 70 7 Np@t坣 IPc3#)18@GR{^5Thov{c% 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pPlZp000 *7QލЍA. !. d0h 7p`0SPE@E p 0S:0@0DlO-,MTPpP+ S`  @P_30S  P@  P@,P$ X P$0X4B3dz00,Ѝ P,P, R P,PE0S X R0 6#3먳0 0 0 :$ R, R ӰP 0 0 9$ R R ,PX!@P !!! P/ P/Q0@-0@0Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-P@`MpUQ:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  P70 0 ԭ.0 I@0 0IU:D Xܲ0 0 `TT  DSPO-`@P0p 00900W*0S T [700 Ѝ!0 *00@KP  00T [ 00 P     @ \Jo"  & Z/Z#gT [\*00 0000K@PP\ZT [T [ KP|h% C-RM MPLp`Hp; @%?pE 6p V=p >4 6pTG    0 tIp P; IeP 8I/    VRލ Ѝ   20V002 0@I p  @pP0P@T*5p0S4 +p`@T*T 0 5p @ p   }0#$$("( 5pm @  j0d#$$(B(   ]04!c#!$c$" _5pM @@  J 0b"!4b$#  =>I   .0I/ P* I/65p$ 0S @00SP%@'5p-00  / @YJJA- PpU@M YЍR` R 00P0S 0 -0 0t0#0Q0 .V 0 00 03P0S 0 O-4MX@p 0S\`d` (0S:0 p20"4ЍO 0  ,   xp0,0 ,0SPCD ,<Yp 0"00,04ЍP V0 000!0  ŭ 0,pBp000P!d `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  09,P   8bp@-P@`P 0S P$`(0Sp,` P,` P  070@-MMP+ pp P0@ۍЍ0;0 C,@P ,P $@- PΠ Rʯ00\L  ^@-Q00P`PV0 V=`V xЍp@@T   ᅪ0x@ `DPЍp`Vx1@P 0>0S *⃊P PU@P PPm`j/0P@-000 00 Q$0  @Bs @-` ,MJ00<0@SP  '0x Bfp 0pt0 0 01 0 0S0S|0@0|0 0  X00Qx0 xIPT ,Ѝ0 8 0@0S 0xPTꌯA-`@VPPFP|P2Xpx`Es-P x倂|"x20 巩V0  y|20|2@-`@MpP! h (d (X( 8p6PU@ T700@Ѝ i///0@-M @ p+PPЍ0 3"Qtp 000)0096p0000@ 0+6plp 00 " 06p< Gp  p@-QUp@p 4-0x1p@-p@->`FMV '0P0Fߍp@PF/ Э9  0Xt01 0 `0 HF?#6P 0> *0 F?6 ii@-@MtP4@ $(P P@Ѝ Q@-<0< <<~0SSP`/// $0 /Lp/@-Q @ p000t0@0Q00@-P@,M(  Z   P5p 0 00S p,Ѝ08i(p@-@MP 6 ` 1 ⻣  (P5PЍp:iC-PQSM M3# T0S3"`V2"@p@"0B01801T0t0 H00C@L0@T3H @0H0L00L0 P T0X00L00L0PL0 0L0TH00H0XH0 < 0| H0 x ;H0R `0p 0`00t0H0 L00$L0T@崬120@ 2T@@D@@0@L0 X:   @L0  ƧXH@L0   @L0  XP ᮧUPPEPP@ D$("(/3p`Sލ Ѝ C ⒧XH@  C-`p"0M` 0$`  0{-pP @T+Ѝ`+PPA   0c-pg0 S +@ ``T*x0V*W00+T00V:0 (P|P@ ($ @Y 0@P @-`@DM pP@  ׫  a!> U 134  R2$ $@0 DЍUi@i@-|@QM  ⮫00 p |2 0"x23Ѝp@-]MP#y2p PP -R ֫000S0S S SS wR0S HipVPS CQRS@ 0`  x@P -$0 Bp 0S$ HD HΡhH 3p 5 $ L 80St S S00,0S  R000@0S  R00@ H @ 0 H❡!>50H \0p3p[O0S K01S dd0Sc0 0 000 0 0`TRY>S SM  ]ލpRIxZ@P= p@9 i3P0 0- H):3P[%0S" HM P N000Sii@ @-40 000 0+Ѝ 2S/2S00/@-@@ʪV002@-S0@0 @@弪V0002S 峅/ G-PM`p (PWP(@P0 0TT`031p<00 - &1pP0S p 2p PU0S p 1)@! (⨠( 2p | Px2p 7/PP m2p m'P Ѝ@9BqB@MlBpBfB@G-@p`0M00P U 00S1P     P崡 00S V 1!X0P00 0P0 PPP0PU:000000x Ѝ@-   2 ЍgBp@-0M2S`P@x (ĤVP@0 \(1ĩ00ލp@  B@-P`2@Sp0$M  0*00ᇤ%440 0 0p`0$Ѝ@-@;0 )@(@-@pp 1p`~B 0`( "4`#/p@-^@P T^00p``0@D^N"000œ\p@Tp0,R0-0 \ 0 # R0 0QRO-M@@00`1Q V00ЍP0p Q :8Q@SI 딂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 f'P 0 B0 媣 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S vЍ@-@ 000YP  R b Ѝ@-@\0S \0\0@-@`q0` /0`0@-@08$@L0p@-800@P% >Q" &T%0x1 RpR 0S TT0Q  >0S , p@|0800yTA-p`KPU&P@00<000S@ (0? @0K0cScO-@IM`ḠȐDp0 7Iߍ0RS*R? ,0000K C&PP d0S  FRV ( Q  R L)Qh 0 0000200> 0BS0 *⒢0 360s RpS00n T) $0K0p C80$0Q  DPV VdP h  Q 4($/ \ 8pHQ@`$Q DQV R <0S @HT60 0 <; @V20HS80 0 t.@(1S p0 H0S=00(  (100@ S . F P81#<141816%#810p0F07spVg 5Sp 0 HS+00 %A C 5V0@B WeV M 5S8Vp0p 50ST 0HSt300r ǡ 0HSe 7000  0 @ ", 02 S3 07 ,04' Rl Ip0  0HSA20 0 ☡W@(1SgVp 000DKP*0W(1SW(, 030 PV:0BST  ,,S P R:(, "  PV: ART  ,0 00D0C0W00HS90 00 0C!41%@ 4S Y 0 HSM00 $A  40@(1SWEVuW08 2Sk  8 "R0 PHt  [:Q0 2 0000 00 @V5 VpWH h 6SD 0HSr^00 &A Ƞ 60@4W08 2S'V0081 0 Z00 HRO P0@W00  ^00HS>t000@0D0D0 HS3<0 0 " ≠ 2V0@ WV}[Q0000 00@0 0P0"9 S0H R 0   _ @~0, $cSc257@-P\ R&@P\W0S x0x08  Ѝ0PP @ 40yp L% ,IA-PR1!@ ` P0 pC R0 0R0 06 30 0 0}P0 0:0 00sP00;0 00iP0060 00JP00ЍP 0000000 00.p0 00"p0 00 !C-P@UM"P, 0P`00P 01iH00P0 0v븀x0`  ($0(10< cV `!P (@B  ) 0ta!P( ``(1 ( N0(t!pH0+"70 (P 0y c>```h!P( `"(1* (> >Qߍ 0*Y   Nd0@-p0i0 MSP`$M1 1 !p *p@ 0S i Up ۍ$Ѝi@ 0 Pp I8QQ050 004pP!P() x%$ @- 0080PP `V@Ѝp0S  @P  ᡞ00O-IM PpPHLL `PR q @P0IߍO #0,0#600 0400` 0 p00,0 PS2 V30a2@0 0 ,0TO;`0 9P B;wB@PIߍO@8;0 Px !VT` 0X`0T$;0 4`;P |@[oO-@pP`QP,b尠,`2S$P㘀U`,@ ,r&-Pk&, Q 0S ,9 ]& P,`0 RO-00!`p@PT:Ip T  X ⢱00U *Ţ"0 4p Ѝ0R0  ➝ @:0 &p  :  &p@c-A-RMM00@` PRp0F R㼀 00 ApۍЍt p p @ NO: S&p 00CS@- 81S Q S0 00 0PЍ R 0# DPD3O-04MS@ h@@ `0P0_0 o0 00 0 pP 3 00 y0 pP3 0 0S0@0`00T0 @P0i 00 0 `P` 0 $ ( ZXXppP  ,$h(e,8b P`@ [0!P*"0 0HP 0 S$)( ,⒜p $8(5,82  P@0Sh0` 0h0  0304Ѝ$ i0 k p( ,\wtp 00 !0 ApPp @ kZj $D ,@,0pS P@,0$S  S St0P !R "R hp( $(,8 'P@O-P0M040@p0` `2##pRp#ppW9 pW6l0S~,0Sp,0儂0噇 2Sp,0800噇 847Sp,0l0噇 p"R000, 20wS4~47S 8 0h pߍ00 `2$p $  0 p 00 `2(p$ 8 0 p $y8 0 p(m8 0t p#0}0,L04l0 440}po#0n@0"04,0 40kp`8p`5pg2pn,0 !P ,@ 0,00lS  R, `" pP 00H1,0,0H0 p 0 7Y00, }R0S 000P 0I p p  0,,0 !P !, `"P ,0 0H0p0  0,p*;_Mt@`p@-PUp@bn0L0pp@- P# Mp 0` 0 ` 0@'pi&@ Ѝp ` 0x'p )X` 0p'p  T00; U100\'p@-p@`P8!(0-080000&0S  0R  dp`H Ѝ@@ ,0p Ѝ@ Ѝ KO-`@p 0帀SP$H` 000 0 0 `00`0 0 Р0 `  $7" 0T0003H081y H ЍO<0 $6 :000x3@0Sl3H000s$80406 D'S ,6000800S#;P 3R840S'01P 2R40S,d0S) $0P%h0"6 00S:P p2R 8d8 S0P 82R 4,$6 00H0S0SU h R 0R<0S 0S11H000s8040 P14 P18 Pl10 804 T0@ 0R0i $|0.0 0^p ̀h`0 [ P0 x.0S00H.7 p P 0dh0 ЍO Ѝ??:y"/P0;/4A-@PT` 0S0A hp` |  S 0i0P 0S <0S $5   .p0 s pP ppL0H00p 00p0   =00 0$0 F#5 FAd0h0BO-0R\M@pȀP 0#P X0 #3P 0 RT0` pp hPP/ eL`V` `@V@`#?L`}ooF`P X0 R2 R 0PUqNON T0pd0S  $ P $[ <Y y' l2 0d208#<410,00000<00@0,0D00 <$P(P Q48pLPPPTPH0#pa mpZ 00YPPP  0x 0'x1 08#<48#8 10 E00@ R*$tP 0S 07S Ǜ ǛY  S0  !!  Q 0 S:500 0Dp00 0 0 ЍO Y 0 0Cs0&o0S0 S0L0  p    0P 0 0 `0SY0A060@ 600 0p0 0  `P  0 S 081di@6P P0S0 0<S<0P0Ѝ 0    05P 06SY700S00YV0S9 0Ul00 0P0 RS0KSK?3050`%30 pY 4i%0 5 @0S0 Q 2 P   ? rZ0S Y Y 0  Br.  Br*0 @- $P0 0 0 Y & 0 Y 3@ $ 0P 0  S 0S0@00 $0D⍒Y<0<0818 ?  ; 0 P0kP4 000а 00 0 0P00 S*P *   pY @ 0ЍO600 0<P0 0S * oP  p*`81 000H 0 000 `0`0\0S   0L!YP 0 8 R @ 1ЍO3Y Y' Rr   0 P0Pd0 Yk 0 4. t ЍO#D[w.%b x.l/R@oA-h0PR@. 0 DA0BS`pbp a0 Ad$O-` /Pp 0䐠x1@T ЍT 0S R T0S> R *qP  0 4@O-,M@`P Q0 ,ЍO`F zVWP0@SS 0SP0#ttx'xVI:PQUE0VB:  *""448#8S50V2:1 S/ 0 0P!' 0S 0`00a0<10  &  !P -  0\,Ѝ G 0  B4 ,@-` MQP\@M  C0p000 p 0S TH # ۍЍ 0W`V \@Tc $A- p`@PpAPU- 0 HA0S 0A\0S 0A IA-0 ;M0M`pp@P @ p0?0<000C$00(00$0C,00@pV004p8  XXU0`$0 0p ݍ0Ѝ c  p@-@PzT  (@x1S0pSq 02p 02022p R Rp07@-PX0D @P 0S6 >0P 7P7;00@0S02700000 0#0 Ѝ0@}/gPE@DGF 00 @ 0[ Ѝ0zDl5p@-@P0( cUph0Spp@5O-P`@T Q Pd0S  0 0pd0 ЍP0AQ 0S 0P ,  08p|0#  帐81- 8 0 $ 0R0hd`h08 R0, 00C0 b0800<0  P`00 0 0.0S $0 pWp:#<0 2 0 0 R0H0@S( 00ppW\0H0/Ht   p00,0`( "4`4#S /0 @Rp@-00p0`PQPE@ `㛓 @d@$,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ oSQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScG-`x1 @PMT. 0S pW$ P ⷇ ႈPP@0Sh0S d0S4$❇d0 0S }PPPЍ|0d 0|00 00od0 00i090 FP] > PU9$0 00 HPP 00C@d8p 0S#0 0 0p8`@[ +  D0P R 0W0SJ @띎@ 50P 0S00 `0 SWG p@DW :Sp:SY @\Sp S Spp p00T:C P@D 0SJ G0P0@ 0 Y@S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 P0@DJ`F  0S   00,  @ ` P D,0fr  br,0@PEg P0S $ D0A00T*y PPR 0P@,P%3@-0  0 Ѝ@-(@ P G0 0@,0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ u0Pv Ps @ jG Q0P ލЍ vu0P P 0@POG0 PP U LqP   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  @,h%?p@-@PDp@NA-`= @P@ d# PPd f 00@^S0S:S_ p0 R0S@Ad PJ] \Sp0S:SH 0C^ 0@0LT1 0L\0TSpASBC\ LnnHmnpnHmHmHmHmHmHmHmhnHmHmHmxnHmn0bC ^ 0 0 00:0 0Pd @0:SS0AR0@A $ P A-p= `P@ d PPd0`Fu 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00A ^a0ASW0AA0AS70A\2" 0@-4@0P %PX,5G-Q0S `pʯ PV00Ѝ  yP00CS0 F Pp0  W00S(@ P   , P P00SW  X  R00S 047σ,P R   S@T PR   R X,,`,@0@-0S yP `PX,,@-@WP08GX,p@-P@PPpKEPpX,@-@AP M 0@87ST X,,p@-@ PS P@p p@-@P & 0@87ST X,,O-pWP`@P @ ЍZ K P PPT  RT@ Z //////O-D@00S P`$  4PU00 Ѝ  yxP00CS0D Pp0 0 x  V00Sp P    P jP00SVppZppW  P SP00S  P P xP \P DP ,P$} :xPxꘞ,ˌ0@-4@0P \P蘞,@X0@-0S ;@@0@00DFP0DЍPꘞ,О,@-@`0P0`Sp 0+P PP Ѝꘞ,@-@P08D蘞,p@-P@PPpCPp蘞,A- P@`pPЍ0 (0P84SUP @ꘞ,@-$ 000B;P ЍО,A- P@`pkPЍ0 (0P84SUP @ꘞ,@-$ 000B;P ЍО,@    /0A-P<<`0@ (0p0D0& SQ 0@/0PA/A/O-@PDpDpG``b0Y:0z  Z# 0@@D 0DA\0:Z: [=0 S: p `$ Ѝ `pԢ,A-@`Pp   A 00@-A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @PNmp TT0 pֈ@ 7<0@9(404 4/,00S Z0TЍT%ԣSԢ,A-`@ 0s P0L0p0pGWp0PCP @P @pT 0@@PP @Ԣ,p@-@P?@0 ?@0R:@@pP pԢ,p@-QM$0Sp A1` 6/`1!6/&%!Q10P! \`6/*)x!(Qp'l10Pdd! \\\^`P 6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/ЍpԢ,T%}ԣ?@!yroM$z>wt O-Q<08@0(00IpPV @}|x`,@480T:(x(P80< (0T:(x((< 80(0@ 0T : Z|030H*@`(4 L|008  D!0 `@4 ;|< 8000c4 0300 `@80@&000 4/0SD0p Ԣ, T%*p@-@0`,0DPSp1S{@Ԣ,0D0P/Ԣ,O-EAMHP MU>K0`0000, 0P0P6p0,0j0@00`o`L+ pp A>0t@lTllH0SpW W DyP P 00PpXA C9R񟗈܅       ,    Ll  Ȇ܆        Ѕ            @T  І  0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0% 0  ;/Qr$0`S  0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 0 00 z `| ze,`PPDAލ Ѝ, !ȅ/P 0H0Ԣ,OT%Do`a0 @,X,0H0S/Ԣ,0Pd /Ԣ,A-HAP|0`S@M*0S'} 0S S fu 0P 0P@ @Ѝ  pW*P 0 000z0p p@ `0p%X0 T7/0S :0SP 0 P0@ЍAzԢ,X,T%ԣSG-\qPL @0P12C001b5R 0 0&0S  7 h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0Rz00Yz0S0PS z&0S,P N,@GHԢ,-!\  0L0#0Ԣ,@-p0M  L0@31 ^AP 0C! 0ЍlyԢ, @-L 0 0@11D ^Q       Ԣ,A-Db@0Mu L0 @2# p PW%cP_  Bc p\  Zw$0 HD@,X#10000 2R01   0 0S0" V00 S Ѝm@P %Q|0S0S Pk 00Ԣ,T%@aO-@QpL$M(0S@ P u`(W +0PT\\0T**P* 0`0  `?oo 0c `S, `P T 1q*|J'0S l p@`$Ѝ4 T$P030#P0S X 200301S%T#2QZ E*0T00S  Dୀ`P 00P`P0 0#  0|0S0S @ @pu,sv`0<0 0 p`  u`P% 0   u%T#2QZ J*0T00S  DYVvꠀ 00FP )0S 00@,0, 4/#`PԢ,aT%@,m@-L0@'0S 0 00 05T Ѝ@ЍԢ,aG////d%/d%000/h%000/h%000 /h%000/h%000/h%000/h%000/h%000 /h%000 /h%000@/h%000/h%000 /h%Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/% -0 0CS0 S P'0 /p@-P@,`|Pp@ Tp 0A S010// 0P/!R/P/P/Qa/P/0000 /h%P/ 0S S//@-@!Gz000/d%000/`%7@-@PD@P 40R0PPA0 / Ѝ0Gh%PQ 0S///ᜩ% 03P/0 ACP 0AB0P CoSPS//O-MX@ @ЍOSQ`p rT} 04S`\xP0@`,S@T~L_Uᚔ!` y@T`0`PErCT 04SX:`\V0㨱0 r~T  Q X ( Q  t|yP@PZ P  yT0`0S0?oT20S@W-Ѝ @&0R @T`0-@}~@`00P  0S S @0V @ X 1Py@0@V X*Z~ 00 00S00/@!\%. 00S00/ᐉ!@%C ///@-@Hi@P 2~( " @Vmh%:i-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A }00ЍQ@P }@p@-0P `| @P  \*. Q  Rp R  (  p 0 B h%l,qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00!r Ѝ0S/1>3 !/0S 000/l,0S*p@- @PDK P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!!a0`0sA-0p0@P`M̂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ00 |R 0S |0 3/000Q R R0SQ|P.00 R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍl,A-PRp `@P 0!v000A-@Pp`0 SW' WV00S񟗋Ꜳ$$$$$40Գ$$$$$$V VjpGPX`ч1 X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0PS Hp  B0s  B`NpGP`Fe`AA-`@0PS0<R"*1 21<0S 0R0PP0S*! !x000S(!!!,p (#I0PA , (0 ,P%d%`%A-Pp0 R*S\ ]\ t`@BX T wPuP`꼩% R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00l,< 08 C800/`Q'Q!//h%p@-P@0`wP@@p Tp Q 010// $1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0P`%d%`%O-P 0R@M 1w P&  *w P 000Ѝ 0@   HPP ЍO 0 PS@ y 0 00<00S*^Q000800R ]R00-R Ԗv0S* ]R -RQ\U0]Si-Rk0 Sz:0S00T6000S8\ 00000 68^C8e SeR ,0Sl40Si$0Sf<0Sc(0x_ j 0(` pc0@`F p@  yUh 00C0c-R [RQ :R =R 0`S:  0Q00pS0p000-S]S0pS0p04 R*000`BV R:0pS0p00 S>*R; :R8 ]R500A  s0` `BxP⠳ 0(S0<B(R$ FP    rP  `$0  0$ 峠0S00pp0Q00pS0p000-S]S0pS0p0= m R:0pS0p00 S*R =R ]R 0S0 -RB Q?]Q< -Z00  V1 0S. V0pS 0p00S ,Z00V0S Z4 0xFP   `hFh400!0`Რ40 P0S 00000 P  P (B( [i 0]S S `Q\  (B( 0  EB#ЍOY ` %l,h%p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@h%d%`%C-@PPp\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  mHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB It i @ 0D OX &(  RPSxPA4#X  z 0   000`020$U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP  B   B0   B0V0\S0{SPP0PS<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S Y^0<0S 00$000*Xe .X< 0el,)>{^ ]h%@-0@``P?Q $0A  R Sl^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )p V 1L  0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   000p030 0V:0S003000 <Q >Q x`P  &  R  #+S  *Sg 0S9* *B?RP {R2 Q/ 2000( =$,Pu 0S 00h2Q 0   0R  0 `S|* ,Ry  2000< V0 R  !   `0 S*}Q00 0RX}QR  Q +S ( 0  BF  B   B0:  B~?S {Sz   B0(  B 0  B  B  B " A 0000S 00000l,h%^ ]0S C- `M pQpG opL@P 6W:( ЍPPP P $PPxP @ItP0 uPP 6   00|0  $ ( , 0P4 8 < @ D t_000G R:0S005000 S3:  H 0A0yBP  00Q p0 P>3S! 1St Sq S <0RpQ00< 0o )  sSW S<0RuQp< 000p000Q S S SS8 S S4 +Sg >SQP>3S S' "S 0SU\ S: ? <0Sg 2H 0@0 @010 0  H0S ZCPR, 0E10S*P 08 BB0SE0 1AS*, ^ R0C*@ Q U B!U \1LX0R#3S#^S!7l80SD 0>Q Q QS 00 0R 10C/TUUdDl,Ee$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0XP`%d%`%0p@-0PS0<Q@*@80P p<0S P pH0@0@P(00Ppp@%d%`%O-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T +P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  LP:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00Ch% O-Pp`0,@Q V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. P`F`FV00@>N>0> \0C~>!0>#0 R@u @O-4M0\0( 0(0 000p 002   0 X = Q  0 R)  R # `Z X !,    R  $  S  R  V  PP$ X$@1`v X PP@(@ xPPP @(r P  @@ $ X1  RvX PYtt vb  (B( _V R  !    _X RG v@(@X 0x  v% YPt P I_Vytu xLt  _`V `R`V t@@ v(  P Px Ptv  O_XO 8@Y (@X bY0txPt- xt v  t v  (B(   _X_V Q ( X ,0 _X @itg v xx ,    R (ZS $X  $ 0` (ZS  P 00004Ѝ0S0 0x| @P h%O-P`M80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R >sp0 `800@ 0 WZR  D>sp 0 I800@ 0 @ZH  D>3 1> Q p0p-800@ 0 p$ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T rP0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  \GP:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00Ch% O-pP,@ W`> ^* +^` ^i ^O ^a pP ^o ^Y  !P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>00 E 0000S0R0SpG pGPt0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-3S SY S$ SVSc 0 F>s2 R >sp0 G800@ 0 >ZR  D>sp 0 0800@ 0 'ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R >sp0 G800@ 0 >ZR  D>sp 0 0800@ 0 'ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  @P:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00Ch% O-lM`-PQ0r @-Qm   i        Q 0$R`S, 0pp WK,[ 4\ 8Y| <HZ01S0s x[RPR 0C1!S 0(_0p[Z 0000 ,@4H80 0 S I0 0CR 0%2 L D0 HY0S100u 0 S 00Z!  0 @S P0CX 0SY 0 0$Ѝ 0 Q 3R0D]T00S SD @ PTP?: = @   d40z0 R03S? $ꄟ Q0@-M@(,4`0  P#USA\ 0 `U-00ĵЍ~ r0\pFW`&SA0@-(M B (@tЍ0LQ0@-M `@(,0  P#USA\ 0 `UU-00ĵЍ~ r0\pFW`&SA 0G-M@0p`W PV P%Y P.X PmZ PNx P4 P GWf  G GV+  G GY  Gt GX5Z! L G< GЍYXZ-  G G  G GЍ G GZVY  PЍGd0  | $ 4  G-PQ00R0p`ᤔ00M 0 A@P @0S nS a0CSsNU2  0oSm 8[PN Ѝ/[PZ V000U000[P[Z V070U070P [PZ V000U000ZPZV000U000ZPZU000V000zZPZO V080U080i0@q@ZPZ: ZP ZP ZP`ZL V080U080?ZPo ZP ZPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000lIZP TBZP l @  X l <  ؕ ؕ 0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  Mp, 0 Yp@ Xp@  :p@@@d\0 PY\P\0 P&\P`Ѝ\00@O-1MM @PDP  8 "( "p C. `pX,@D;@8 (0Sl pp  ` ᰑ 00㨱$ %0!`p@ t0!0o TPRP 0S RA\001ݍЍ:\0S 0K0S R Pp 08D<4! @ P0 0w0Z  0J)0h,R <$1ݍЍpꄔ P FtH t gt0@-P@M 0  PNp >p@ P Ѝ00 0Ѝ0@Ѝ0A-@@0s/ PP0P  0#p` ``h0`0[0pp\X`p [``P0`0[ 00{rpC-@PCM2 /*IP4 $#pPC ` @}[000*t3 0C.@ F P4D@ @FPM0S VS00 SCލpt@@0S@\0\ 0P@0 T P@1:G[?00@A[00@,q p@-QMP4@SMY TE /HPB QP0s+ `XP OQaP 0`vpG @ 0@KQqp> D 3p7 ۍЍp+0si/1p0 +,QQ@0 P@0  P@1:Z?00 p 04Z0#S @Z@Z@-p@ Z00pxLpHxp %@wxoȍ Ѝ @-qP`O-$(X,P0p-S`@/U'W1 ? *UZ0 0$UP : [#P?5# yq 42x2 zPWi@rUZ0[% 0@-DM@ P, P 0`0?d0t00P0?T0l0@0?D0p080?<0h0H0?L0d0/X00\ 0 00#(0`@S  R $ R &R  :6$4&60!$ 0/!!> 5 Ã111Nş P ą?(ᴕ咉 ?( /( R  " R,咜  )/,< 0( 08# L.:6,$4&60($ 0(΃ 5#111L4 ^ 9) 0()0"!/#0 0 ,僂 ͌0, 0 0^P0(0 0T 0T$0P/`@ #)0`@00%$0S`@P# R"  " R,"2!x"$0St"x`@ `@x3p0P a:($^0\<P0W 0=R( Q( %0h00c @D0 0O"):60 0($0Ϡ! "(>0!!!0C 0 \ ( "Yx? ,`Ÿ 0/  "1? A  , , 0Y (Q0040 `@10P :P0 0<R$0h00c 0 0[OX!):60 0($0Ϡ! 4!(>0!!!0C 0 \ ( Y? , 0/  "1? A  , , 0Y(  R0#/`@ #)qd<t<l'"""".%Q(\)\²`@  0 Q0z*0^s*rs!DP&T8<`@ 0dR$  \[ XQO&PT8<`@  \0C000 Q00S7PT8< `@0  0C0,000 @ 0S# 0 h00$%`@0 @0D 0 0h$% 0S 000000$0`@2p rp t t `@  0 R  0 & D%w`@D000 P 0S %i 0`@ D!b 0`@ ![0S(0S `@(300P :c 0 /NX#):60 0($0Ϡ! |#(>0!!!0C  0  " R Ό "!( #Y?#"0/  `@ D#`@ D `@000 P 0Ss D%`@Q0i 000 \0S_q< 8 D`%d`@D000 P 0SL!D% & PA#RLP; R8  \Q,%8< &0dP(00 00% :60 0!$Ϡ0! !>%0!!!0C % P5!" ?.Q!Q( 00 #0BL00 h00%Hw 0C000 00S ^0 0  s 0L0^ }  C00 00S ^ 0 0@P \' R" !O-Mp`${R0lL0wR0W@0 V3 0 2c1  ?80PP/ 0v> 0`0?d000P0?T0 080?4 <0 00$$%"˟$` 0000  000V @;0d0P] 0TPP dPN$`P0Sʼ Rʨ R ʰ R  0 0f 0S0`@dp?O$@T'pET0}Np0`@dp00Q v^D@D 0H080HXP0 00 PESQSp PQJ| 40 dhltxP^@S[R R00d@px0Ut0Zp0 Rl0Xh0 Rd0Ywt [,[8P0>C 0C 0p00@t0p` VP x0S Q0pt0 00@p d00Pg xT( "ό R t0"! R RYv 1 ?)/!! #.ǟ/ B Y? ?.P  Pʉ 00#1?Pv.C BAQSx  \tp PpQ 0 %qp 0qp Q0S@T`p VPy0 ?oR20SP00ߍ 0 Pd@$qp@p 0Q   Q+10!pR@"NSp \TPd0 P0,Pd000 0  ZR 0S 00@ P0d@ `P0S0 !0X0ZS 0#0dd`` `ҵ0dP0? T0ɵ0d80? <00d@0? D0ⷵ0dH0? L0宵X$\BZP ;@pRP0S= C-ßԓ"bY2&:##c2S Pm8PP 0 hß0dT09L30@p4)P 00P ` d0@pP ?/( R ß&0Q| 0Z/0 #10">/ 0C!a 0C0 0"#0R"P#. X#0,lX10( #ΌQà3\!=30S 0@! B^ A 00 0`qp: @p(p>=O#00O0S@@㴰p 0d0@p괰[0"c01 2c1@T 0 O Q 0  s!P OT00|O0S10(` #ΌQjO00@podOT00V`OT00pTlH)\P(\ ףvɻ %I$@-@~ LepTat X00 R 0 R 0Q/  /  Hb b  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/THa a H  Q j.0 0#  Q/G00Ɠ\ 0@-pPo> 0@" \ 0 /HGA-@P `p@P@0% P PPA-\@`@P pjNP@0& gP PPHFA-\@`@DP pH@P@0& LP PPEO-P M pP9 谟P n.`P P @@ % "P P0S  Ѝz T W H  20p0SLEZ A-pPQ `@Q P 0@DDB(000S  ;?8@- M`pPPp) M 0 /0@0S M0"S" 0p000S0 7/ ЍM0"S1Ds\0pT000S @ Ѝ1Ds$ X4?g 8>\g @-@ @O-P`U M PP2SpPK P@N P K <10`0Z@P6 0nS# =;PP00Q Q GP R  \0  KB" 0 0Q@00oS@d000S p Ѝ4 ~TW <DO-BMM@p(M@0  0HP::PP  HPn00G0P PC @@`Kp 0 PPp 0P0 0 PPp \@P! H 0dSPkPU0 Pp` p}  0 JP @PP0 PpS lQ P' %L 00BލЍP/U ` P 4p@L0SQ  BPBލЍ B0H0PP0 rp=  5qL00 P 0Bd! 0 j0 0]L0<0  0BQL!0 Q*N00'8L00 P 0qB},L00  P 0eBq L0\0 P 0ZBfPe Le x d zd@ d b `b b hb Pb Db a a da 0@-@PM 0 A PЍ00@-@>PM 0 A PЍ00@-@?PM 0 A PЍ00-,M 0 zAPЍT` --V0$ S   0/ 00BBp@-PAU@pK?( ( 0P 5/p4B_ p@-P4U@pK?( ( 0P 5/pA_ @-@P 0003/At_ @-g@P 0003/@A4_ p@-Pr?oU20S@ 0 0 03/p@^ p@-P`|UV00P00S@p$ P05/p@^ p@-P?oU20S@ 0 0 03/p$@l^ p@-P`OC@PpK(@0 p@/?,^ p@-P@P p 0 0 03/p? ^ -@- M  dp@(0(003/ Ѝ@ Ѝ/(?] @-dp@0003/>] O-`$M ؄P @<0Sp $ЍJ0,P@@  4/ $Ѝ<>\ O-`$M ؄P @0Sp $ЍuJ0,P@@  4/ $Ѝ=\ !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////8\ $\ ] \ \ \ \ \ \ \ l\ \\ H\ 0\ \ \ [ <\ [ [ [ [ |[ h[ T[ @[ 0[ [ [ Z Z Z Z `[ h $0(- C^ 0CQ$ :$0S3 57 $05, 0$0(00 # 0 $0 0@-@$ MP#055050%A0!0%P$00$0Ѝ0 $0R  S,3 5,07$050$0/S<3 57 $050 0$0/0S/, p@-R@pP$(ASp0$ R>3057$ 5 $ !PpO-`@VPpDM@P؆, Hp0@ U p 0@T UO UK %I,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R#00C R00CT,@DЍF, 0R3057, 5 05 R, S# 0C 0S 0C 0S 0C5$0P$p 0@V@B 0S1 `@@0 SS( S R 0C#@ =0 00 P, Q0Ç0,  0, 0 P<@0S80S ,0 S>3 57,050,0@q`V  FV")VX*0FSTRQPONMLKJIHGFEDBA?>=<;:98bV5?Q20S/ 031 a< A0100@w  0 00P, \0Ç0,0,0P @ YfV ?R0@SQ  b9@S B88 C c3<21FV 0, 00 R Q05 705,5 0,0 5RQ= 305 7,5 0,O| f@ 1$01$0@@@0TS`VE.0Z0 Q X Q=V, R05`7, 505 ,   R,0 Q ,0 0,0 R ; @Zp 0Sm @R@ 0Pb % @ ?RY0@SV b9 B88b00 F@00b%#jo%#jx%ju00@-MB0@Ѝ0p@-P`M0@ 0I 4/ЍpG-PRM[  `Tp~PC/a@4P @1000< pp. Ѝ80S&  1 000< ppG0S0000< @ ppG0Sx F0S X 0 < @F00F00T \M m |P lM P @-$$@M Ѝ O-EM M`X@P+p `E= cI0P@'T 0 WI0P@T| 0 0EAP / /UEލ ЍF00F00d= N @-@` pMPCP& /H 0RP$  rR$   P @0Co rR  Ph 0 @bЍ0 Ѝ@}0rS KF 0 XN N j A-`@ p 0P/S /HP @0 Sp 0 S *  Ap@-IMM@`PP p 0: S X0 0up IލЍpEO00@IލЍpE00pI p@-IMM@`PP p 0: S X0 0Jp IލЍpEO00@IލЍpE00l 0@-@PM 0 A PЍ00P 8 Q  8 //p@-@P PP` 0 PP u 4P  p@q*PPp--00 M (0  ЍЍ/ᄇHP --M  Ѝ Ѝ// -- MN<P 00  0 ЍЍ/H0-@- M@NP  Ѝ@Ѝ/O- q`Pp,M< PR% Ppp0 0CS%c  P[ P@ 0 @[P N ,Ѝ000:Q!0P00,ЍhXp@-(M `@PP& (Ѝp0 00  Hp@-`@PRNpp p@p@-(M @P,0, 0 `(& (Ѝp訄Hp@-@@ @  `  @P)Npp p@i\Hp@-(M@PNp `%8 X(Ѝp@-@PT T  ,M` @Np p% =,Ѝ踃HC-PP,M/ p@``FV`R V @`0 @T M ,Ѝ00 0:2 0,ЍPXp@-(M `@P% (Ѝp0 00 (Hp@-`@PMpp p@p@-(M @P,0, 0 `o% (ЍpāHp@-@@ @  `  @PpMpp p@vxHp@-(M@PbMp `D%8 e(Ѝp@-@PT T  ,M` @GMp p)% J,ЍԀH P $ Q80 @-880@M08 Ѝ880/LL0000 0<Q 80880Ѝ/ppP/0@-@0@0 M0S 0000 X0 x0PP d00zB/P00 Ѝ0@Z5P, 0,,HA A O-3M0PP 0 @0 `D0p@ P P00U pp0 0C Y 2ATT00  RF LD@D T\:[ 2 0000~`K L0 V0 W7 X2ATT 0`Fs 0Ry pL 0  0 B 0SH \L0Ѝ V0  0  KL 0 0pHX<0S3 0 4Lw 0 B@ 0 B  B!L`FtZ  0 B  BL 0 z L 0 0S 0 B 0 b00~ 00  {Hp@-@PKppp@ 0RS00 /p@-@<0<00P  @Kppp@ zH808 00 Q0R00 /PzHp@-@`PKpT T   p@pp@-@P\ \  ` @}KpTT  p@pyHO-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDA Œ Č Ȍ A`| Ap2  W R ? \ QQ Wt ,0 000IC11i00Q0 0, Ѝ000,8y0 00w4wH@-@0@ 000 @T @P80@080w@-@P @P80@0800-M  Ѝ0-M  ЍO-ϟiM P̑Ёqa QP@ PP? `K͌U P ? K͌T zP> F͌(1S gP|> F͌(Y UPx4> C͌ X CPk= JB͌8W 1P^= ̌V PQ\= ^B͌`,=@ 0S078 H0P `P P  P P` P< P P PP( QP PP (Px PDX PxP'( 8Q780H0x100C40S000C,0h0LP 0P( z(0Q0Pd , P `P X hU1q @a0T0 @IT, 0X  p @dQYh`@0`@ ܼP`'  V U `0P1A1S  ,000@!1S 0D 0| 0?piߍ00P,,0`L0!!\\, @  B  $8 P<`@ Y& 00A00@S= 00 1 `V P`ƾV ,PY 000 `,0匰 0[p$0p1`㐀0@@p`SPp  W 0@0@S  P8<`@P(04 0R(0LPP1@0啿0S@@X!(@L 匿0S00!$0P 儿[T~0S0 0 v, 8P 0BX00P0 P< BY 00 O0 T ,q` 0q @PV f`Xp0@  P  U  P5U,0V00@ Pܰ封[ P@0ɻPP  U `X0pP @Y 0@X RzY0,0P0  0, H V 少[0D|A>`Fp1 ( `N9Y( I9e( D9r( ?9 (  :9( J59( 09( ^+9,  `,  B 08P< T$,  p , 0 H T0封1D|a)>p@8P 0<04 ! , B BP   $@ 0[X T[0,p`p0q0 0q08@<X\PV f`Xp1@  P  U  PHU,0 V00@ P封Y P@0ۺPP&  U `X0p8@ 0<X\P@U)[P,0 CT", 40p! ,0 H0X 0q1D|a=p@P 00 0R6 (0SJ ,00p W! 0g1(0pS8 1@ a! @0T0P0 @T,00 ` @,vX4!(0R1@pPBN0P@ T  0Pp 0,0 SR,0, 0B ` p0 W" 0 0B00`S9 0P 0Q!1 @TQ @gT,000 @,0,0Q@@ఱ>P`p PPA U  p ` $0S; ,04 1Y 0i1$0 S- L 1Q!qD0 @00T00 @T,0 0P @Ta$0V1@V T  0 㪹0P@,0 SX,0 00C @,p0 [# 0 0 B0!0@SC 0T 0a!H 1 P U a PһU,000 P,0|!0RP 0P1` @b0P` T  0 @  040 0R80000S O-pYM|C0cS@` Q 00L3?K͌ 0 00S?H`3K͌ 0H00S?pp2F͌( 0p00S|?Pl2F͌( 000Sp? 2C͌  000 Sd萍 1?B͌8 000 SX 1?̌ 0110SLN 1?41@BM@0810 POYߍ 000Sk H`0Sv pp0S P0S 0 S 萍 0 S  10S N bX0@-P@L0MH( 00 ,0 40Ѝ0d^H0@-P@L0MH( 00 ,0 40Ѝ0]H\0\ 0 R/D@Q 0Q(00?H/]H$P0P0/ D <  R ,  R$ 00?H/(]$0P07 A- D   R'P?UH@0aaS,p10 0D C  (  \@Uk@U(  R 00/\$0 00[Hl P  `0H?30\ -@@  D\,00D//[$O-PP 4M 0pS4Ѝ׺PH D0 0 0L|!0S:|@ĺP` `0D0ZP`@0PZ0 TJP V@``@|k:L ?3Q 4Q<  H0 00DpL |"(0:9`P0S R@,PR @0P -: R0`S4ЍT `@004  0`Pu @|`[$0 00]XHp@-\0\ 00PU 0@S 3PHrppxXHp@-@P 0PS P1[pp0P0% H -? \0| DR0  0R0 S000 0\$( /W$0 00VH 00 /O-tRt2P0M`@V0u T":L"@"4"("2 2 $ 2 T 0 01X 0 01\ 1 ` 0 01l  1pmp0p0npp@z20吲0唢園 $TX\0` 0lm0n =1Q0'0 0 0 0 nЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000V l@40(HG-阂pP@M |Ѷ`P @@d2Z0 @#0 ͆BBB"`@C @@ࣅCC匵PV C> pQ pL 0p R] @B0 @@@(P: 0 @@@(P/ Mp+ #p' p0 @@p(P  'd 000S :3S ЍP [B2T @Tyw`Ѝh0S )pP_S48 A-Z`pPp [Bd2S @T2'KI000 R AA A <,Q@-dQ+ P@E0`PM_  S- 41#0!!!!v : !' !_ !| !o ><^p!* p!:! f0p Q R 81 R 0SЍQ @0 0 0 El0T0ЍtP@0l 0̃ S/LO-D@p`ᄤM[ +X(p($W  0CS0S43 P 4 0/$ % 0:̓xsăH pß|x8tdX`(PrHhÃP@弁8x0,($  @2101: R 0S 18p10S pWЍQ `2 0 0#DHr'>ppGl`( g1(@ T (0Ѝ>ザrp<}^zvw8#t:q0'n#kz #gH#dp-a-^`_[|XoUpRrOyLzI{F@|Ch}@`a NI @ !p+!,%!-!.%#0#%of&i`"%{j%k %l%m<%nq%t$%u4%v,%w%x~#p#rd"ye"z|\@p@-,@'^@k( @0T(PpO-`ܶ6 6M000ƟJҭp6 0000SVF E p :p PP[ k p?P4S S S|V0S$pPn 0@l   $ `00 4S 0 0 40 s 00bR$ 4S4 0P%00Ѝp PP 0 04P40 s 00bR4 440P ?21 R R0 ;0O $Q B q 0 ;0 @pP.4 S S040S$ 004 0r0  cR$`S 404#` pse0  ;0 p PP4P0u0PPcRT T4S{0z$0P s 00bRS40 00V0ShpP 0@  ^ $@ `00 4S  20 zS 202#`N py p 0$ $P0 s 00bR40 ; 0⬴p@ P< pg 40 s 00bR4 4$R2P00$0C?o$ r  aR$2&100 ?c p5 p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100 ?c0`00$P r  aR$ $ Q 0000 4 00 40 s 00bR 440`00\0\0! 0!ʵP I8Q8HA,0 p@-P@,0 0 P3 TT TpO-T4P@P0DM+ 8 `$Qi w :Q|#R3Z 300S 8 pK0@ 30S0:3S `00X00Z! 0*`00 <00A @A40 00h=Hp@-@Pj<ppp@p@-@80800P  @V<ppp@ =H@- MP-pP 0@T $T` @@TP  Ѝ<V>0K P0@P@P@X@-@/P @/P f-P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o"(  O-00fS`PpMvpJP U0 pr(ʍ"(0J"Rp 3S(0$00 0$PK cT$P Z 0XSX%$ LT 0@50 85 2P4S0300SL p0SI 4SC 4S 0d$V、匑Tp"2 =PN 4p2Z LQU P P xP DAoL4Ytx2 PY $4x2$4X|2 Pm 3|2gЍH5S4S 4S0?o20 D p$l h $ <%$(lX .P Y .P Z .Pp2?;~0p220P_0 r("(0II"Rp7XD  .PZ2Zx2X  .Px2?;~0x2V  .Px278x2Y .P<2|2Z w.P|2?;~0|2V m.P|278|2v1S05 4S1zL%R.pZVY  T.PTx2!78x2|"ZYZ8PP!x|"t2OZV*  9.P%x278x21|29p2Z#0 0Ѝ@-h@M@ 0SЍ +# 0R  (00 Ѝ # t4@-LBL2@P$MQ :cVW0r3p p[0Scqp 0SQ1p0SB 0  B0`*1`00|PN 1@ 300 R 8 D 30 0X300 f :3,p 4 P`$Ѝ0`00|P @ " 0R` 00 ` 00T @8 V300 "X pA- M0 P`p   `ȫR`hp `L@徫ܫ<0@00:3S O 㮫 Ѝ | 0 000:3S/<0X0X 00:3S 03@-p P`/@-@0@ 00 03, p /P`@-<0< 00034p _P`@0@-PPP M* 0Q0@00xP 00 02000*C Ѝ0|P H00 020000* Ѝ0p/0@- 0 @P0:R M P% P P Ѝ0P 000 l20 Ѝ0PtP 4000 Pp0 000: !-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0\@Tp-#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@TЍA-PPM Q@`Q00?`FV`V` ,p(L 0@nTЍP/\ 0,  B0/\//A-`MVP@,p(L 0@BTЍA-`MVP@,p(L 0@(TЍ@-PP M Q@7`pV00Ӣ?0`FV`V` W,(  L0p@T Ѝ(1@ RR( RR T 0 p@-`V,@@Da QP(0 ^0C0 S0Vp(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0V-Pp4S-` @PP3@ 0 00p) ,4, [ 0  . 0   lЍB0  :lЍO 0O-:$M$pdZ0  r$ @T^ P 0p p 婢 VH&:0PSF  0 @Pp$Ѝ @ P0S S7 SpUV'0004S$ЍODp @0S F0V  B2Rp  `Fp!U 0`F Vp  p!@p FPPQO-PM 4 3`S,[*Y= @00! 0@ @00@ zTP/ { @p ` qPPE @0S  0 ፡`PЍ` D  P 4A " 29Ѝ @0  P0  0 /ጙ404 000S :P /<0<0 0 0S :P /404 000S :P /<0<0 0 0S :P /H404 000S :P /-DD 0\ ʌP 0 s@-|0| 00@T 0J#4R B0pQ 8@.P h @\808 000S :P P/D0D 000SP:P4@//000 000S :P /4L0L 000S :P @-xp @W/A-0 00pW* Z3$SP! #R`@4Sp`3@Tv AlB0tQ 8A.-0    p000 000S :P /O-00 0 MX% p `P 0 Gp @4P  0 P;p@ 0 5@ y Ѝ@<P  P /p@-JP p3S P`4`Z30PVT  0s3 S 0P 2 $R 0X0S 0D3 20X #$04p03ppDp@-jP ,3S @P4P30@Sp@A-`PY JSU#X p @R 3S$ S(XڒL0AQ0, X0p ,01B0010χL10|10\ b0 0XP 3PSSpP4Spp3PUpp@-@P PX0:"C0T0XppG- ؀\/P@p  `ᥟP LTL VW PT WV  P000S;0 ᐟ0 0 O-($Z Ap`PMP@8P ( T2QP* T GP 0 n @00 f0WXT P  RX8 @(  !@0 d @-?C0 @   @ (( i  XA- Q@PP% pW# 0 0S0,ޝ000 R   R   R  P .ɝǝ4Ý`T `TX *P Q Sp  QW02pp@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S hP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0pnpH0H 000S P@ ?# Q@ 080//H(0( 00Q0/HH(0( 00Q0t/Hp@-P0P0 0@R` 0(00P 0P 0 00@000480H000\1 P``P ` @ 㶗P@  T  @`` P0CZ``(``@ P 00 0(0 0帡K?3$0 2[00Z2K 0STP- 0C (\00C:000T ,S  !(0   00C0<Ѝ1Su[` SP7  0 Z  (0000 0P0Q00 0 0X0 X`@00 7T0`F[ V@pV p@<ЍZUZ00rP 0   0T S00 , 1 @01AT0[80  0 0000  1 AB ?[0@p`` @`HLP,D |帠p@D 0 Q H0T0Q (00^00Sq H0@0 L0 0DἰD 0R`D0|0vpjP  S,01@ 1A`pD00|`^p0R H @ L Q Dn1S J0 (00P0 080 5 l10 0S0L0 80 & D0=0 p@``(00P01  (C\00C00 T0,R001 @0#80 000 S 0C`C00080   J O-PM? P ,0H1`  0qU 0/p @T% PE$ `p0(@ U 0哘P0 0@  0@@0 Ѝ-,0 (0 M0 ЍH- M0 ЍC-@P M(p, P00S 0G`SLhPJ0 O@0H"Hb ``8 ͘ 0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ000 Ѝ0`00SZ00%0   0T S00% , W10X0pXP T0`ER VڜpPpV 0 pP Ѝ80  080 000 S0C`C`sp@-`@P5!pp 0p@- M Ѝp@-@T T  M` @P!p 0 Ѝp Hl l0 00S X  8Q Q @ ,@ /&R//HH H0 00S 4  !R@ ,@ //(H`0P0 T 0008!R !R @0<@0/6S//<0P0 0 0001S@0<@0//\l0l 000S X *" (Q Q @ ,@ /&R//H$0$ 000S @ /HP X0:20(!R !R @0<@0/6S//0P @ /A-p@Pp" 80  P` PF  ? D000T $000S0H0H 0 ?o20QQP T//4H000 00 0RPT00/HA-`@P` 80  QP p PeU @00PU _000S00 00H?o20SRPT //0PPT00/,0, 0000P/P/`,0, 0000P/P/$O-h3@P0Y Q T# PU D#00SPH00SPQpP0GP0HS``HpHW, 0 ^  1  !!pGPI@Yep0S a[0q SV,0 0D |000 P0pP`a`0IS`IX`a,1 \  0  !!pW`YHp0Sa>0 S;,0 0D | 0 00P0qpI PX 00C P0HSP 1TX[00CS``[TY0IS`YPY0 0CP&Y0 00dHp@-@PpP`0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0S 1H`?c`` AD Ap0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CT0 00HT0 ?o2R0S P (1  //|pLp-(^,0R0^Q!R@O-A1@ 0QM4 P`p, @p 0S" Ï#SÏH000C  ```P  (0R0 (00000C00T0 03/p 0PS@  Ѝoxo4n(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P' (0@SpP0@-0^ @ 0 Q@R0mO-`P M@ VU``D0S  00C(00P00 T0P 0 S `&, 0 SPp0SᴀJ`Dp᎓0 `| 0pP Ѝ 0 S RR Ѝ,P e,00P 00X p  ``F , B,(`aaA0  U p0E`4ʑP  Fp`,004@ 0U` p0EtPT   PB  0SQ 0 0PC 0$ 0\R <PT 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000U1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP H4PQ8 0 /$ $\/ P/|PQA-a@`ؠ1Pp0$ TZ 10 0 QT$ D 0R U ESpM D10 0 QT$ D 0R U EAp; 0D00  Q P@$ R U E*p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q(H4PQA-`0`p0*Â@$ PP q@D00T 0Q@P- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P  0 BS0@( p`0,,0A0C1!0 0i0`S@( X0@-8  PE? J0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M4~ڌ`ọ@Pw 0㈰(᳍Pp,o ͎PP0b Y4& 80!S0` ``pX08 0 T``0a$ <@0H0|0L P08 0!\08 `0d0h0l0p0 ЍP4/ uP) 0*Q! Q80 SpG V P  PʪP Ѝ តᜏᚏᘏ@ᔏ A-0QM@PP(C p`QAR   B P1 \.X) P$,PBPP H0 DH00R00D p0$`P!b@0SЍPЍ@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI 㑏L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @$40@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ00H@-44@M00 MЍ茭QP-D00M  ( @05Ѝ<P8 /00@-MN 0N00 P@ 0 0E DЍ0QPO-r( P0@|0, 0!0 8C8PT* H00E  @HDHT,0Q0 00S H00S_   R ,  H D S400,01$00Q$0 0P 00AQ 0%, S00,0,1$0000 S 40p0L|@0H00D00jp 0SL01H@400 0,0000,00 0Yl0Y 00S 0` S0F 0R_4000,00 1 1 01IY0CRڸ/o<"L\ Rn Y@L0l00P6P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Yp$ 0 AS 0 V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s D  RD   00SB 80 T8( 0`V 00P0 0CS 80 @-@ NN Œ Č Ȍ N LL\80ɟ`Vpl<8( 00S>0X *1h"0( 880 0 @ `40 , 0W Pp$t00Sz000 @0#pc 1`11qWP7P'PP0 P<00 00S 0X *1h"0f40V @ 60S J6( 0p|Q:0A0 0C0/ꄆ 10 0 S' PP 1 11RY@ RRQ 0   V %( R R !%`FPA p0p`P@ !?3 pGWaFeP `/0 < p  L  `P 0P0P00 PP0P0D0T H00S {080  400 h H(,40 kp`\Ѝ8 L0j bT<00D RY 0 R PP!Y n [R  g[ $R\  0E0 p0T  0E  <000$R ( 3 H000S2( 0<000h0S0F  0 0}O@t 4000Vk0 0C B 040H00 R d1S\Ѝ4080 @0 80.P00C\H00^<0SC P\1( 0, QA@`0`4! ,\@XP ppX@P EP0@, Q J   4p@,@ APWp@PT ``LA@4$;pQ 8xQ t98/.@.-,p`TPp P @0`, AVXDP q@DH P! R @   \`Q  ABQ`P P4 BQO p @ p   ,@ 0$8 R p P p , [!, !`w @@[`o P p0 WPn $ Q  $P p,@08 P LPA\H0000`, Iy$ @A`0,  \- `@00400   0z8 0!00@ 0C40`0 pWPx p p  P  , BQ 0` W G 4 DP @P | 40@ PL0Y0I D| p~0TpP:W W@ P o@DT GpGGD@a0 0: 40Rpp0,@0C 0B0W,0P 0p p000E,0 PU U R0a R  W R RR.0 S0@^ 0 RAA$8 LD@ , H@zX LD 0B0 B$8 B!!i 00Cb 0U40P0 P,0a0 0R0h400,@P d1S ( ,7 G <0@00!R 7Q R dP  ,@ ``E 0E0p0~ 0E  <000P' 88(  <0@ ?0,0 0000Ss 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  P9( @` 0 `b( <@0 0L0 00 /<000[( l>@ v0 `C0`  <000tW B `0 U<`? 0 0LPP6Pj <00 pAU \ʕeH5Sp@TL 0$`P@@U= 8P8P `$=` 'tƒ /A\  B\  ^tƒ    /V01P0A 00` P;ʀ :l“3\0 /@P%0000CS 00000000000000000/LU@-@P@M&\\ Y #3t P P 00 O000 0jЍ Tp`P -P\P Y͌# /XS@-00  |00S d d0 8=0!D00 R R 0,  @-4!41 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ !A\   (RX0d 8 0 000:h/Pp@-@0@`P0M*l"R R`   P H00 040@ 0 @ &ЍpPp|02C-00$RSP@ M "2` @  "0S 1#{0 Q  l"R. R !`@ '( v@ Ѝ1=00QM0SJ\1`20+L10 0F0剑Q:20t1=00Q!0S0`20l 00 0&0剑Q:20h00 00`0`Y0!Q 00`M0!Q Op0 000/Mp@-x0x 000@00CS0 S 0 S P00pZ{P0M0p@-0CS@0 S 0 S P00p<{P0p@-,0, 000Pv@pLp@-Pv@p0 000S  @-@J Q P\,Q    @/(LH0P JP\@-\,AP / P/0S/p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0pPP`@ V vP 00CS/*+*00+T0 S80  ,3 0@,0 @D BT p`$ЍIɟ,0 1A!R 1A0 CPg(pW01H1qH1P[W:PP  pGTPE  P0 00?3[0pPPp`rPP+  U   PQ(0@ SCIP@C00 (0C\00C _2b$Ѝ {q X@ @ D0|0lp H0@D002 T `V `tV ``  @x=@J0 00FHp@-@Pppp@p@-@80800P  @ppp@(FHO-,6dM0@P$0 Z Qx 0pu`PuQ P"r0P0K W 040P0[000P0@SE:I.A@`0XP0P00PEPUK000 00PS0404 00 0`P0p @R@+40T R80 % 4000C?00-uP`F(uPH` !u$ L400Pp pG`0 0p`0 PP Y 00 00 E 0 4,QpQpP Qձ,pp( X4 R!! B qH" R~U` pG,UH04 S0 0 P` 4,8p 04,0@,@ 0<8"PU 0 4Q00C 00 Sb 0( 0C0, Q0 00PSl 0006 t$ 10 P 00  0! 0 K00000p0_000C?00etP pGR0H`FOZtP 0I pE!q X{ 0H 00 0ᰡH X!D0|0p*sdЍ004 p` 040T pR0`40 00 0P} 0KP sPdЍ`sE0 00 f?Hp@-`@Ppp p@X V00 N8?Hp@-@Pppp@ Ap@-@@ @  `  @Ppp p@+>Hp@-@<0<00P  @ppp@ x>Hp@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``(>O-MS D@HP 0Y 0p`@ 0 0[  F4/ 0 R = $R0<SX10000#10#.Q00S0> IP 0 0@0 0x00 P  0H8#8 S R0 0?ظP4/[WЍZ  0H8#8 S R@0刀0ຸpP4/pW=@0/Q" @-@ RM !R "R pPĜ\  00@[Ѝ/0Q " @-  MS S PpP$R (@2Ѝ/|:-4M0 Ѝ\@-@000M, @Ѝh9p@- 0B\\@S ^\1  @ % e ,\'\ { d"LB!!A0 4"!! L}0 p%   @ '  pPU< 0 ER3\!@`P    ^0 B! { c\ "0  {  \ @ o% d  + {o\\:\ { c9QO-M  Dn0PP 0  &  0 S  s `\@u,\    @ \ .  QS%\+ L GRSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8   Rp 00PЍ%@ i\@ @ `f` 00#1.Q0*Q 0S k@  RP %p0@ %dd\  @ @   RP% p0 @%@c  RP p% 0 C@ @%+@c     R} 0   @  Rj 0   @TY @ꄑ 0 0   0 00< 0   0D @@ @  T0 S\R [$ J00 S $0<  q0>/ 0 0S0\S 0 S0 0006|&(&%p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0/<(A-@0MS0D0@!0@p0S? ` 0j1Ã!1P!1"b2cP@AL0L  00210B\P0 pW$P@WP 0fSIPЍЍP 0Ѝ.N"gA-@0MS0D0@!0@p0S> ` 0 1à ‚P P@0!0A1 0120BP0 pW$P@TP 0nSPЍЍP"0ЍL-kLp!>C-@0MS00! 0p0S2 PU 0 `1H $@0   0 @ 1$  0H $$N04!b1cD$!b1c  H0N 0 00ࣀ((!h!b∀C 'P㈁ 0tS0cS0S㸠 0 @00 h@PT0< X 00k 1l$NgkL>-?L*S A-@`p0\ %\0PpS sS lS@ 0\TTW 000P1CP0@CV` 1D!v00O-餮pQ qM PP- 00S0406 `$  0l@H 00S1  RS G@T l P p 4 @@T %T@%T400 R,:PjP 400P,%0p,08=0,P0(-(͟00:T T) `DV%?#"< / XT c`D`Vfz t``` 0`DHlQ 0>T-0p0  Tg@W -@@@C?T@^ >Tp A0D =R=S3t 1CYbewV.`^`0^@ C @00! D 2d* R:0\'TOP ͍R'R ͍T0   R'R'Rp@@pI@[VhP 00040MhP, 000p^ Q1`!RZ 0BS11`W PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#{1S 0C-11@ Q 34 00`Q,]*P 0 mp 40P040`OU< 01 1`0@1O1S  0C-11@ST 400 Q,%*P  4 @@8AT @D=AA0@a DQA DR3@D1@ؕ% R ?R ;RM  pR 0%R 0@a0D RA0DS 13 DOS ͍!!010@Sl00l0 0St00t0QU PE@=1QP OU6 =1 =10@1@10D R-1!TORP=1=1 @T!p1S 0C110 S@Rb  ?R ;R QeR  pRT 0%R 0 00000 0 B10 OQj }RR0  R}R}R@@pr!R =1X@ BT! l4 Q`!`10` Q,0*S 0 lp 40040@L, 40,qߍ! 1It00@QU PE=1@Q@1OU =0@01P@ Q#-1 1OSQ00PgP 400P,V 2gP 4 0,`V b``&``VP``P``Ê`@oobP``V} Z`y`@vs`pQ AQ AQU PE=1!T@QOo1BV 2g0PO 4 0,0R@p00@ 0 m00 @00\# ' V8$`000&@DQ0VT$"! y p]K5#\0@0B!@DUOo0B00N0@00-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/|A-pQ@PM 0S! XB RfP `V! 0v0* V U~ ``ЍpP0U0f ``U &8 0 0 R U Ul1P0S U8  op 0S R 8(C8B((0 000SU00P L0 8C8(0P L0 8C80TƨU@4༨< ht@T (  | 0R @-ME0@S  ЍA-pPP U)  @`TV 0PS |@P0D V  6P .oO-PR M `Q 00 Ѝ@ pPb % Pb Pc d%0 ES  eP  P  0PP P0 S    P`0 S  `  0Sn  0`S  0PS  `V$ `P *f$`%dP !dPdP 봰 0$[PP "? [ `$@ k (B8BBXnS0 sS fSU/o0"S R00000P`h&h V 0@:  D0S  C("(  ` P0ጲ 1P 0 U W PpU 00d P`Vl Q`Fh&hVPb    0 SPW  P`U= o᫲ 0p @  0 ` PEX%XU !  X * `0 @ p0 00  PR0W00Pc0X0  0P/W  R000Q0e  cP$% P0(C-Pa@!`pM0 h P 000S@ PЍ`P U P0 Gp  R 0S 0IPP   PP004PЍ B 0 P  @``+ P*`PĿH ԾpO-M M:S&0:SSP 0`S:Spp@F T R!*  @ 0  tDiP 0P:S ۍ ЍPۍ ЍC-pP,Ÿ,M M@`tP) 0/SI P5{P 0 ۍЍC0P p! gP20 ۍЍCl0P 0S/S ܃pP ,dX y0#dX IP 70 ۍЍC0 PۍЍ p 0^cYW L0L 0 $ۍЍ404 0 $ l \   G-p`@P  X0@cT  NP @\PPP P @T  @0GT-@-@ M&00 Ѝ@ Ѝ/s1 Ѝ@ Ѝ/@-@ccc@cc c0c@}cp@- 0@SM 0  ЍpP0`0 0 0 0` 0 Ѝp 0p@-PS@:pS ebP!p`C- `@V M pPᤐ0fU@@`V   0W nU sU  `V  0@00 Ѝ R@@@G- PMU# `pfSPU @ f P0 0nS sS UPUc 0 Ѝ 0S00("(ЍPA-P# P J00`pp0,SS00 0\,\@CW`P   p`p@ C-p M@`PWP(>pWX*nUO sUF fUH0D Y)RA @aPK H0D@ pH0@0 H0H0nUp@0 H P4 sUG fU? L00L0 Ѝ@P%  @AP80W D08 400 _ 0S0008  @H0R# ,0 0H00H0H0@ HH0@ 40 0{H0@04 H00sH04 0H040, R0 0fH00H0 h O-0@M0=`[  6Z p /p(080H0s_P; P0  `0/0 `) ἀ$[`   ` p`Z `   ` ` 0@ 0@Ѝ@-0 000 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\A-`p PPU@M"R& Z`P !0P ᴀ0V00  p   0 0 0ЍPЍ^ p|  O-`0@ 4M 0 1P p`pZ6 P !PC`0P  0O`pP|@P P(@@_P` 4Ѝ /` `0, Y 0(0$0,0& PP@,p , PAR   0S00SPu Y  T㼂 P" ` L@PXH @ D L F ,p P$fU8   0 P+ X9  BHDXDnUDH sU  "0 S   ,@  P5` 4Ѝ  B P$%`$(E$E@Rp T A-Pp ``V@M(R, )_P$ A0` ඀n000 Pe00 0] 0 0 0ЍPЍ]@-0P pW@` MR ^P 0 `3 00P 00 0 ЍP ЍW]0O-LM< <*, 0 $0`P |@P0|0PP* 00|zPzT P)P:PyPI^P  P- U $0+T $0, PPG $0 P10#0 p(000K{e 0s 0P^ , P) 0S& ( .S  ROSF =``P#[@PZ `XEXu 0n P DDD0 0SP PC$0 ? 0S u0 @$000  00 n0 gPp^ j LЍ0TS$0   C0 400 S,0'Z8 ,\8 0S!/@0@SI hFhvP00$0 0f0 $PnWq ,pP@U 0 Up`e '\UQWW%P^UPg P@U 0 &0FS;{  0tP ,p80 EQE E/RVTSRQPONMLKJIHGFEDCBA@?>=<;:yl76ce3210/S-Q+*)_d` pPU@ U\%00P  @ P00@ %00    P`P pP`,?]8 <04 $nP@0f  P +P p P`       04 $9 ?U  #u 0 S00P{p0pP@`80 L0@\0 00 $04 W80S0P@ `UPPpP`O 0$0 000000 0s0P ,p:@hFhvnXEXu= @0n  8P% 0S00 #PhqPQTP P0 $Z0$ ,p|P00E vPXEXu0k 0@s 0 P0P'0 $zP] LЍ0$ m $g0`n0 $\p$< V p `KD̲ ܱ  p l  h P P/N$P00//@-M@)0 0!1l!1"b2cNL 0@@0$@B!A@C0tPЍ赁N g P0`0K?//@-M@0 F0 ClB N0"0L 2<@0$AB@C1dK:PЍkL@>$0P00?//@-M@0  0C@N $@L0B!b!bN?AA4 1c1cL0P0@$$C!d!b8A@C1PЍ-?L4/*Sp@-0P0M`2@P 0Ѝpj^, 0 0S Q20Ѝp$G-1!0  aP P@4 04 S0p0p2,0PP0  |Qp`  WPeȄpEQ  W| 0 ȇ0H00`@-@P [[[ [$[,[[,00!R  ! 001/Ἕ001P//ᤝT @- M`p P0P0@0Ps P 0jP Ѝ 0@P ЍtC-@P,MA!n`Hp@\ yf"RDK8d$7$rQ>*:eRZ>t [~|iUD1Pot{Yo"SRQPOLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!   X" ;T<"!00,ЍPM P :0 00X0BP P. ~P d* 0X 0 0"P 0cP0z:0 00*X P 0cP090X 0 0"P(:<:"}Pi 0cP0Zh90X 0 0H"kP^ 0cP0K$ 0X"  YP@ cPc  (:VX`pF"(9" 0ƅPf9P* e0cP0d 0X" v DV0cP0080X 0"8"P D0cP070X 0"`8"P 20cP0 ʨ70X 0"8"P  cPpdX  0"P% 0cP0 70 00] P88<8X"h P 0cP060 00HX@ P 0cP03p60 003XW P 0cP0 60X 0"|6"P. 0cP050X 0"6"{P{ 0cP0ʘ50X 0"5"iP| 0cP0yT50X 0j"5"WP\ 0cP050 00X" EP q0cP040 00X" 3P _0cP0Sʈ40X 0A"4"!P M0cP0DD40xXB 0 P <0cP040X 0"(4"P *0cP030X 0"3"P' 0cP0|30X 0"3"P 0cP0830X 0t"P3"P 0cP0$20 00X"_ P 0cP0ʰ20 00X"H P] 0cP0Pl20U 0 01X"= P 0cP020X 0"<2"}P 0cP010X 0"1"kPD 0cP0Dʔ10X 05"1"YP 0cP0P10X 0"L1"GP` s0cP0 10 00X" 5P a0cP0R00 00X" #P Ot< ܤ  `  ?L  L  l ( < 8 h  p Ȝ l  ě t L , 8 G 4 x  ̕  ( d H t    ܓ ē P ܒ x ̒ @ 4 0  ̑ 8 d , 8 ! @-DT ?0cP010 0 0@X P] 0cP0T10X 0"h1"P cP!AʜX  PW 0cP010X 0"1"tP 0cP0$ 0X"  bPq 0cP0h20 00X" PPk |0cP0ʬ20X 0"2">P j0cP020 00X" ,PW X d2X"6!00NH30P30 2X"$&!00>30 2X")"00130 3X"i "00$30[ H3X""0040 0nX!00L40T40[ P33X"I"004044040 4X"8"0040*40]40 d4X"5!0050'50 4X"!00H50P50J 4X"9"0050+50 05X"!005050) x5X"_s!0050Q 5X"f"00~(60z0608 0ϊX"P!00ht60 06X"'C"00[6060᱊X2!00J60 0ដXJ!007ᓊXS!00, 7" 0PX"00 0tX!00 7070 7X"["0080M 7X"(!00080880a@80HIP" @8X"k!0080]"00!00"00{PԘԈ1!( !00"0090"00!00!00z"00u"00p"00k"00f"00~a"00y\!00tЉS!00k@(Z B`{P  L:9@P 0RsP p:"0S:2!00J0SX *!00B0Sz "!00:0S{ !0020S| !00*0S} !00"0SD !000S !000S= "00 0S !000S "000S !000SN !000S !00PS 0S !000S "000S !000Sb !000Sl !000S "000S !000S# !000S |!000S t!000SW l!000S d!00|0S \!00t0S T"00l0SW L"00d0S  D!00\0S <!00T0Sk 4!00LH& c@60N)"00A$"00<"007"002"00-"00( "00#"00"00"00"00x 0rP <5"m 0qP"5" 5 0 04 @@0 140 040 0l4 @@h0 u84L0 0l{4,0 0cz3 0 0Zy30 0Qx30 0H3 @@0 ;P3|00 2e!00}3L0 0%2 @@z0 g20 020 0|20 0X20 042|0 022\0 0g1<0 0 !00#10 0210 0gl1 @@0 81 @@ 0 %1h0 0\0H0 00(0 000 0t00 0{PP00 0r',00 0i^h t , D ܊ Ȋ  Љ 8 H ؈ T h ؇ T P T H ȇ  Ԇ | ̆ H A-t ANL\0@Po>\DQ; 00P \QHTL a`0 0 0:46 0b0#6(7(0a`  0 A03\ \ ANN1 0QU^ /|2G-0@P Q0>A L `@/ƌ@0pG/p0PϠ B`@T 0 P\^\4 0C@PU 0. ^\!B\A ! QK%RL:     b3Ό2@XX 0勅 0,}P t` 0q 0}P tP`P@P056Q 0t 0W 0` 0Yn?P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BT@! $V @D 8,0400G0, 0 40@( (8/P840,0S00 40Q 0 @-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0000CS 0S H=006c@ Q,=00 C0 0,0pS P<`@@e0S 0,SV [ 0PC0000 00 0 0 0 0#1^@0Q 38R0 4 RR  4,00 PUSY,, < 0 40 30O <Ѝ(0 S0(0@I; 03C`;0U 0PEd@T0S` ;0  R S R PQ0 P 0BS  0 0C R 10Uk 0PEd@T00  BR00S  7P 0 S0f8&#4<f4#R  \:00P:0 00 80B4 R,5@0 000 000 DQ1  P !ADL B \000D0S909 UR000 0pP <`@@n0*pS0 ʈ  P<`@@ ;TUS 0PEd@00 S  SL S5 8a@D00@T6c0PEd@T ULQl80 R H0A S00 CR*ʈ+R~ D800$80LQcD0ʈ;80\0T U 0PEd@00SQʈ@6c@D 700 $ R40,0000 700gUw  PEd@T  [ !RX 70Uf 0PEd@T:ʈH ;0 H @D;6aUR 0PEd@T:0ʈD+1 0D0@D6a+D`60[{ U1 0[![4 0 0C 00  00D0 PE 0CD0 p0Dld0h \ X 0!PU 0PEd@0S^6c@D0l0\ 04 R! / Rf<500 Q 0SU 0PEd@T6 0V3 400400 C`l P[T U 0PEd@00Rl @Da0C T R=0 U 0PEd@T40F?o20$0S0h $3$&$B0#22cR]0S 30T0PEd@TU|Tj0PEd@TdUp  0t$ R R& D U1![ $Q P LQ0Q 0 ! B00  0D PE B pD R=0 D l" 0$ R D D" C$ R$," 0+0;6cD@D10 R   B0 D  010$0S  &$   0K` `@U 0PEd@T$0D`S` 0-0`@+U G$ 0R $P (D R2D507S U     0d 0S PE p0004(| =?>?N?P?5? y M?dy Q?H?A?L?w J?Lv t C?ls s L Bp 9?:?;?0@\,( @Dʈ+6nM2a@D0 D0B$0S`0  0`(3@0W43&8#[ D30L3HL0  h300@S|3D0z `o0aS 0X00\03@D0P0;T0300 C3a@D06c0D@C c P8l01r0ರ^l[PEd@[UsR!B"0$ 8 S0l00X0S>0p0P0?0X00 p0toP 40s0 (CL @n 850c@ 0`0P50G 00`_t50R|5l 0Y[qPEd@[kU 0C00Sq 0 000 (1 T*U $((U_ PEd1岐@^ $( 6cQ0D6kD @C6c0D@CaC6L0$ R&400  0s@ 7`0> 0cV`0@+KP6c@D\ 0ಷ@D&a@`7l000p 0 0P0<`@@0 $(C 0X0S>0p0P0 Xtp0(0$P$(0/ @80( &b0R0S(0l8@D0hSR: @3 0@l0$8@0@80t 0c \ p T d \ h WP ,90B0 `C40SP90*p@-@LPP80S ($03/$0(3/00pPA-@`4PP@p0 QR 408 B~4 08@xV000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000P@P`P-@ R2Q <001 0 0S!B<@0 RD R  0cPࠓ^ S R5 0 1 Ra @ <00 R1@ 0 <l0P\p\ G R R0c BP  R S R 00S  0S  pl0Sp0p0Cpp0+x0 00 0DP,040p0 x0 0 0 30 Ѝ0l0S  pl0@@@ g|S???$P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-PXPZP 0|!(`3/@PW 8pW8  ( 0(3/pPH 8 )$!%P S>0R:oRS B P T  B T p W0Bp$  (08#8p@p  BS>00p08 ` P S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰX 0C0 0$SQ $Cp0`0 sRpW-0 p  p0 Ѝ0` R`V40sDJB 0|=J^S30 b6 08#8^0X 0 C∀0S 0SCXP! P( 0 ! 1T2 0! T 0SЍ0W0T0S Ѝ0D?o 240%R00S020,0@0000,004@0D?o280(000 0 0 0C$0PU?PU@PUAP0UAPR@oPP 0CX2p0;(8ӗ1Ӆ1&=tPxl0fPPENAxtP N0NPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPP`l h\0S8 B0l0\000S mMP`-0S P(p00F S$0`0!h0S:l R1#P0 6SM \0P8 Bl0\00PЍl08  : RƃPƃPƃ !hP\0P8 BWl0\000SЍ}O-pj P,MXt \l@80H00XT 1#D04 @  QH0@ ,0 DA?C0CR`Pƙ Yp0&0D8#( ƙ#<0ƙ@30 B0(1I>RP30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80X`TptP` l H 06#0H0Xl \0P8 B l0\000S,Ѝ80&6&6 &!9096tl L Qtl \e 8t0 S` R S9 Sl@sX 2`o 0D 0 4 @0 0A$H0   @`@ Pl @!0P PH0P `   @P$ll R1#\ Q \P80 B0 Gl0\0w0P,Ѝ\P80 B0 4l0\0d00S,ЍwO- ,0PK[ M@!0 ДP0pUp/oX" Xp zpHor 030 #4 B %B B  0BVU2W0>&* Q!M:l`\A `Fp W P!P1UP! U:XUppU`10\ 8  \ 0PE0 000C00U00\   W 0 B0 0 PpU` ,8^v0 6Aฺ,0 l0&\0PpU`l0&R65V`    R\S#` Ѝ R R0 PR \:0S@\!v!w|U!1^  RX  `\h$X  `\h, Rl R O- M`0P 0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPH/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S>00000 S *S0SWq00Q 0SD0@S>P0 W0Ss S00W0 00#400 03 0  0#400  0 \0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000* R0f9S /0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E000S ! P B R  PE[ 0 X0 * PH p0 ,0 SR0 B00 0 0 0 0 0 S0 S00ӈ R01q 00 @ R}0ES IS= [S8 gS8 00S0CkWi D8 RC0SS@ S   00#  #800#"0    ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S,  Rg00 0 B000,0g  S  0Q0q0S 000#40m0q00Y0SZt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SWc :W㴖K 6SV \0l S 8 B0 l0\000SDI\ R8 C0 l0\000S7 xZt0(l 8`R B  ^C 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l S+t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [ KoP᫲[@ `P``0P0@&ƅ&0(!ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0800S=p#  #800#"0 00]eQB 00c*W6F &R< \ R80l0 C;0,0|h 0 00 0000 B 0L0DC0C ᖸt0S*l0\06\0l S 8 B0 l0\000SD10,\ R80l0 C97531/-A-`pPTq@PG Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0 `\p# 0S%t l00\ R6S S L D0 BC 060@! Rpp@@p@-@/PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ ‚2)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOzv `fp00$0`(0 } Ѝ8 80  000&Q-M 0 0 AЍA-P?PUPb8 `9 0t!(3/@PU \!@. 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/ᘘ O-Q M R x 0 R 0#01,#0Pp4` 0  0 + P%*0 @)0 @$0 q0B0PQ1;`,:(9p'463041 R P%BQ` 01 0 0# Q#4,!!01\!#00#0#\#4!  01Q #0P%0%| 0S,!R4T0S@S QS,T%@$@N%, AS,D$ S$, AS,D$ S$, AS,D$ ^$,00B00 R  0 0#01Y,# ЍP0#20CS!B1Ppu` Ж x L  D C-PRp ` P  0!\0 0#@B .P@18R0  C @$'蘔 C-PRp ` P  0!\0 0#@B .P@18R0  C @$'輓 @-@Plp`hPp@` 0!đQ0 0#B   @-@Plp`hPp@` 0!đQ0 0#B  X p@-P04`^00# @L P%!p G-Rx 'xh Q RO SRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#7&c2pG0N 1pW|GpG1^NNPV=F10C>@@P  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0@0C 00 pQ80'7b"c2pGNq&R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/ U/0S0`0//.< 1U36@-S k>@@0 #400k.06S0k. ς 1O- p:PTU0!`Q`+ṐY* V@ : U @0ς!\KU V*  p0Q=0^QQ [ 0O-0 0@ 00 0p刲0 S[Q 0嵟  !  W X SA  ׾ᨦ [㑢* & "& R\+ ೞLY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0P 00Q00S@\ R 802^02N00 R0@\<ЍW@  yP 01LX 1R 6 G2#6pP^p N  p=A-`@PT1R`QPE0+~PT S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O-` MV00R@ʀkf W !.⼠ᾐ5 i8R#8% P000P#406IP0cZ38#8V嫞⼠50aS)0P⸐0P%TPVAPeZ5) B("(Q1P8#8000P#406cR!0C 6V V0T@R p` PF_oRRPU RV0W RB+pᰐgZ5P8#8000P#406pGp0cY38#8 WvAP78p#8k.00P0p#406VPcQ 0C6C0T@ Ѝ+}ⶐpi58Z#8PPI0 00#4 06P0cWs8#8 UVZ AU0pX%Xk.PPP0p#406VPcQ 0C6 0g0bQ^`徠἖0`j9Y8`J#8 0 00#4 0编0iQ8#8  R0἖`2006.01 P V+ B("(5VPk.0V0o B("(7k V0&0`8p#8;O-ʀ6knS㼖0M $P  #  # #  #  "A @b98 T#8@p000@p#406 B0c^8#80἖&R @ P$ pḀn98 Z#8 0N 00#4 060cX8#8qX tq@DH$Hph>W8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಐpi>8X#8000#406I0cWs8#8 0@弖^| `D B("(9@n8 T#8@@p000@p#406N0cR#8R0἖\ b98 ^#8 @Pk`0`00@#4PP0 B0`Q8#8 k0&Ѝ0἖10἖-` T H < 0 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&A-Pk΁@`&8#8 R   pp "$ &bS0  Bk>& 0  8#̠  4##<V0 0 ৩000*60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-k6 S#("(00@P P 0 #4@@06 c\  ("( 0Ck΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@PP@ @"$PP Ɓ0O-0 QR@ M, R 0p&]P+(+0N  q/ ! RH@P j   Q&Q3 "[r&k R0D 2 8#8000 #40&0bP8#8 Bk0&N.V }0G. 0S0 0xS0   0LSI>X&&&&0 Ѝ(  \ P+R +R ,RE R  Q ,^ R3 "&][Pj 0q ЍO R \3 "[kΆ 0("(1 Q8#8000#400aR#8#8 A+ QB Ƞ(,Ƞ!k>0#400a\38#8 A Ƞ,Ƞ18 Q#8k000#40缦0j\38#8 J Z㼦Y@ Ƞ,Ƞ!k>0#40缦0j\3! J`M⼦k> / ! Z! ! 缦jR!! J^ἦ    s Q3 "[6@!:!18#8x!28#8 ꨉ 0 :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  < 0S A-P p@0 C`0@N4TUT @<'P &/@- MP`p*@P @ P J4p + @P  Ѝ 0@0 Ѝ@ Ѝ0@+T  Ѝp@-P*@P @Ԧ@p 00p@-@t*0P 0æ000 00p@-MP``*@P @ @宦00 03p K+@Ѝp̫0@B+T ū@Ѝp0p@-S P@0 C`X0@3T 0 p&0P@p%yara0p@-S P@0 C`30@3T 0 pw&0P@p%tcid0S p@-`@0 CP0@d3T @bpp/0S p@-P@0 C`0@I3Tp;&(0P@@p/z%yara0S p@-P@0 C`0@%3Tp&(0P@p/V%tcid0@- M P@ ,3p  @P Ѝ0@ Ѝ0@ Ѝ00@- M P@ 3p < @P Ѝ0@ Ѝ0@ Ѝ0yara0@- M P@ 2p < n@P Ѝ0˪@ Ѝ0ƪ@ Ѝ0tcid- M} Ѝ- Mv Ѝtcidp@-@P%0PPptcidp@-@P%$0P p00ploobp@-P`w@P  0@$p@-@_@ @-@Y@& @-@S@> @-@M@Z @-@G@v @-@A@ @-@;@ @-@5@ @-@/@ @-@)@ @-@#@ @-@@ @-@@@-@@.@-@ @C@-@@S@-@@h@-@@v@-@@@-@@p@-P` @P  =0@<$pp@-P` @P  +0@*$pp@-P` @P  0@$pp@-P` @P  0@$pp@-P0`P @P  0@#pp@-P` @P  0@#pp@-P`n @P  0@#pp@-P`\ @P  0@#pp@-P`J @P  0@#pp@-P0`P6 @P  0@#pp@-P`< @P  0@#pp@-P`* @P  s0@r#pp@-P` @P  a0@`#pp@-P` @P  O0@N#pp@-P0`P @P  ;0@:#pp@-P` @P  )0@(#pp@-P` @P  0@#pp@-P` @P  0@#pp@-P` @P  0@"pp@-P0`P @P  0@"pp@-Pw@#(0P p<0P 0pgntsp@-P`@P  0@"pp@-P`@P  0@"pp@-`PB@X#<P pP U patadp@-P`v@P  0@"pp@-P`@P  o0@n"pA-P@#X0P p@%`P  P `'gntsp@-P@"(0P p0P 0pgntsp@-P`9@P  .0@-"pp@-P`-@P  0@"p@-@R 0@"p@-@ P"$0P p00ploobp@-P`@P   0@!pp@-P@P 1!0@!p@-@ @) @-@ @A @-@ @Y @-@ @u @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@} @ @-@w @ @-@q @% @-@k @4 @-@e @I @-@_ @^ @-@Y @n @-@S @ @-@M @ @-@G @ @-@A @ p@-P`@P  \ 0@W!pp@-P@P  0@G!pp@-P`@P  : 0@5!pp@-P@P u 0@%!pp@-P`@P   0@!pp@-P@P S 0@!pp@-P`@P  0@ pp@-P@P 1 0@ pp@-P0`Pm@P  0@ pp@-P0PZ@P  0@ pp@-P`I@P  0@ pp@-P8@P 0@ pp@-P`'@P  0@ pp@-P@P 0@w pp@-P`@P  j0@e pp@-P@P 0@U pp@-P`@P  H0@C pp@-P@P 0@3 pp@-P0`P@P  $0@ pp@-P0P@P ]0@ pp@-P`@P  0@p p@-P@P :0@pp@-P`@P  0@p p@-P~@P 0@pp@-P`m@P  0@p p@-P[@P 0@pp@-P`J@P  0@p p@-P8@P 0@pp@-P0`P%@P  r0@mpp@-P0P@P 0@[pp@-P`@P  N0@Ip p@-P@P 0@8pp@-P`@P  +0@&p p@-P@P e0@pp@-P`@P  0@p p@-P@P B0@pp@-P`@P  0@p p@-P@P 0@pp@-P0`Ps@P  0@pp@-P0P`@P 0@pp@-P{@X(0P p0P 0pgntsp@-P`@P  0@pp@-P@P 0@wpp@-P`w@P  k0@fpp@-Pg@P 0@Wpp@-`P(@<P pP U patadp@-P`#@P  20@-pp@-P`3@P   0@pp@-P@P [0@ pp@-P@P K0@pA-P@X0P Np `P  eP `#gntsp@-P@(0P p;0P 0pgntsp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@p@-@Q 0@@-@R |0@wp@-@0 P ""p@PPs#0S n#p⸘g#0@-$@@N#෗茺P 0R @-P Q 8o//P $0 t@-0 Pg p@-P Q @@ @0@ f0 n( (0( g0 ef P f T 0S p@-\@`@@ PPpP p@ = $A-P`p# @P  `P `pp"ₗP` " !" `!!HDp@-P @`sPpP p@@- h@P $ k0 0 0 lA-pP U@P"  X0 0 0 PD`P  ` P0 000 ,0< M@ c H/@-@P Ԝ@ e 0 0X c \}-A-M `V $P0 P$@PpP  0P$ ;ЍAЍ/ЍAЍ/ 0 0t jb Uܾ@-@P @  0 0X OLb $}p@-@P x0 0 0R0 P0P Q # p@ppp@-@P `0 0 0R P0P Q # p@pDP/0 0 0R /P/<0 0 0R0/P/// 0P @-od  QP  QQ #/@P/ 0 0 0R/@-@P \0 0 0R  &0P Q ^#00P/00 0 0RP///A-PPM /o00 0"P R Ѝ R0 p 0 p`P 0 S  R H  # pP` &   00$A-@PM 0 0 0R ЍQP 0 ] 0p`P 0S d P # pP` 000( (0( $0 HP] P; P -/o<0"0 0^ R  R/P/D0 0 0R /@-P {oxP/D0 0 0R /@-P doP /ol00 0"\ R RP Q F Q> / fP 40 0 0RP ,)/0fA-(0`SM.P@U Ѝ P0P pP 00  0rP* S'P0S0"Q00 @P X 0 0 0 @Ѝ( ZP  LP 00#0 0 P 0S S R/P/ R0/@- @ h̑@-0,MS-a @ S  P `T"` `cP |P ,ЍX  ,ЍD P ` 5"(0( (0 dX $@-@ⵔܪ@-(@@Kⳓ謪@- M`p@P0 P0P!s*0 00 Ѝ0"S@- M@pPٞ`0 `$qp 0 00 ЍĞ0"S 00 S 0 P :\03#/S 0 P \0///A-Pa`?@P (pP  &@P pW@, ,0, (0 Ȩ lU xM 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ xЍ00@- @PM  @ jЍ00@- @PM  @ \Ѝ0@-@P ,0 0 0Rd /P/0 0 0R / 00 !S R!* R0:/-  ^0 : 0P0*  R*/@@/ / P $0 0 0R //0P $0 0 0R //P $0 0 0R //P $0 0 0R //P/d0 0 0R / 0   \*S  0/S[ p,p0 S S0` ` S S/S >S S 0 S S0FU0 RsP0/S^ 0(00>Sa S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p0 0 * S =S`B`0"S0S   0"R R  "RC$ >R0 W0(00>S` 0  $ 0x> G-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R"@ tR Ѝ mR8 pR oR sR ;R'@ ;R<@ tR ;R>@P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮qvhg"R /R@S00S@Ѝ!1 0 =   0NPp 0 +("( RB*0 Re \Rb  uR^ 7PY +  PS6I %"". 0)" " <,  0   ,0     SPY$ Y  ͕)  )# < 0,!  Y*-"-  }  )&  u: ԞG-@`pp W W00 GR0SWL 0'<0W0PPF <W0@@j\r\\p 00 S S   CQ R<S+  P)   P#   P-0@S@S -S 0@@-S0>S @ 03@0S>S 0 @>SSS @@ @bP (0SP  R @ W' W0S@@k@qPV` 8P @P D -P0SМԜXĚBO-PMupt@PZ ,pPQ apQ 0G g``S`IP0!  z0P0u4  Y  p `PЍ |z0P0u  600 @0izpn`hAo/A-PP $P`p @@PP@@@P p40,p0P4080<0 ꜅@-@  kp@-(@@ QP|ݒڒ@-@f@cO-4@T p`, ǒP @@D¤@`T P礀Qㅑ@0@ @@0 PZ PZ P|2  @-R 0P< P 4Q ,  D D0D )0 , ,0, (0 P1 \1 8p@-@M4 00R0SP,0SER 1`V- P` 0 0P 40, 0C40P% I`ЍpS' RyuЍp 0 Z0D p p0p l0D \ \0\ c0D D D0D @0D {|0 X0 $y40 ̔0 liA-@`,pPP W 0 !᠏,P0`+,P0`C-`0@SPpMF  ]P00Ѝ!0 @P ,0SV !0 5P ,0S(0S00  0 P 0S?0S0"S 0:S 0 }R00 "R  0"S P  P @` 0 @P , ,0, (0\ ` P- D0p@-S `  Q P@0@p 0  0 4, P0S 40 00$ $0$ @-0 밯d, d 4 @-R 0, B4 P @@ @0@ <0 t, ,0, (0 k+ + hO-80M@ Ѝ@p`| PP @ ` @mЍȒ  APP0 004QY  4 R] ,剱1Qw  赐 P 0YIW  B B!w,0 P 04 `<0 04 <0 (P,UN<U8U+pY& 嘡 @p P  PP) f 0,S<SS> bPc @ ,0P`<04 0<0x<9 !w,0P YP V{,%x x0x t0F/d d0d W0,L L0L 0 |b{( $<2( \( p@-@PP0S L  Q <0 0 p@ 0  0K/a' t@p@-@P 0`0VPP p p0 0  0@S0<  0pPp( (0( $0K/2뜪 ,& O-0@SP MR z`G40SM x `P@9 ЍnP pP 00S 0q 2 00PX 0S. @0R* P# [` 4P 0P 0S 9P' X D` ЍORP 0  03/P  40R 1#PP 0 0U/d 00C 0P `O@zh h0h d0U/T T0T 0]/|먩4ih$ 48$ Ј$ d@-@[0,S<SS, 0  0 Pud# PG-U p`0VRV@P7 404 S ` ^ \S` D000,0 100,0$ 100, ,0P ?o  @ 2\0S0S P`P : ) '404 SS`  `D D0D @0c/0 000 ,0c/똥! tX!! x47G-PS @- Y`' T 1p 0R  X V 004 00R% NP E 0S 0 GRtd d0d `0i/0,S0 000 ,0F/` | 1D ܄ G-PP' 0 0R"p4`P 4 R @,0儡ᄑ1  ,04 儑@ 0T:804 80{`0P 4  Q@-P80080/dp@-@P^80080p@Wp@-@P 80 0R@ pPI4@Fpp@-@P \0 0R@ pP`400S@#:.p@꘡p@-@P!@pA-PP 0 0R4p` 40S @40S ,0 P@h `A-@P 0`0VpP0S {P @T @ @0@ 0]/@@T \`A-PP /o0`0"Q@@T @0R p H@P @T @ 0  0]/o똟 tx0P \@- ^ 400\@/ 0  0F/P؞d  0P o@-x@ T\ @\400\@/ 0  0F/'T X @-PP M @1 0R Ѝ`@;80  Ѝ@4 P 4 0Rp@ S*,P$0 B!s400C40<00<0  h h0h d0s/T T0T P0s/@ @0@ <0s/밝 4~ux ~vT t}w P/?o0 2 R0S/0@ S/(0P -?o82 ^0S 0 S\ /؛P/0 0@0R/ጛP/0 0@0R/` P -/o<0"0@0^ R  R/ /( A-`P @PpP (0Sp 0P  pA`h  `4Y4ooA-PP P`p @@P @@@P p<```( 0,p0P4080<0|@-@+ @(  @-R 0P< P 4Q ,  <0< <<0 ,0, ,,0 PnT nQn4 tnVPG-< Pp0`W=W@ 404 S P SP /000P,0 10,0$ 10P : 404 S P PSP@ @0@ 0( }( (0( 0( t jm @mlp@-@M400 S+RP, R7S 1CaV( P` 0 00P 400C40`ЍpR S j  Ѝpd d0d k0< 2L L0L |0< )4 404 l0<  Plk hkh (lkA-@`,pPP W 0 !J,P0`,P0`p@-00P4Q8 @Q u4 <0,04Q<0pPp 0 0P < jtjo@-P MU3 0`Sp@$  PU00 Ѝ 0 P ,0S @t 0 @P  Ѝ0]S$ $0$ 0` d$ Tj\iRp@-@P 0`0VPP p p0 0 0@S0<  0pPp( (0( $0 _0Dd Thhw0G-S@PK Tpu 40SF   P@g P P 00S 0>|P7 0 03/P0  40R 1#P' `P 00C 0_P  @ꀐ ) pG \ \0\ 0 8 808 0 @LB `f 8df40S 0C40/ 0  @-0  `gPf0p@-S `  Q P@0@p 0  0 , eeip@-@P 0`0VP0S R <0 0 p@D D0D @0 0 000 ,0 z뜀 d,e dewG-S *X@` V 0P 0R `00p |T` vV 0S  Gp@ @0@ <0F/980,S (edA-PP 0 0RF4pP 40S @,0a, 40a@T:8 408 /p~@-P80080p@-@P 80 0R@ pP0@p}p@-@P 80 0R@ pP4@p}p@-@P \0 0R@ pP`00S@#:p@T}p@-@P$@pp@-@P80080p@p@-@P8@@@pp@-@P 0 0RP`40S ,0AT p@p@ 0  0O/lP| ]`aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@h@<@D D0D @0S/.0 000 ,0S/%{ a_| a_p@-@P H0 0R@ pP`5 @/p|zA-@P1 0RP` 4P%80,0!qW&  P  1P ,0P < 0@ 40< AiAD D0D 0W/, ,0, (0W/z p_8^ Z^0P -?o82 ^0S 0 Sd/xp@-`P pP@bP (0S p@  y x0 //@-/LP0 p0 k0^ 4^O-IMP ; @T p `0 R 2/0#L\ P Y  9/0  p\PV @T!1 0 6003/Y@ 9/T KT T @T@" 000Q 1/0K' P70S+ 03/P. Y 9/K@T 0 0( 0 0 Iߍ 0 0( 0 0( Y 9/Z 0 03/X X0X 0( 0 ]d]( \\\ l\8\ @\ \ (\[h [[P0/O-@MM(p ~T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0=P 0 $ \00 Mߍ0 000 ,0H F R00p YY# 0/0/@-@@A-PPp`M2 0S/ O@0U  UP 0/P B 0CU/PU  U0 0 B/Q T!0C@T@!  >;@04D.0 0 0 S* ,Qp@  V 60P ( @.Pۍ)?00@ۍS0 p A `? H p  p 0P@ X p@-R 0@S PR :   Pp0P  , 0`0` `90 L0L L:0 808 8;0 wp0W @WTW WTW Wp@-@Q PPpQp@-0 MSP@`PA Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPU pp 0 +QQ Px, ,0, 0 UpU8UT LT 0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@ D DJ8R#0p@-S+@PPU Q PpQp<{Pp/tP PQ lP Qp@>c 0 Q0`  PIDQ0p@-SG@`PU Q Q DP<?Pp PU Q 3P QPU Q &P QpPQ P Q/P p@>  0 0| | GOcA-PP4 Qpp0` XpW*@P&  P <V`p p0 8/PXPU`<``Q# PDP P 0S #P P PP@ @ P P 0 gNgp@-P@PP c| P዁0@놁@p {z011/A-\@`pP \1S 0 €  P 1P1 `p P 0808 8A0 $0$ $B0 M MM M@-@^ P ^%QRS  T00NQRS"  TŒ 00 0 Z0 MLG-@R00QP(M P 0 ` p Pt p `š0T?o20S00(Ѝp`0 Lp@- @PM`00{0 0{0 0{0   Q Ѝp 0@-@P M0{ { {0     P  Ѝ0p@-@ P0Ml,`.4l4#0c{ "44 0[{ "44 0S{0   \ Ѝp 0@-P M0@<{0 |b" b! 1{ "440 *{0 ,   S Ѝ0p@-@PP`(M/ 0S, R00z$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0N P0V00(Ѝp@ R 0S V00 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@^} P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Px80 0 @  0""048# /UUUU3333  l&: S@-x R Sd0 X Sb0?0 r-w - 0!= S W 9SL @Sx00 r@-@w- 0h@  RD R9 Rx 0 r-w-! P6 P0 P& P x  00Rs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- - S0S t T A0a0-0O-1oApP@8 9pP8  jopP% 001o` 0@T yP0=S AP` AT BX ! |p o T|00cG-XX"X2XBM 0 P@DH L0TPi X`P ㌠吠唠嘠圠刀Vypm pp Oypb $P p[ X0p 0S0R0400408<@S'4''0x'o8180 00D000 @oC'T  #{0S bep@ y y W ЍoЍ @{0@ 0 x x x:::bd98O-p`M@uP-TPm +T@`0\ ?  0(v0 !v P p  !ʎ @00D \a0DSW0DA0DS70DURX : QP   S  R [{ "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0T W 0 p0@0` XR A B0A PR W p p88@ 0`W p p}ꙙ0@-BR"^L M @000 Ѝ0@F@Pz00TP Ѝ0]p@-BR"^p@2@Pz0T0PpO-p`M@tP-TPm +T@`0\ ?  0Qu0 Ju P p  !ʎ @00D \a0DSW0DA0DS70DURX : QP   S  R z "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0T W 0 p0@0` XR A B0A PR W p p88@ 0`W p p}ꙙ0@-BR"^L M @000 Ѝ0@F@Pz00TP Ѝ00Zp@-BR"^p@2@Pz0T0PpO-MHP@0@Q0@0BU PR"S0`8XP 00R B  P1Y O-8H0@p(,M@P R  ( @`Q t( h(hh  @0 DjPT0+0CP $@ p@ z 0  0 0J D@@Q0 Q?0 0X0-SQV|0 iP0-S`0!000 ,Ѝ,7,0 70Pt v` 70  `,Ѝ 0 @ @D@B@@0带 :Q` 0+@P +eP 0 WV :\ 0S0008Ɵ@ 0~ ~ -Q & % $ QL `=0dP0 AZ pP` P p 0PpU  ntPrP 2 y  Q Q 0PRUpZ p0Py  B` VwQ| $ R :R t X00 RP$ `0`0+ C% :S& V;\j R  ~X $ # R :R #0 0W 0 0+ C0:S0:` R :P  X 10H3H0   R   # R :R  "0?` FRQA 00 `S``P0S  ,Ѝ p0Ph 0Lq 0#0" R :R 0 <0]0 0 ! R :R 0I0V ! R$  p! R :R x0. 0B 000 0 R  W0!0  R :R 0 00+ C@00@tW ` p 0 0D0G0L! LRLD(HM*t<)|KdDl@0J \H `G$ T 0E O-2夒0 \p`" P@T60ll R01-[@@P-T@PA T" RPP JcP? -@Cc0P  :R7 10 0S! 000PP@:T0S! 000|100S 0:S \ T0i?@0S01 0 0@P 0:S  W $ 00:R@ 0S  0;P00P0 0 Qh0h 0 L H xCh,B dBHAx\A [ֻ@-@-Q Q Q  Q010! 0 0 0 0 S r0! S L^ 0r0!# ^t00404 40 ntT00X, $t xG-P @p0#03w0q0W`@DT@!  o 0 0R ! 0 3P   GDt0@ pQPC-pp M P@P `P$ 0 @p0 PP V Ѝ^t00PYt0`PQt`Nt0P`HtPtl0 0 Xk B,-0   Xw dB,0/o" B0 B/o"; B0@-M 0@xAPЍ0 QQp@-@ 6e00QUPQ7ep )e00QUP"e00Q1R ! /A-pR P@a@T T 1 !03/pWG /p@-@PDT 0p@/pA-`Qp@P RqP 0开D00p 00$`,@(P0Rs00A-P`p@PB 0U0" V W- p`Pp`PqP, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`PZs00|dXp@-0`@1PSM ,0S $n$0S n pЍp0@-S @Rd0 P @0P 0 0001 1 00Eds 0 p@-0`@1PS ,0S m$0S m:Bppp@-@d00CS00 Pdp,P--M  mAЍ Ѝ/ -- M0 0@ ЍЍ/0@-0P$M R P0@S&  S$tm0  B!  0 $Ѝ00bm L000 0 PS@$  D@XM+P 4000S$/00//lhP4A-dd 8MP4`P. <<  Q S  @2 hmpU 0 0 40 30.8Ѝ @mUp  jh@p@ pW \oPX 0 L  @2lp(@p@;L*:)t)D- M ЍC-p`D!D1 !M0M40<80$1 pP4>v@P 0 0 <8 303!ݍЍ0 q  0 @p_PP@T Cnt` 0 P8TvPnP @T@52\99<C-!1 0!MM0<800 Q P00400 x1@`uP@p4 D1pu P4000 $ ( ,  0 0 ppPP"@T Cnؐ` 0 P8TuPnP @T@0S  d L0 0 <8 30 !ݍЍ800($74 6O-ğFM M 瘤dčĝZp@TX (` 0F0;d 0P0S  0F'PU 0 P(00S`P $bPu]Pp$Ug ,TPg(,mSP $zU ,v >Z "2 0 d4 30Fލ Ѝl 0P1`LmP mP9 / sP @@U  `>`W< WH 0!0 0  `G1 0 Ptt0$0SP / rh-0ݹP ZPh 1 S S   #@ |# S`  000 S ST S0 R R R R B RQ@  BQRS 0S1 @+S7 -S[QUp @Us0S 0S 0 0_o0p`R0+S4 -SF iPPUpw[ WPW% Pp S 0QUp @U40Sa QT 0 s0_o00p+SR0S @S#0 `PP Z_opR0S @S&0 LPP` E_opR <_op`RU3 0 0 2 30ߍ_iPPpPp py S!@=r n _ %%TD"R O-llŸpd2 MM0ȍP`&N 0AM.0; PY \V @ +b+U  0  0  0P@ @@P3H0: S4 d10@\! 6 %  pmvmzNS <@ @&`(aKi @$@dIcKL%fc .al0$e;a 0#0c=f;h.d f,``l̠j`荠fpeˌa{'D #n e 8` m3df` piHpp,c{d p' p8@}n{ @n+)Pl .nc+g fi`k@$X Pm$&-3 `+k[%P@ +.B #Bj'Bc+00@m46K=lKY30i[i;d 0h!+@k@0@lˀ. `PD *`ˌ ꭠg )n @ mČƌ͌3kˌf+" d,mČƌh+͌03hˌe;# 0͠T0fˌ+>C3C7Cg;p隠3gPa"j{ a(f `H hkekb,b(e P]@a[l&al( h4bf%bf! lLe+( e+"+I 啓I 嫗Ib< l`` +LLd pL dˌp' p g|nˇ\pb)f+ *h! pf{h,Ld8p`K`nkpꩠgi `lɠleˌa{" pea{'p0P @g}h{ $bK,@Ph[bK$@f `dID`aKl['P`akl[%P`e]b[gk$`bgk&`8 klkd% l+d!ad ge&  g+e)雠` di+( X%p Tg+pf+! gzk{df+" gh@+NDCD4GDkK,+J͠ᕣJ`ˌ᫧J` . n`b*Le+aK)@e aK$ @P(MXfKi "fi h`0a a;Xld@P`kb$b!ai4(0ad )l0ibb+D0l[i;(06P0n`! +뽠daK) @$@L dJ`Ki+d+(, < R0 00//@-M Pp @*U`P`W0D>S 0!3100 0UЍ>SD 0!3100W00W00/-p@-M7P@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( <x@-=Q@B 8XA^^14/.-,+*)('&%$#" R@"    +S@ -S =S  +AR@@@-R@  ++   @      0RuS/WS^0@-X0CSMF <0 à 0R ^ @@PSPQP@^  0  0 uS0WS+S -S00T0 0 +S -S/0 0 I@O-0wSpLM 08@ (P(0,000409 10 0V @ NV@TnL7 `0p00000  0a0GS^) $00+W@ 0-S4=W000 0P @X B R f ^XS  "=W  R!   P:0$`2V @ vN*V R$ "@`0   ~ Y 0 S:$`Vp@ UN V0S$ 0"0C`ኡ0X  X   pW ,WwpPXS  Z0$`U P $)NU R$ "@`0   1 =Wr +0G?oY20S ZlX 00 00X00 Z$`UP MU0Sl$0 ""@` 傡 0T 000 ) HR;%I?#I0!0 HR<IU0 @ƺ0@0S:wU0"SW  T4* 0 SA*"-+ @ LЍ'pC=W   00$`QUP $MIU0S  $0""@ `Ⴁ|!!!0C!0T!"@0$AO#`0/0(0 0,002#Ă0! 0mP!T! 0!T$/ !.P !P A00410`00Pd000@tPd00 $L  R$@8ਁ4(0AP`0 0A,0儀H P0x 0 P0P0P.. - GzGԶQ(\)\И+ d+ 8SQ4̠O-p 0࡟MW:Pn @T) QT/ T P" 0 ^_ S^ЍP@T T T@@TBp^ pQTp0 p0@`PV@@@@ @& @V @Pp0 VpP@0`V 0 SV0Sp#P0W p 0`@(pV*?[!]-SE@-0M0M040K00S0 0@ $03/L D0 0 4 30ۍЍP@T>HG-`@``a V00 "5FPP6 pP@ 0S? 0p R0CÐ@>P0 T  00S0 0  0  ! Y*o`@TspP Y  !OO00O-ddş MMMčHş尰 TDp`$0OT%*0U@@ R R 40B?o2 00⃰0S U0 S0E0 &0Sw0000Sfd0+0E 0@ 03/0S| 0@4$ 0000,00F$0(@03/P   0S00*  0.S @ T0S0V:0S 0S  ,P8 * R YP $0DQ/ 310 D1 0 (0P00 0S  0P80: S 0" $2 MލЍ0S} 0   000S0z P@T  00S0gO04/P 0 0]Ef00m0   0C x 0.Su0S` 0.So\ Ru  @$ 03/0  00.SI X P 0 D;P8 @)  2/0 C 0@ 03/N0Sw 0 eBQN0/ 0 @0 03/0BB0 *0oPHO-pXXŸ KMMčؔܤ\0 /\@ @`P\/\P  `W!1 0 4 30cKލЍV4/\ W/  0/\W@P P`P 0   R  = T/R  * R& R 0 0 0  0, R @  (03/0S0: SW/0 0ā āQ0M/0 `0`ꌫO-@ş5M$M 00000~S`P <   pH 0/SS;R 0B0 4ZS 0H*0; P4S 0 0CPR IR*0S0;R 0X @H p S    ᬓ嬣嬳*S1 00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QT Რ@  P+@PW |"h2 0 0 30ۍ$Ѝ@\0 D Sn 0]S2!^0100]S  000-S]Q 0]S  0@< 0|10s  0BW 0R S0BW 0R S@b 0 Qy  001A0 8Y0  p:>0P0H*0 ;P 0[0!^0  @'Q@f@d?**[!-]$#"M = -A=9Rp㴀Y WꘀqvK SБp0X{FH 0hth,[[PgXgg}iflff0O-,,% BMM $ %u  %p 000 0000+ 0ϑP 40 4D.P P@\ cP 0S l400#S \ TP 0S 444d0``\ EP 0S 4d0``\ 6P 0S 30   \ '0P 0S d30\ 0P 0S d`30X3PE0 +:@3@0 0P`\ @P 0S >?PP[[ AP200xS0xS0Se "P2 0 4 30BލЍlR@P\ Pq 0S @200#SF \ P 0S 2R0P\ PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ 0P 0S !dH10\ x0P 0S d10 ! 10P 0 $Ȑ0000 0000@P갅TfXT X0p@-\PP 4P p<`<`P@pPQ^$`x>@-@@P00PO-,S$M M @p60P`U 0C   500 0?SN Sl *S 00 *Q @R50*QLU 00  *QA[SU \S0  0 @ Q8 $Ѝ?[ [2 *[ @[[ \[0S @@0S /Sy .Syw 0W r 0W/So.Z^ Q /Q 0pP  /P P$ЍQ /QU 300000  ^[![00 0 00 @ pp /S \S? S -RF P0 U@ ᱠ0]S^0 p Sv tj p, 0Wl  0W/Sfdp @^U/X2000 /WU0@  0U ᾠ]QQ \Q  @P PӥU@  Q$ @@  0\ @ 8!  p[Q @ P0 @0 C0 0p`@0U0  Z 0 P/ZY  / /Q /Qk 0000D}T@0lP@-@ P TA 0 Q 4Qg?o2cWWp@-@lPw>P Xq>P T00pT 00p"A 0 pWpWO-0p M @zp` P |z10230Y ߍPT 0 [pI  P: [ ; 0` 0P rP) @@ 0  Ep@ 0 *P0P S P ; ">0 "C 0 %p@@ -RuuO-0p M @p` P 10230Y ߍ葽PT 0 pI  ㅽP: [ ; 0` 0P P) @@ 0  p@ 0 P0P S P ; ">0 "C 0 p@"@ -RssO-0p M @jp` P rp10230Y ߍ PT 0 KpI  P: [ ; 0` 0P hP) @@ 0  5p@ 0 P0P S P : ">0 "C 0 p@? -Rqlqp@-T@0`P@ e0P0S SP p p@-T@0`P@ 0P0S SzP p8 p@-T@0`P@ =0P0S SaP p 0 00 n-H- M 0 S 0  00\100M 0 R0    R z8 00 0 0 30KH Ѝ/dnm-H- M 0 S 0  00\100M 0 R0    R  L8 00 0 0 30KH Ѝ/xml -- M0 0(--M  --M  A-`hpQpP @Q +PD@(0 0000A^0  0 A0S0* R0 :R|R\F\@ D  4 P Pw;PmX00X0᩽: P % X00X0P  mp<E0 @ (0bp0 00Zpl5 0, ` PpL5 04 @E @ HP!$A 50 c 4p0$ ,00 D@ 80$p8404 0< p40  ph40\  pD408  p 40  p30P  p30T  p30 p*`3C00 2#8"0t3@00 2#(\3& 00a#(2D3* 00@#(2,3. 00p#(332 0 00 `,  R D< 0q[@C   1-)%!p     ~p  ( wp    R   $kp 9D0  ^p  D  YPSDx0@1q00p`I2#8ẘ"0\p  !@<p0@0@5T0dAd1@ 00WL!x0 0 40 30<Ѝ  p  1!0 :PX00X0kBBTBKK0KKApG|A?KHHHpH WF=<WEVeD<Ep@-@P> 0S0 O70@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!T0h0p\@@PT 0708@@0/S(@@ @@<;!;!!4A-M@P6Pq0PpC D!0C `0 00   ! 0b0C S0;.-,+0)('0%,`<0 ⺈0pS@ 0S 0S;0"S $7# Ѝ T1r0:;00Ѝ?0#ό Ό C+ C+0c̠0: /07 Ϡ? 0S! Q/o/o @bPG-?b P) P @pBb&`b4')3V4( X4G1Y 010.? "1?1>( B24 5 /00@ Ϡ P! 0Soo C-@@a5T?a"6T3 7T `a2V7pX F3Q g>>> 36 / "A11 A>+@A4+a21/4 6:  / 0Q!*?B0CS?S3S4 cC0 0c11/C.B0B#B# b0///0Q0@-#/A BR?R0463R64b0A3QBA b3B ,00/A BR?RCA A2" #@A4#a01,000P-; S J?R$R b02!0 SJ?R  C" C0c0,PP `I@-900 :p@-P@` 5Ppp@-P@ 5Ppp@-P@`D 5Ppp@-@PP p?P :PppC-PMP`V ⟷@T |00>4Ѝp :  p@`$ ೿\P88| 00 R *7,@-b900 0S@(X70#/"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PBPX `3@ ]4PPY  @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍʷPP @@ @匷0(@$0ԷXHT$TSO-`ϟC 0C,0   /"b!!A0,0 W0 0000 0YWP 0  Q0( SP 0 00HWz 0@P(0PW%S(Pk6 ,0 6,/,0 v>C 0CWP0(Z 000"0W0QD6 0 0P( 0, ,04!/A!b!b0C P0( 4 0 B0 S8P(P1W*p 50 ,P(W0 00W =0 P( WTWp ;0 P 0 0p S0 (0W(Ph 0 P(]c0 , 0PS( 0$0?2c1, 11,0 020 0000 0 ,, ,0 0CP0(J 00000 3 ,, o,0 0CWP0(000c c0 ,^P([(P000yW0T 00. 0 FP(1 u  RO 0s! `p0@@v0 @`   ` @aKal B  0 B0 V PKUS ZSP  @ 0,"P ( 0$0 R0Y R0P ,P\  /#b!!0"A `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0,40 00N(00 S!0 @pA_Q"pG@D  W@ 0 40N Q @(0P 0(P00R)\P(\ ף  Ql'$I<,,+n) Q1(PP @ ACLC  \^JS S 00#3P0z z H/o"(PzXn|TQ(P7 pp@*CP(!B0pu10 B0,Pp> ( ' Pp!/"b!C;R, a2ba126MP P(P @ @0C2c2c2P$00( (0 00 @ 0 @Q ,0@0S} 00@y0S 0@r r,p0 0P P(00, 0C$0(^3000c^\0M0cP$`jP$`   0P  P(00 , 0Cq$00(06  p  0P( ,  #P ( (0 b$ 00 0M0Ѝ?A-x1@0QHPP P MM Q%L10 P1$8,p P@@ . R! v Pp `1U  Ѝ0 P0  P La@p ` U3T 0 ЍH -200( 8 $ *!!!x!gfff!D!|@-0M@ R0P 00Ѝ@-0M@a0P x00Ѝ@->P@lp@-0 00M0,00`P @  P00Q Q Q 2 0 l d0 0 ,0 300Ѝp <嬺 ,姺 墺}<<t,t,t,0@P/ P @/G-X# `p;-V@P0PES  R  D0PEV R  SS0@0D@R@- 0BAs @Q 0CR 1@O-` M$VP ? @%P>  $pP9 ,0p01S Y% Ѝ0$0P@$P 0 0P $0 0 ,=00 ,100%4:RQ@-M *@PЍTT 1@bЍ1 00O-xx ]MMō\\ P Kp `TpB @P;@`0 80xA|Aܱ8O80PTA>CZ/ sa$P 400@@P Ph T0 0 5 30 ]ލЍh100@c100Z8h8<l70   M Ѝ6--M  kЍ Ѝ/ -- M0 0 ЍЍ/O-R @p` M R00?oT"& 00P @ P 00 P! !  3d1XP5   VP W9 V[XP0Ppp`0 0`f`0` 0 00!" Ѝ`pP% PR0XP C0PP00 " ЍpP V ߭pP `d6\@-@ M!(0S2 0 `0( `1/qpPp0)  0 0 PUR <0PU! ЍPPTp 0S  0CP!q000Pp!@-P M!(0S: c0 "p0( p1/qp@`0/  0 0 @ToR <0@Toz!1`V ЍP@T` 0S  0C@o)0T00]!!000V!0 R/p@- @Tp0 Rp0 0R0 ု P 0S P0v 0c0(q 0P0 l0 Sg,P c4P _8P [p@XeEp@-@$PP'Jp@ |t@- @@J@D@p@-,PP K@p @-M 1!00P00S p  0 XRp p 0S= `@@ W8 CR81!0A0 S0Q\.*L\*\ ( L0 0QW   "Q @\ #R.SA a  00C "\ #R Ѝ`0@D04  R  *4 8/ 0X\S 040:8 R РS /\xB@-@`PLpL0ppD尀 T  7 w|ᤰ-,p @-P`@.0 Gp@-h ` \\\%p \!00p@P\ ckVmmsTICt70000E00pH00 Z00p#T00 0`0;T cQƟF @dQ 1^01 0SS100S0dQ U60100 T =Tr T 0@0060000  i 7@DLDL000B@00DQ00100C0y T T 00n 50000  J70D0 0]\ 0 0   ? 00D 009 004 00/00*cQPcdQ{B0@DLDL00D00<00D  0W0C3 X $=A-R@P 0`So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@!00@10 03/P(!p0 $@ ௮0V0 p00 R (㻨P00 0P3/P" Up   R  SVp 0S㷩P00 0U T `G-@P P+&`P (rp^u  0F0\c<!"#b!0CaqV; Y w(PpY` $00100S p e!`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(P`0003/P 0 p 0000SXP00}00/>3 tt\(=G-@P P%`P $rp ^t  0F0\c<!#b!b0CaqV; Y 'PpY` $00100S p  `1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(uP`0003/P 0 p 000$0S|P0 $0~008D0lhSR: G-P0`00Sp 3/0Y @IOP T 00 00 Y @IOP q T P00 D0D 0 p`P/ᨽtd(SR; G-P0`00Sp 3/00 Y @IP < T 00 00  Y @IP ) T P00 D0D 0 p` P$/ጼTDлO-PPM M Q@ \ /\C PyP$P8p/\ @ @. D\m `P /RR.\' B Rm/0  F0H$ P 0E P\pE 0: S 9S0/\0Sy@/\` FQ .PQX 0t/S0W0OʨP !廯P uO # \B  $+/\p@` @ᄨލ Ѝ.00X0/ލ Ѝ @( X 0/ ?   P@X(00 @(>00 @(?00 @(00 @(00(00p@-@P Q WPp`\PP0@P HP`V (0"S p(00p@p@-La P`M=  f#00QP0履P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P ͧ 800  L( 0 @P/:P-0SP S:R S 0@S0S S P:P@P :R0P:P 00/ᘵ0@-@A R R:\|\00\0S Q0A|R  :RRO-ǟM MtDčpĝ!^ $ 0 ^ |G@PU 0P0  pP 00S D  R&' Ừ0 00 J PK0B0P000x` @ Z0P@0 S [K :S`\ \S S S`0UD*Z0+ P 0@0 S[BV`P0#SS  [P500PS0O0SE0AU0:$0p%x5 0 D4 30Aݍ Ѝ:SV P0U:HեPPE" pP`PEV  00 0S gᚦ00@ =pP  x4@00PS0 00p4 p0040(0,= Pv :SL 0@S t40@0 0(<P<`4 pD pbPX pI  :S2 0S 0IK 00S:S:0 0pK0HW# 0 E 05   1 9 0PCUPp`.& 00C`R0@0B HPEJ@D:P P @ :00`0000 00,S p' 0pS p%0 SRF r&0@m&@00` `3@ӥ 0<40&!04P80 0 `6/p P 0S00S\S00 RAP, 0S7\S5 00S1 :S000 0 S4S[ A 00S :S|S@0@ A@B0S'h!81 0 8 30E ލ Ѝ   @P 00 C 10 Y P W@P @@PP P @ 00   0P 50 0Pp @mtxD ,(xXp@-L`@` 0PS 0 0 00p@   XA-P= fpP dǡ@P 0:SS  `d \S p+ Q0 @ 0:SS ^S0S:S 0Q0p @Ld@P{ 0`:SSd@0QLpA0]`0S:S 0C^7B Cp2RIFB?5/A)&"!0p 0 BW1 0 BR0 0 0 0~0|:0z0x@᧢`Pၣ 0np pvp# 00A-`= PP6 d@P8 0S:S  pd%0:SS   Q0@@@dpP pd@0 QCPAp@^pP8P P/P# 00p@-@# iP 00S 00XS  @<,00A ^aPAUA0AW0AS70ARppO- AM Mß3 00(0 00SJ @`pF0/44 PPN P40D 8T  0c#00CS3%10/.-x+*)(&%$#"! 㹩 㵩| ఩0:S 84Sr0#0S,#008"$2 0 (0 30| K P* 0B.KS:S00 B0$ 8T S%ȡ 440<4 0 S BKJ ; /0$ I 4$4I <4$0C 0$CPPB>K0C 04 8 0S:S X< H R0 0  Q!000M P@04@@0 n0:S " 00UOPAK0 S:S008$ 0S:S000 4<H0 00 -H-M0 S0 00 0 0 0@  00^100M 0 @R0    R L00 @ 00 0 0 30KH Ѝ/J4@-@0 @ @0d\O-@`,M$xxPWd20 R\ 00@`pR 0 @P Z p  P p J Y J PP0 S#: % U10 r 1$4S1$ !@00P P0S "<100S (!0 0 $0 306 ,Ѝ U r pP Р jP 5SX0(, VT00#    PP P0Sh|0hho ˠ@-(@M@@0?PЍ@-Q@0M 0    ",  0$0(0T P0 0# 00Ѝ w0Ѝ0-$M  00 0ħP$Ѝ0-$M  00 0崧P$Ѝ0 -M 00 0 壧Ѝ Ȩ Ϩ0Ǩ/C-@P sMX`0^ppAtAF0O₡ 0 00PP0PTA A\0 $ @4 (0 0 1 30sߍ׿L40   M ЍO-ϟ MÍ000PQpZ P   P0%%Z * 0S0 R ,/$? 0 3 30< ߍP0 P 0C PS !000C 0 `0zSN~|{oyxwvus1jh?*c_^\ `ZEU000 `0CP0PE 0SF0 0C0000 000Sw0  IY 񏐕r<P0 P 0P0CS0000 @ 0D SB*Lr? (0R0 (0 , 0C$00 40A@QPVo`^ 0 S0 00 Y8 @@0 {P 0C0@0@ @T  0SP 00 0@0 @0 0CP2 0S0 000$0 $0S0 =. #RR 0 @00T0C0 0 =. #RR 0000CT0 S`P P000, 0@C0 <9T@!r?(0@0@ + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0_000@T@09S XRZ    0 ( 0        00 0@0( 0CP000&     ( S@ @x& YʱY  P rP @0vP" HP 0 S0 0C0  S |P @00CS0D 0 S0  @$ 00S nP40SZ 40AQ0G 0Yc $ @00ESZ AP 0@0CS0O 0 S0 G @0ES$ PS|Z| R0/ 0@0CS0 0 S000K @+ D  @AQ X+ @  P 0@0CS0R000 0XO $ +D @@P 0 R0 @NT9 0Tb@@P9 0 R0 $ @XQ[@@P   R @0 00K ? 0r?(00Y D  ^ 00S0P0SY 00 0(0C@0@00<000jS0,` `01D0(0H@V< s P 0  B0=>J(  r0  $p P p "p =>3PSq $0S0000PS`F.P Z,`XT $0S0 00 00;0j0<00000:0^09000 b Lb ] pS dL  0    0 P P  +P  P0^Z``,40QZ`I` @0&0,(0( =>0#C0,`-QR ]QP @0J Q  ,` 000 0 tP 0 0C P0 SP 000;000;0000900000000l000090 00a0:0[00WqIT  ,@  BR 0 R0 @$P 0 R0k @X;"  R "  R1XX  P BR@ $.P$L 0 SI 0iT nT  , BR@ 0Z0K @ R񏐸D" AR>  @ BR  0X0@ NR-  @ BR  0X0\ $@(T  @ BR  0 R0 @)T  @ BR  0 R0 $J$0 S$@5*YY0$ 0(0@T 0V040 (@) Hb00`500S @0S/ 00 0;Zd P 0@0CS0| 0Y0  @d0SN}P 0Z 0atP 0 S 0 p00 00W 0*@ =. #RR @R  B   @ 009 @0=>03SS2 0@T0C0000@000& 0S5P @X A 00 000&P[ 0XX 0@*P? 0 S< 0@@Q= P1 0Y. 0@ 1PF 0 SC 0 0 (o ?o_T20S  00CS@0 0 S000 Pi 0 0H0 B=>  @Jr0 啚pP P p ܚP 0Y0C P 00S50@00CS0400 0S0  @0\,p `0$  , BR@ t 0 R0m&00 (@a00rP Z 0@00N,  ]R$ `Z Pp80$0 0 P80,  4`, rO<`T P$0 0P(0080<$p0PR 0 SO 0N'P 0X 0$@4P= 0X: 0@PE 0 SA$P P<P 0 S4$4I2P 0Y 0$ @0P0 0S- 0 @0I$P P P 0 S 0@X,` @ tTP 0 ST' @tZ ( S C@ SP 0 S 0 @000< 4P $RP @-P 0 S 0$@   ,$P*, [F 0S@!0@3ZO 0仜P@ P 00 0 {Z  ` `>0$0H00 Q PE A=>0 $ C 0rp/ P ZP@D7 0ST `Z   @DP0 T0C 0 p0SP Y ` 0@000 @(XZP@D`A-@P`p 0 0@ @-@`P MDp @0p0 000@  Ѝ 2p0A-} !P0@0S5  0`1S010f C000PP! pW@0P@ `PR 0 D00 @ C PC000 04  Q  Q*RQ( <00@8 BP0i /P00`0 CP + B ?#A 0#@ # B0 G C P@p@-@P0  "s0@1 p@- $ M0@4/@PЍ@Ѝ@-X0 T0M0$@ 4/@PЍ@Ѝ@-0M$̓0 $@ 4/@P Ѝ@ Ѝ@-@0\ \  M $, $@4/@P Ѝ@ Ѝ,@-0M$̓0 (@ 4/@P Ѝw@ Ѝ@-@0\ \  M $, (@4/@P ЍZ@ ЍP@-0M$̓0 4@ 4/@P Ѝ@@ Ѝ@-@0\ \  M $, 4@4/@P Ѝ#@ ЍtO-M@DX@`pP# 0SP 0$,  ;/0$ 0H@ 4/@PЍ@Ѝ$ @-$$@M Ѝ8@- $ M08@4/@PЍ@Ѝ@-X0 T0M0$8@ 4/@PЍ@Ѝ@-@`pPtt0l尀 ᑚT  ƭ@0 [6$ ~)(,0O-şM `@0  N 0P0 pP0ʿ00! B b09<Bp  UQPE @ 04BL3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b 尕P  00D0S0S0 S  \000!#300@ 00@00 @0`PUb*Ѝ@\ M00 rP-  R^^? @ 0 `0  oP 0J ZS0 0 0J ZS,1 0000 Ѝ0S0 P1 00000\  s  `\00 00 00C0S ``0\  a  `0\  b  `0\  t  `0\  n  `0\  v  `}0\  f  `v0\  r  `o0\  @`iqA- Q@Pp`! P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0 P0 A A-P@`ᗔPp .T Tp!0D1(0D,TS0 pAd_T %(0$"0@ !1 I68 O-ǟ UMLǟS @`|  sP0P0 rp0P0 [00 x190 H@ TU1 p00PU`p! X U0 1 #ᆔP00? PP P5%0 ^PU`p0pGGq WP1 P! D:`⨒pP- Ƞ  0S V D0 G0CSax1  * 50 0  Rx1  ' 40 0  Rx1 00x1 00x1 00x1 "00x1@\00x100Ox1 I` U $`xPUO 0p 9/P 00`}{y#3 0 L1 30Uߍ 0S IP/3#0 ]$P 1p3p#pz0 |]\ T 0 Dpk 8ar$001 0S 0S 0 fY `0$0C04@@P @0pB`PA80 `\0`.S0@D`H08< 0L R%0L R!8< \P@D V^0 0U :0Ѝ]0S \040. SЍp $p Ѝ O-,00$0pO-Q MP`0t@Py 0PS(,P| pP0UP1S Q3P`R 0P ,PU 0L0[j p PP Pp[! 0PH ,hP\07 , L0 PXU P0P[pXW P!0, @P 0, P 5 W < ЍP6U 20.@ 00 00TAp,00,0 0 , P P pdT\g0p@-SP %$L R,0@T@L0S@T @TP ,0 @p(0 p@  @T 0`ȌV K `A-@TZ P,,V5S S% R| `@`T} L0S 5S0S 4$0 V 0BSR@ @D 0R\ 5`V `傌V`05`D`V    ,`qV`P`,0  `+ P` `5 0V5$  0   0S00/,0 C /P00 \ -`SO`+L0s ,0 @L0SK 5_ ,0(NP(NA,0DPZ00\p ,0/P WP `U0` 0`$ `!@S ` Pf,0 cp(O 505X,0' $0S005` ,P 05(6,0  nP ,0<,0J0S ݓP ,0 ’p( 505ᖋ @@- 0(@Œ @  0%$0  0%$0ꐑ0 Xb `aR%/@-  0 A-L)P`p @,0 $5 S9 S@T @UT V,0`<,0L0`S00/S , @  00` Wpp@ 00]P]X_p@-t0t 0P@0S 0`00S p@@(݋(ڋ(؋( xA- 1 0 0PS`@(M @Ppp 00 @0= P& 00CS(  p0 0 0 4 5;1(Ѝ 0<080? " 0 (Ѝ0ꘟ|  0 00M 0ЍX0Q/0S/S/ZYO-p`M@ P-TPm +T@`0\ ?  00  P p  !ʎ @00D \a0DSW0DA0DS70DURX : QP   S  R  "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0T W 0 p0@0` XR A B0A PR W p p88@ 0`W p p}ꙙ0@-BR"^L M @000 Ѝ0@F@P\ 00TP Ѝ08p@-BR"^p@2@PH 0T0Pp@-@0LM`Pp@0 #P LЍ`0 "LЍC-1 0MM`00<0pP;x@P V h1 0S -P(1 F  ᱑P( 1R P$P uPP( 0 0 < 30)ލЍ0 娀R 0 P P0nS P0S  HF @P P P((9긨 P,xnfsXuniop@-`HPKp  @Pp 0@S @p`@-M @ᰑp 0: S  4p  ]Ѝ 00ЍO-3$M0P`0 J;#;$Spp{@00V00S00 e00 @ @ ` T  *P 0F @`  0  p P @D T*4 0Si @T0 U X*@0p    T1p [ 0Ḡ @ZTr/@Pr Xp#: 10 0'01[!  p000 0 S [  -P p0 0 S0S 0 [ P K`@0 P$0@$Ѝ0 <00 000S0[p0ՅP  0!X@pPq  p ꄗp@-P  @T @T0 0p O-@Q M0" `Ppb [ P5@1 P1 5*P  6/P  00Y[ @D:P PU Ѝ/O-RLM<nQ`* @<000$0@ a0P 0a V0P@0p000F< 0 0 `00p :/Pppp Xh*00 d P `RP(0`4``p,0 PV 8/P  W Z(,004`V1011p1*`G0p 3/P00X < 0G 0 X  pW: pW 0  X:p H(0:/P(0<0 0H00 p' RP0 S <0 `00 Vp P` `(p Dp000 SP C00P E \0#03\0S pQ ,0P4` 8 p :/ P0 0RP p`ppP :/ PpW  V p 0S$0 S 0p  BY 0Y30I 0 00L W 00 0 SW1: ,0P4`8R $0S0] AR0pB00^ `<0 S< ᗆLЍ 0 <<0 0 <UT `0F0W 0 Z 0   S`V0Y 0I 0CY0003  0 W R0B0C0000(0U 00(0 0 pPS PPp @pp`P @P Y@?p :/ P` @PT00p0 p5p1 *`Pp :/ PpT:P p 0S$0(S 0B  BY0Y030I p0@R0 0' 0P @pCY p 0:/ P0000Y`pIQ'p :/ PP`Y0p0Y0I0CY0003 p0R 0 0 S]*$Q\ 0L0CL 0A\ 0L0 00D `Dp@ 0 S 0`W00PIW8PdP `D  RPU @ M00-0 M0 Ѝp@- P@U 00S  RQ QpׂP ! 0P 0ppH0H 000S@-@(0(@4xp@- @MT TPT @TЍp0 Q 0QP ``0`P 0 RЍppC-M@P``0S$0090 0 P( p$ PQ# 0 00CR 0 U S R 0S$0Ѝp"00`$0P0P 000S@-@([0(@TxA-`P@p 䀟0 00S (>P   (20Sp qP   0S P(0SPppx 00@-M!@ P 0塅p @Ѝ0@0 SPX0P @-DQ4  Xoh0P@-X  S H@ @0( (@ ꌃli\inDil0R0 @-\@0@ PQ 000^ N/T0@-@H001UP0P  0!0hh0@-@D001UP0P  0!0hh0h0@-@LUPQP   00!0hg0@-@D001UP0P  0!0ghg000/$/$000/$00 0/$0P /0-@PQ@0/0P /0P /000S 0 00 9/`-  0  ^^$  00D$$mNA$l$ A- p`W'0 FP@Ï@hC12c` P@ R0d0d 00 1HP@@T0`10 P#0$_ N##p@-HP@P ⌃0S,000@ p@  "#\"G-xx p P@`o `FR0A0A10 0T<T10 0!p 0 M?TTT&?  0p0@p0 0@\  B0B10< @` | ,""h"!!4!! G-@0`萟#䀟 P #Qp PFR0A0A10  00 0UPQ@pG@P H0&&```8800A @Ԃx !d  \ @-(@@ @Ă0@ῂp@'O-p`P& 0Q@@PppW@Q0Jh `X  80PX@aa凂(OÂ(0pG.wZ_TaB L e000 D.@-,@@0@P0S@8$G-`@P@_}P(p 0@aaB0O~00ZO.TTaXPB(0( $0 0 hbya0p@-05S PଂP0SZ sX@ 0CR\p@T P UP@|a$#8/0$0! 0/p@-$P@P $P p@p@-@M P$`0.'wP  rP DDtN00S 3/Ѝp003/\ TcA-$P0@MSp p0(`0 0@0p$p<Pp0(04,00S 3/@Ѝ %00,0(p03/pP 0S /A-M $P@0P 00 `pP zЍ00pO-d`yM(p`8,PP } 1@Po 2 820 RF 10!$@ !  00Ⲉ0 4L  00 0. $(p,`Z PP 80 03/``~P"   !0 0 1 302yߍ         eP P||d``de-udu P{,{`0t| _< T_ 0_P00/ @- 0UM 0H`0L10㵟p! 0H1s@pP0P`p  S 0$< ,0 0 L1 30Uߍ-r@rp@-MP@[`P`Ѝp ]P S[P  N[P 00 0  PqXO-@P(p,S[P/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV }P``4d@P V@0SZ V@00T D\G-`R p@P8/PP @VG-!1 0M@Q000`PQ UI U v.00P!1 0 0 30ZЍ0) p00P 00 S00 0PP  0PP  0PS>Up!0T  P1p0 pPp Pp 0 @Pb0 00݆P o`o/ B/0  Q B  /0 R % B   %3 %//Q0 / 0R ,` , `! B  // R 0  B-  ` .$`$"  /0S :p@-@P0C0 % 00 0p/0p@-S@ :P0C0  00 0pp0S Pb"! b, @-@M0C0 u 00 0Ѝ/0S/ p@- PM0C@`0\ 0b"!4Pb4#0 PЍp0 $000  / 00$0|^`^p@-P@([P 0S S pp@[ZP p@ Zp@-P@[Pp> \[P  [P 0S SYP p@Yp0p@/p@-P@ZPp >p@4[ Z0@- MP@YP Ѝ0ZP 0S00 x[\0 00 S /p@-P@YPpZP YP  YP p@Y0S S  /0S0/ R R 0 /0 0 /0  0/ CR  0  0/ 00/ 00/ 00/0 / @-P/ 0SAS/0-$(0@# A  A A A0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030< TPE YPA Y0S !1 0 3 30<ߍ(#@- R R  R pP& R p   0S  % 0 0 4 p  0ƛTfeXQPO-ddğIM,M IM$J͍$@@Pp P0`S S  $3 I0$ 0 30Iݍ,Ѝ RJ- 岰RW# " "  J=00hc +4p# 4I8#8   KJ- 0S 0S> S" UV J=00 v J=00Xe O<  'TP #0Sx 0SG0S  0S0s S0S UVJ= 0  2b"!4b4#"R #< v<0I8 0J=00 0 P J- 0S.J=  0CS) S LJ͍0 @:01 00000G0 ,0jPP @(& 00SaLP P P J=00X0  SPjJ͍zPa ꥚d,0O-2M0pC P,0 0TP0  03/P 0P&< 00SS   &< 00< S Rd  0S 0Dp8pՔ&Vdh&hL QI$4@@H 0$0 C0TpP0  03/P PU U UX pt<0Se [( &< 00 Sf&< 00SDzwPP0K?o2X  RXKo᪢SH00S0D@@Z@0(C,0D\8 [^4 @0 C40P1 0P4000000"S? @%5 04 0 30nݍ<ЍT00H0Sn&< 00 Sp 0K'[SPV 0`FUd:00S4@N Xw HuP0px`0X0pP 0$0ptX; `p ``p0, 055U 0$ ( `  .P 0;0@#$$(0"(@0S S000 0StX[P ,0LE0S. /T00z[P [[[, ![ [DvPP'Ko᪢X00 S0K?o2'|30 00 RwtT00ND8Q (0D 0 ,0 sRCp.@%D0@.vR0@@T@S@@)0D 20 0=SPPC0  03/P; Z 00 S3 PD@ @%,0$RC.@&< 0 P !80%P v  {,(5$%0 5s 00S Sp SSP10 0LRPP0  ; PP qP  L0R4 t 4S Z 4S 00RP00S 0R $RZ $R 0)!KxK |<8HM\ h H0O-Pğ SMD`03qpP /qP  $0  08Y0p00S0  P{ 000 SPw @@PY 0  BPQsOs@l#d3 0 D1 30Sߍ0000R @T^ 0 .T0@T RDSS d! Sz*0 D DD@Q00 00000000 ;Pʖ0=S} R0SN SB SC 0S 0 %P0s[0Sb R00rr @S @Rd! S1*.T 0 Pk< D K0P9dC   DD@Q0000000  Q000S000.@DOoB0  P84R0T0 0 0s )R00  P#0S R000 PR000 DD@Q`wrR00 B@O-@X`PM @#  R[ pP 08X0\0`0d0h0l0p08000 00000XS< S5 S Q00QP( P& PЍ 0& 0$8<`\` 0 0x Px000 0000 d1SbЍ 0<`$ 0<`$ ppP X8 x4  0x!x T00(000  00R @# 0  P  0 `$; P!$08<080 (0P $q[0 RV딀bXid1 @SYtX@C 0@0S   HP @@`!1 0 0 30\Ѝ0 SRJ @PF  0 o`P 000S P`P@P 0q.qT  P X0 SR @P  0 8`P000S`` ᩐP{9H-09$P001\//8+$p@-@P@P ppTpO-P@Md  X/ x " 8 0 `P  0p X 0S0S " p 0 . "2 ߍ0S0SP;0S pW\>37 p p Q P  >00W  R  A/o"\  P  R R  . p P 0P R   L" l1,P0S$n0 RS S0 00 ZpP  <p00@(0$pW g972 G520W0 0S   S  R  R Q ^  ^  \/oQ" SS RT0S  0 PxQu x+0 0Sn QRj 0pS\ %0P,0V hP , 0 B  0P0pW ,00 X,@4B <AuP1x00x0 lp@pPPP @ `0V 00`zlT0`ulO-ttqLM @ p PP0 0I0PE ``0S S S T@9P `0S `(0( (`]P00 U `V X 00 ΋X``VU$@LЍT G-XM`@ኋP pP @;00  Q0 P 40S0- XЍ qP k7 0 wP k8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ0-   00#EgܺvT2A-`0!ᣁ000?0"@@h>VP0p: Q0hV@Hp` G0S@@:p`F Ap@-@P0M0` 0 00 !? 7R8 bx b  D 80 0 0 30X Ѝp@Hꍆ G-X"X2 0M000@2@"00P005  `p0\ @ 0 XS@@ ,B,R0C# T/ .0N ,B,R0.\'^V*00D!41 0 0 30DЍT  Aa  B8 LR\P 0FS0 S S X0n(."4n4#0RP0@^*0^0 8< 4^*0 8<- M\P Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp k(0!@$R0@0T$0B0S \@0S ( !0$ R0Dꍅ(  ` A-@8`4 rMX0P^ppAtAf0Of0 000TAΌ LcP" 0 nppP 0@dP d X0 0 1 30 rߍP e00@ 0P06 B 0   M Ѝh  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ p@- M@ Pt00h` 0`0 `P@@X@%0@'T  Ѝp ,@-TT1 0M` !000mp @P    mp tl@ 0 0 0 30*ЍflPpW @@T PU 0SP@>T00@500ꇄ i 0p@-P@0 0p0d(0Pd(P,Pd 0\0PP 0P 00,,oiP 00p\@ 0@-@ 0 0r 0 0 0 ! 0 00@- 0 MP @0d 00P 0 Y??o20c Ѝ02 00 0p@-@P 0U0 0pp@-@Pd0PPd(0Pd(P,PpG-P0Pm `^Pf 0@00 S S0 S S tMPU 008#<p48#8W 08 (p8@P 0q0p0S S S@ 0A S  A @P0 ! 0Sp q0000BcP  p bPp0@~@L`O-@ 0Pp M,0(S{: d(T_  \0 T0V 00SR 0 RL@D@T0`G 00SC000@D@D0`0S, T0X  0!0J@0`I 00S$0AS0020  v*0S000   e0S& 0p@c0ppc(0pc(p,p@ ЍbP  (,@(|0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0oP Ѝ0;p 0$  $ 0 . Ѝ0O-@XULMP$`0 @@dPF$`pPB 0 @@dP7$PPW* 0`Q QD QR Q& 0S:00Sz `Pb  `00"0 @p R  R/ RY R 0 @T:p b 0J[0H 0 LЍ   @QA@ 0S`:   (⼐p 0  ,  p0p 4`0W G`@ @T: 0yb00tb `^ \LQ  QA@ \Y ^ Q\ @  p, 0S QARU  R  PP@T( Q  A X " X. X4 p X@  P@T+:>X X X 0` `9p  ` g  Q@` `` X `p`Oa\{ aUjO-'Q Mqp POPh<k_ @00`0* $   $$Z0 X(0,3(``-P p`Z # 3X(00, "(`` -0P p`TQK`a!Q0#03U0S` Q:PQ Y7X ЍX030#1! 0 _a@ Ѝ000X; S`3 `#61S41`F2s2`Fs1`FPS0`Fh _0`F`4:0;`0Y S`3 `#61S41`F2s2`Fs1`FPS0`Fi @0`F`0809```u pC-`M0hp' @ip* P0u00 @0@,ht \0 0P Ѝpgihd00h\ / p@-\ ,@\ \ Q :\ :Ap:00p500C-P$0@SMJ 0( U4pȃ :`H;$963>0H G8ƌ<Π GpB71B- 0R  R  0000890L>1 0 00LЍ 00 !00 0 0@-S@ 3/@J`O-M@Y Qs` 0  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \ᧇ" 00\3 L0 1 00p0`0`Ff& G B$"HHࢆ(0F0C(6# B B("HA!0C0C1# B B%"AA!0 Ѝ ZTr `  O PJ 0 pD 0 J0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧇# 0Z Z Z 0 0 0 0 0  p 0`Z$Z7 Z3 Z5 0  p 0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[Pp`@p`D0|0x0t0l0h0dy7o l l Ep@-1!00 P@0 00D@1011.T 0@\0 S@ G P p0  00C1000L   00LDL k ʚ;j A-`MPpM&laapGQQNHH0   @ N 0Ѝ̔j Q@@-T4T$00 0`P@P @0C0APP@@ 0P@PP PpP p0C0qPPp@ 0P@PP  0PC0.S P000@000@ 0@E0C2S20/.-,+*)|'&%$n"! je \NJ2S2\0/.-,+*)Q'&%$L"! J< 1,*000 @ @  @0Bdn`QeEBdnnQph0000P R 0NQ00 H 0NP0000N00 P 9 O-``!80@@R@@ ǟ MM|čǟT ਴L<,406A[0P80 0 06,P0H0p000&6 0 @ P< 0hD0 0 ,vP?o4 2R0S <0`1  AD0PU 0P 0U V HaV/h0S ̥ 00U?p$5P00P 0UH W00刅?p|50= 0X& WP0 a@V00? )R 08p UpP  , rP* 8  +4 p0 4@ p04 p0xp4 p0Pj0S\P Z0P80[ 0 "#3 0 |4 30ݍЍ_3P `0_?0S 40ST<0`1   #/^`  aP#2 0 |4 308ݍЍO\p$P00!?0"( aU]" P "\` `T X@` `@F`DV?xT 04  S)D#$$ D(H"($H1 Y P` pI  I` T 0 T2L p 0I00  .I5* T@F 0 `DVX@P꘡ 0   wYx 0 o 0 iL1d`0`0 ppG  pG`T  0 d`P0L p 0J00  .J) Tʳr^  a`Ad{` < X\ $ <  T@ 0 $4 ||0`O-tM@@ `nVPPh0 P p 0' 0  0$`14 %S, %ἴ0 徤   (6< 0 V 1P80^6< 0B>PU  0R40008 _`1S   ;`1S0 0  0PJ0  0P7P  PP$0  0P0  0P0  0P0  0P0 0P`1SxYz < P0ppW  0R 0b_pW 0pW  0Rx 0O_pWf 0pWa  0R0 ,0<_pWGpWD 0 PS00 *_`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0~001p 0s001p 0h001p 0]xt1p 0S[t\L ^tЍ tЍ 0 10 ~0 w 0 p0 i 0b0 [x0 T H$  h ` `@@-@`00AMM0 400p00 8PP0S xD 80 0 4 30AލЍ.3:y<  0,@-@ M pp P8`PP 0S@   Ѝ00S.S 0S ЍLp@-|0|AMPt 0 ` $ 0 @P %8 00 0 4 30Aލpx  p@-P@Q`  @Q k[PV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `3W00 Ѝp@-@MP`0S 0 @S 0S@V00ЍpO00@0 P V00ЍpL0@- MP0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0 0hlp@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@  0@- MPr0@0@=@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@00 0Py Ѝ0t 8@d0@-@ M< T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@$T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP`d4 0@- MP@O@ P Ѝ0 0( 0P Ѝ0`0@- MPvh0h@0@B>@T  0U Ѝ0O,0@ 0P Ѝ0 8HMp@-@ML 0 Q0P0<00P@ ` 0. 0nT @D Y000T H0 0 <0 30 @Ѝp@Ѝ/.0 T/v  O-PM@PP pd``0 裟Q  ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0`a 0 T @ P  S#3@ P 0RQ  S # 3!# 0T4 0 T @  P  S#3@  P 0R \  S # 3 # 0T0 0N 0L0 000J 00  0;d O-Q0 dM R Č  $Ȍ (̌ 0 00pp< pp_p  XPc$Ѝ0C-@P@ `p MPOP @U WP@W  Ѝ @Pt0 0000 j0 P%!@b0S0Toᨂ#X  C-@P@ `p MPx@P @U VP@W  Ѝ @Pt0 0000 $0 P @0S0Toᨂ#@ t p@-@P800CS0 S  P `0 P/pjY`0 0CS0S P 0 /RY@-M@0  0000 !R !0@Ѝ@-0 S 0@Q0 R  004S f0@l@Q0R Q    R Q l Lp@-DPD0P`@0pp 00p@,X0 x L,p@-@ @ `@0Ppp0p@,  LA-DD p@0P`p0 A LC-P0 `0pMpp@ H 0D @ <8 }@Ѝ!3l LC-tPp0 `0p MFp@ ( 0  @ Ѝ2 L0 00/D L0 00/$ L 0 00M0Ѝ$ LA-TT p@P`Mp 0 Ѝ L0 00M0Ѝl LC-tPp0 `0p Mp@ ( 0  @ Ѝ28 LC-|Px0 `0pMp@ 4 00  @Ѝx2갿 L0@-P@000 00M 0 0iЍ0 Lp@-D0D 0@0pP p@TWN2pо L((  M  0 Ѝx L< R) p@-P`@V rP 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-M,`(@Pp 0a1PF0 R # P R8@  0  B0 00 ЍW Q ^.Q  Q. 0  .Q P P 00p@-P0@S` }0 0C0p 0 pO-Mp8`P@P*W2*00V-:Y `* 00 p pZ+ `P 0 P0 P 0F000000Ѝ`<0 PFЍ ` pDP<<A-PR@`p0ASAA0 0SA0q0@ <0 eP00`pԴO-ΟMM M $0>0l>͍0 @@8,0=͍p 000\0`@8<L@H 0 P, 0PS P0⯭40H0P 0 0A Pt0(0-0 H< 0.PPe00H= K$0 p0 D 00 00x0=<;:9876543210/.-,+*)('&%$#"!  P3 R 0S .S 0S 0S00S.SP080W$( 8d 0 P 0 P 0D 0 ScD0C7$.800440PI0000 0@ 0CS(00w0p` 5Z@$`p @D0  xP(0Ss,0 mP0 0`P6000#806, 000.0   .00Q $0 ADP0 0Y0D:0@ H;CH&6 0  0 30d ݍЍ6XW{6P0h5WP0e % dP0⯭40H00 0 PPo0 v0P(0e5000#80P0d寭40H0 0 0PO04 0<08 BPD0HK@0DW.P4@DKd 0 @ 0 P)4 0<8 B_P HK40PP_S0Pd 0 0p 0 P00d 0D  0 wP*.0d   0 hPp@WDK L Pc`0d 0 0y 0  RP0SD[ 3Xk  0 DPD{PUD  bp`0WE!@GQi ;"W@- P$ -0 PD8$ 2d 0 P3 0 PpP: -p PD[ad `0  0 PV-PD[0d   0 PD-1@d DK0 0 P`14 @0<8 BgP( 0D @PC 0 P`P0 0 d 4 ̳,0XH  ( ȫīlto8ܪ4`L( 4< ̚d*HHx0 ! P t  ====== @VUUU <,t\D(,(W2-0@00Td 00DK0 0v 0 OPPG@ $1 `PV8qVp# P@ 0 4P0U0 0 D+P00e0S0PEVڴ 0 P1d 0 5 0  P-q` 0 PPh 04@DK 0P\XT  0  PR 2PG0/ @0YD: T 0  P= 0 PC20+X W:B0@d 0 0 P 0 P" 0 d 0 P 0@T0DK*S `pPTDK 0d 0 0 0  P=+L0W 10"3$ 0;L0000;L020 20;L00030;L0#100;L0L100;L 0  aP0D 0Sztp@`Tl P0倐d$@U`_  R @ Y$ [0d  Z 0 3P@T=+L0W 10"3% 0;L0000;L020 20;L0L000%;L>L C+A0W 10"3& 0;A0000;A0200;A06;+A0WP&1 00`&;A>A Cl6;}W |6P0&@H 0 P6 0 4 <8 BjP+0DK 0T*Pwp\ `$P倐P 0(Vr  R @0 Y$ 0d  0 P@T0P`D+0@DK1'0X 0 {P@ # (8!?C0 S@ 0 eP 0 4 <8 BP0Dk 0PCUQqڨ@p@Th1 W2 ^0d  ] 0 6PW 9P0u40P<8`@C 0PPh  0 P| 0  Pt  0 Pl0DK 0PCU 90EW 0d 090  0 PR`ViPD[# 1R0@ `P0000^=pHK0 0<#:-@0GV D[HK0 0S@  0 P0Wce*`;@d DK0 P 0 P40<8p@C 0 4P  0 P 0  $PHKW[0*0`@+*;Dk @@2 0  0 cP 0  wPP] \L 0@ PD[ PP ` 0bPc P 0 D[ =P 0 Q0P@S 0D;  0*P4 0<8 BP@p4 0<8p BPyl  0  PqmDK`)PD[0d   0 P[)PD[0d  0 PI)` )P )D>@d `0DKP 0 P/HK@4 0<8@ BaP" 0 P@D[g) 0Pc)HK`)  0@W0S  W T_0Pd 0 0 ` 0 P0p0d 0D 0 tP 0 d 0 fP0`DkS 0 pPs\?P0WH?P0(P(0`00( DkP ?4P0W @ 0 /P>PG!?C0 S  0 P>Wp=H[` 00!~0 P0 `FL>͍d 0` H[! 0 P^ 0@TDK1*pP 0@ D`Y W 0  P? p0d  P 0 P1pGP` 0 Y8 0 P$0d 0 =0  0 P](0D< 0 P2x0H[=0 0yw@(2"PG0 K2P0C2"PG0 A 0"PC2 0: 0 PLrp20( 0x"PCt2 0%@ P+`PVV 4 ,?p0S @P000d0`-Q-+*)('&%$ 7>000Q00o 00A S: P @1T00PCT Љ0A d @00A S0P  ER  00A d0d00+S -S ( 0(00d000C \0Sd 0 d 00S 1CP' $ ZB 2^iS7 IS4 NSd@jP2 d00(Si <010[nS  0S Ѝ00XS `d`0Q Q00 Rd000S 1ЍT @Z o 0'$0 Z0C0;01$CYr 0 "o 06rZ0ST 0SL %0jS 0JR0S 0R0000 @+1 0 ,r0 00iPU 0 $S B ? @ $0(SY0SX[ u@P h3vP 0  0v0S P i X:`phiP)9biP0S t :0jSk&Bp 0q[ 0 tPpqf qh ttt t(`sPPV   ! ⤸0| zvPhI t@P; |0S $ B $R 0C 00CSp`6 bAQ`ppx BpGaw0 [ 0 0S0SIHK 0Set@P hqt0P00 hs00Yh0W hBuPhQp(@0S   88Y'\ hsss s sQ 0JR0S8 0R000X h0 P'1 0 qH X+j0vp8p q0㨀pSY  t6!:k cR R4R p 76K0ct0tj 0 [P 0 'Q0p0"00yQt \ QNdT0# 0 C Rࠃ R0d;0d000 C Rࠃ d$ 000d0Q0 `000SZ  d 00S `1 CRd` 00C QPsW0 S 1$ 0^0C$d 10 q0Cd00C [ d00L0C [@PxT$$ ( R$  b$ d@hPDtPPYp(@$sPPNPt9  Oh 1gPk [t` 3# 3#s\3X 00S0jX0S c0#3gP P3m[1HL0$#40k60C40pc+ 0p'o`2 0SRF؃ io?m 0 opdf p`D"@2sgP/ h(@NrLrJr Hr Fr4o  1o[_1@D0$t`#0$m 0`pYP0[00m`p0 P @0(0$0 @00 0h0 dl d0@ S 0S  p0S46S  0gPO 0 o0 #1X\0%#4#$n Tf A, Tb5?P ||N?55(XP9?L ?MXkX(-0@  p㨀 Do0XpSt剑5At 6o0 0SI&BS5t 0'́5fFp't`%2 0o'o(1pW{56Qp 1'G  .00C?o200!\ $ 10 S' 0^dn[ p  2[fP "2VfP SV 0p'(h@t pfh |PR 5fhq0l pp0jS'0 ` A V@dn 0#$v5ft`Q  N$ZPZ Љ Z$\  Z ㉐Цd00Cd0fPd00d00p(000C?o200)0pS `(@0S0SL Vhppp p pXK 4 =nl40S> 4% 4# bP0 46'4t0[p(@ k R \p0 p 0mVp0@SxULt 46SG50jS  X Rk&PBp 0mp0p0(@t 46S60kS0S0S qPa qPvt0T&Xh A kR?7Rcppp p pn@VX t 60jSR4p R \,O p1 0m 0@PWPh7Gh>p02p0Xp@q3 \ q.6B#: :p t0(g$!\p0p(@ 7h'  p@-BR"^p@ @P0T0Pp | 0 Q?0S @- R-- M[ ЍЍ/G-`P(00 !PER !U6@  >PG0 ʭPU pWU@mPp X" 00  @@pG  pᨭ00 赲 0@00A-P@ RH`H0``@p 6T  I A< ,p@-@Pᶣ00CS0 S  P `0 P㭣p6`@-@ᖣ 0`00@蕣- M ? $ Ѝ0@- M P@0 0 000. 0 0 0 #0 (0 0 0 30 Ѝ0'Q: t: 0O-`MQ 0 Q0 `ߍ0( 06/PP 3p000 00` P i@P 0 "0 0P @ R R R#Z0P`0S 0@ ET :@D0SZ@DPg @ ᵬ P[P@DV R71 0 0 帱00 R R0 S S 4 P@  @DOo  @BP ۮP !V_*0`TY ᴱ p  R R R RO V2* ښP @ R p~  7 R @DH0PS C  > @DZ PT* (/P `F p ` 000(/ P`F m p` p70pa p_`6@-DD @1LM0D`QpP- @.0 P) U) pp0 0ͫ0   PP f0  0 x0 0 D0 30LЍOPLpp  @ G0TO6 F3F45 3A-``@PTpM) W ``00偫 0 OP 0  0 ЍX`` k@ 0T ЍOP @(EP! 0S/ 0S/p@-0` P@ Q 0p0 00 Rp` FQ`00pO-ttß OM4`XQ `Pp@dh Q 00B/00 Z.` ֝P 20 00 [ !!.PQP\.Q Q :0 尝P 0H [ 00:[.[<##=[0Q.S7 Y_0IS00X00 I Z  0O P00 0J ` `媪0 0C S:: Ẫ0  `  A:[ 000(0,$@0勪0 0(0 `0 $~P00 0 0 41 30Oߍ Z[00啯00<4 }PPS U.R  : P wN3 2 @+ (/ .,0 O-ʟ@ M MDtŝ00 P:% Q0`px$ Q Q 0 0 *: 0 D5 30dݍ Ѝ)0 0(b,0P(0 0@ T S#PX (.|5 00 P0  03/P  T:0 C/o"T S R`  P$0 XH%t$(0txᤐU0'x T@0 0 ` `<|L0=D804 ,PXP0 C0 R P0  03/P Y  ` ZV `W VpG:(0,0@0(0<Q 0 d0D P0ST Q  RM p Ph < `BZO[P0 0 0PS ! RȠ LȠoQ \ V\pp0XP &0 02W <0S B@Gq 0PS!P" SPSP@Qp$`0S 0 0X@@ @PC0@P0CSX@:@p$` @)-D0 C0 0CSX: 04 R  Rw Q9 0B'RS] P `00%H `/J0 SRP5 080 v `PC0 | `Z%8ʨX00 S5 8 0X0P($0r/P0$ R R < R0$0P奨0P `VX *P D Q* 䪨<0X`0 `D<00S S F00H030 0  `P0 9 `ZL @0(1Q:*(PfP PXP_0 CR00 SX@0(0,8w P~HpJ0XP@ CR00S:@ணPX@ 03/P $X (0@(C 0L0+0P ( @00(0(,K 0$ 0% /z  0 0!40 T8!rQi(k$0 PXa0.P 0  `PY0 + 0Z0:<0S$0(P@0(0ק`V D`(=0%H .3,;L @0(1Q *(@0P(0s P& K(0@(`C 0L0v+0P  ( @0@0(0@0(0X/ / .  (H , A-0S`@M05 S Ѝ0p 0)PP4 ŬP/ 80 0P P  0 "0P ,ỬU 00S S 0p+ᩬ+ 0 G-20BM0400 00`S0. S @ᄒA~ P p0u #0G\/P @T *X8 4"y,2P 0 "1 0 4 30vBލ 0    ! 1/I)@PI :PPD 8 0 0@طPAP 0 00 00000 00@+T7 0 p pIP  00S 0  0pW&   0 0 0 T+ 0 N+ 0  00S S Jh# |!0!" G-Mp0`ƫ@P0P0 0   0 p`BPǫЍ 0 6PP A-M`pPᠫ@P , 0 (   P 0@ᤫЍ0, 0ЍRQ0@-$MP8@'0S9 0S0S9   0 40 0 0P@P 00$Ѝ0R R" </ 0 0$Ѝ00S 1 0 00S000s S 04   0 X, O-DDğ DM<h@P 0 (%(0P P`spr*0 `!PP TP ,0  0P0ß RR RR 0 Q Q 0 R R 8 $0.$0@P`  s p0S S S@ 1Y g*@@P 000S 0 R0 ?@B 0I  R06@DQ1 y  @DX T!:  @Dpi0 Sq CF P`0  [@D q [p>`8PT* P`))\ 0  0d!P1 0 <0 30HDЍ((PI `  P@Q P1 0 0 0Z0 J P`00)) 0 )0 000 00 `H`P P` p@-M`P@),0,0   0uЍp)*@-M@$$ 9 Ѝ))@-M`P@pP0P0 ɠ@0@ 0   @0ZPߩЍ4)L)0@-P MP@T 0t  P00 000P 9 @ Ѝ0@T00(((@-1!00M@0 ! p`P0^! 00 0 N RJ0100 N.^Q 00 Ѝ R0XS 00 9^0 ^ @ A Q QV ( ,$04 c#!$c4" 00 O-Ÿ2 0,MP0$00@p P / 0 "x2 0 $0 30,ЍX"L2 0 $0 30,ЍOh0P:U000 0> U@ 0p`pP @؁0 tP01 `V, @ pWVp F P$`U 8#< 400SO U0E S0 s\b ᔣP:U@  ;P 0:WV 0S  $0R 8#< 40@ P`0S P@P$`@P.Up P$`UPfGU   0p@-@P  (M $  `0 S+P* ᇞL @0 0 $0 30(Ѝp7 0 ,G X O-ß lMPd 0 P / 0 #3 0 d0 30lЍd#X3 0 d0 30 lЍO 040 $(,00h1T@ RT@P0 q0S P q u XP 0SP q, u00 X0S PX$Up#P40@ 0b:0@Tp0*PUY 0 SY*  0CR00R:@ٝ{uPp40@` 0b\!J 0 *PY9@Tp. U00 S` V,*:0UT0X X- X@P0( R0  JP +P RU @Tpu0 S:E 0 ': 00@SP 0FD   HO-`` M@QpPL P(Z? U U U  0 JЍ0` R|  @0Z' + PP 0:/qp  00P @ P _&00 0 00 Ѝp  .P0  * R + L U[ p  0.P 00 0SN  00 0:/qp 00 `P¿^ 0? <`V<X0`u R0Z0}ᇕ0 jP0 :/qp`0 a 00 0`VÿR <0`VÿpX0PXJS 00 0^O <?` 800C`V 0Y!QD`L0k?  `:/qp< 00 `P  @ P %00 0 Y 00 T`P%0 S": 0C P;P`T 0S  0C`ÿ00C`V0  Y 0CI 0^ @0^ f%00 00 0 ۥ 0 L @ S\0O-@ $M  H`p 00#p 0 0@H`# 0 B0S0 Q6  R00S 0B QR `  :$PP რ00[U X0 00@PL  RWRY 00S ` R00S R Tu*0D0 Sm P^ TP`p^[  C0 P ATq ^a S 0 ` H`@r3 QY/ ΒP+ 0S "  P00S U0S S" S' S- PP000S 0 0ԟT $Ѝ`dP`V=W WS SSS T$p@-@0P0FG p 00p0 0@p¤0TS00 -M0 3/Ѝ/@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ R R R //00/00/ R R R //00/00/@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ0@- @RP M R R Ѝ0003/P PP Ѝ00P03/P 0@- @RP M R R Ѝ0003/P PP Ѝ00P03/P @- @RM R R Ѝ003/P 00S00Ѝ 0R0 02/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/ЍR0 p@-@PPeP P0 03/P U 0| p@ 0/003/P U 0@ p@0/@oppp/\{ MA-P@Qp`M Q Q Ѝ0 03/P V*PX )"000  0003/P P P PЍAR X P` }0SP!y ` ;A-pP`@P  R 0 R 0\A/W 0A/0A-M 00@SpP` SV   P RPU U U Ѝ!000SP Ѝ VP 0SPU! H P` {w d (#0@-0@SP M S S Ѝ00 03/P 003/P  0 Ѝ00 00 0 3/P 003/ Ѝ00@-0@SP M S S Ѝ00 03/P 003/P  0 Ѝ00 00 0 3/P 003/ Ѝ0@-M@P0.S00Ѝ@-M@p@Ѝ R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 /p L0 00/P P0 4# /0 48 RP @Qa GP @Q`P <P @`VT*` P`Vy [\Vr .V DAv Xt0S Q.Sm @]Pj `0PCU`PxQM  D P XS  ``/Qj ]QOP R02   0 ]R) PR  "  XSnP   R0 F b" R` V` `A ` @R^ .R @@  0D0C  X1 (00$Ѝ00P  ` < V    \  PS X R0Q  S0 T 4*@DT[@ XS(@ X000… Q ` T`4*@DT[@S X00` n k 0G-AQ@<*p0S% R3 @R`P00 0X* 000瘠    P 0 Sp00 NAS 0SPQP!00P0X`(00 TRO-P3P#RP3 M0U p\` @0I @R: R R& :(000 ЍQ*@ ĠS? A @ G0RPR@\ 4 R @4 S0A  Y*@T*0P 0A\ R!ɑ" 40S0 4 0- M ЍO-S@,M `0S0g 0S 0S0^P @^Y \S0pS0 0P00C0$PU P0S @Sf  [@U pPU00 S V*0 B>\ A XP00L X 0 Ġ? 0 0P R SAS^01"0!0\WPa(00P0S 0 Q*00G S 0S 0 p  0AUn0S"  ! [*@%X0 `v(  ABQ AA\ Q`E  `  0B>S500A S00P0 S 00 (00,Ѝ R `0S P\0[ $?0 ,4B0`0000ZDPޜ00{$H p@- M P0 `00jp @ !p < 40 0 1 30ލp@;  A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ~;,  Q:/R/0S/S:00/@-\@3#* 0^ @R R R `(000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R*00C#(00/C/A-@P`TP% UVT ᫗P @TP 0?Sp 00(00QSp@-`P@ PP@`V  0R p/pA-PAUQ?UU@A`pP W ځ1AP讛(00詛00꥛?00Q @-A?SSRB 0@S A芛00腛(00/-- M  ЍЍ/@-M@ O#p TЍR/0S0 \ S 0S0000/O-@P M ` <P-Yh +Ya Q0Yj T@ @Q \:pta`PpgQ:pia`P" [)SQ" K0I P0aIQW0IAIQ70IS| V[SQ;+0S \0J0 0 ЍQ `Q0YXP  A@0L ^P @T@@0@-BR"^H M <000 Ѝ0@]@Pᥚ00TP Ѝ0\ p@-BR"^p@J@Pᒚ0T0PpA-@p`P rMX0^pAtA0O0p`0 TA΀\`L PPq$08 @(0 0 1 30rߍN9  0   M Ѝ  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/\ QPO-M@ \ 0S000!pR !01 `PP E`#3`7P*Q30A 0#1#2#4#8 P 0   Д U 0C  pS TP0 0@pQ 0S  ЍșT 0 @00Ѝ这 0 0A-@`Pp0 0@$0$ 0 M Ѝ{( T(p@-0 000St@@@pdPddP@P@P 0000 0 x(t( p@-P@h p@A-@`P8ppp0php JT  0<0   A6 ,@-@P0S  3/000S@N A-pP@`  @ }000@P p@-@PAPpp@@-@!1BMM 0`PF040@@@ @@ 8xqPpU h10S \!p0@  P8A0@ P< 1 0ࡄ!0 0 4 300BލЍP ߘ@P  4/P Q Q 0 0yp0 00P Ø0 0 徘 @V7l 0 %( \́ O-qQpMP m Ap@f a@0` RD 00]4k1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W 0@@00xQQx00p@@[ЍPUЍ<0 0؃ H\ $<#""D  0@-0@P$M P P0L0 0 P $Ѝ0! G-RPL 8104+0SA a q@`p #)/0@S-00儑 000S 0 000 00 x0 00 \0 00 @ G(00p\tA-耟p0S@P$0S!0`PP @0S PU @@P 0U00 {4@ 0@ P  XO-dM∀`XSRßQ 0 3000SYC@0S00 h0X#00T3 0  0 00P ZP3s003@0p0VQ QN  QI oP0S_ 3/0 0P U@@|RP00SJ`" 00C0T@dЍ8B,@@@$20\r 0,0SO  R10$   @$(00 L00LP 0S 0 <00@00<00tP 0 S@$0<S(  ( @0P 1S@iPQ 00C0@@00$   @$(0P< @$0S(  ( @0$  $(0 x<{ 048z y <y x \x 0x x C-@@Ÿ 8MpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W?!1 0 0 30[ЍU00ì?dPER ?\00S T=*0!0 V5 @0S00L0  0T*0 V @0S00U0Pep 0PT*0@0S00 V@@W <0Pe 0P4 Qd HȺlO-ϟ |Mtϟp `0S㠐夀m  Yt 00 0S` %SP %0BUS[;)"@kK/(1 |y]F?a-= 0 t0 30|Ѝ  !O#d"@(,0 P$; - #"0-cR:-c2S=  PP 0 0C@aa0C0C Cr  \\@-N2?#c!!"N , hh ! `bQ,5:TbQL, !,#c!!2N 0  \0 S 0!Y%0`0S00 S `0  p`0 S00C  B1p;Q/0A!b0\P  ~Y0`0S00 S 0  B1:Q/0A!b0\P  ^Y0`0S00 Y0 p`0Q0X: 00\P :Y0`0S00 Y0 p` 0Q09 00\P Y0`0S00 Sah /0 b !Q P9Q00\P  Yi0`0S00b YB0Q08 00\P YQ0`0S00J Y*0 p`7`p0 v`,48 Q0 0\P  Y0`0S00 YQ / b !Q  '0 \P0  Y0`0S00 Y Q L'0 \P0  mY0`0S00 S Q &(0 \P0  SY0`0S00 SU+P#U'P Q h&0 \P0  2Y0`0S00 S 0Q06 00\P Y0`0S00 Sj0 400080 0<00\P@00D0000 0P0l% Yl0 `0S00d YD 0E0 S0ڜ0YT I` R  K S`GYD0$ `0S00; S00$2?2c 1 R11Aãd0Sâd0CS0c04\P 0Y0`0S00 Y 00  0  p00 S0R`050\P0p3 0rY0`0S00 Y(0 p`0\PS002 0NY0`0S00 YY0" `0S00 Yh0 p` 0S 0 @ 5qp  fqp  @Q 0! S! -Rm Sk|! x1Q (> = <= < hxHT7 PlԴnp$IQ(2  0Sc0  Pg0P Y I S ` R  KP0`p `0 SF 1h Y0`0S00 Y0S6 1 Y0`0S00 S0S& !Y0`0S00 S 0  0UP !  Q"" " " 0' " S0 P$  VRN 0gS 0` p`gx0L!?$A1c P0 "?dN2c1 1 @1N0/"b!!Q1C  ã/ d0 S  á/d0CS0c003\P 0Y.0`0S00' S0|3Q00\P Y0`0S00 So ~0P% `" `#a c/ \A-MP@`[0p40@00000 @pT `pGpFЍA"00Ѝ@-$$@M Ѝ| C-pP`X@X@ M u@0@0  0 @  Ѝ8 4C-P`p@XX M T@0( 0  0p@  Ѝ贱 4@-0N \0N@ T \ڏT00\я00p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-0a((Ÿ,Nl^3f*Sj Sq @R 0ϠTlQ@Ҍ 1C0o 1fcf Qq P@\ q00CⓇ?G1c0 0@100C L``S0B0S0BPDKHQ``@P QS@ 0S l lTà%A@002c2cPÌS S L l là l^#3S l là;\L l là^ʌ͌)\P*Qgfff$I8- , ף 0P /0S/ 0 S/0S/0S0@//O-M 00 S X$\P 8 J$/@"b0"b!Q8 UJp#.""O ` T*b!"b @A0SO0 0* b?/& R  " R00G#1? @?@Z R<@0p"#<@I`_`APP R?#"d ?&Q!Q00 37>0R'Z0S()@n \Z R SH*ȟX`` ԨԸ  v@@PPȟ$ȟ夘 ,J(q[.|xtȟ5 :lX\@`X$ ^, PΌ3# `_ 0RS@ xWEXPP  @E`E`ǟ)ǟG $ttH|t(ao[.`gl 11 :Hg8@ ß0D0pϠ'l ‚ b l C /B/`0`01>aG` 120S"&.2db`3ch@G@. c 0ۄ4#+:60 0($0(>! 0#‚!!!0C0"+a[oÏ(" ?00 #2>[?@G'PE@GPD2#"*" H2H0@r,W#10 ?015: 2 0 #"".2Q  3 #101`0T!2? B4sppp0/SX0 p c 0s!+:60 0($0(>! 0+Qd!_P!!!0C0@![Ï(" ?00 #2>PVXi`v c 0C &: 600*$0 *>!!!0C0V& )!"2 >n:E.€Q_uk9"mn Sc$IųQ\(\ףp= ף  Q(\)\° sc 0 8 +:60 0($0T (>!!!0Cl 0[+Q_("Y0%R^PP0 0 cQ @R0!V BqgqgXpC)1? c 00ă0,!):60 0($0!(>X! 0‚!!!0C0x!YÏ1(" ?00 #2>r/D B 1?A1c 1c0R0B0$2@ 502c8"2c2A" "b1C S/  P008T2T!:#0 όR! UZ: 0"#2>"Q0030#0000T  @D0 S0  @ @$ 0ЍDv)1?c 0 010x#):60 0($0#(>!!!0C Y38#,"0.s<0P0@<00000@<0P0@\T 0 @-M0@P T 00t0(0Ѝ 00p0@ ( O-`@PM 0S9  V 04? [P˂$PQ%  .   !0 P  0% R0 R !P  j00Ѝ0 S, 01P0% V 0? VPↂR5. P P !.Q P V0% R0R!Y0h&P l6m&NS`@@0FSHkpP [ 0S10ƒ!0 hh "0 Y001 OX10\1 001Y" <Y50 S0S >S@p3S*S0S -S0 C R0`@0F0H0N<)`h0hlpt ~|Ѝ*YY -Y00I S@0IS0   S ,S;SQHAL d ;S,Sc SiH^&- Q 019mPhj`019mo\` @KO@h6Pc^`L 9k bhp&tulg>@0 0N\hP[~00 @T~ @  P 1 0 0@1 00\P00P 0,Sd0,0P 0S   HILu& ah& `p&g.tl60 4`0 @ `ᴄğ@$(00p$cR0#030 1`002c2c# b?0ppcWZ  X  R `H 4$cR* $L%P 0 S 2J @`p 30@0 @0 `cQ0#031`002c2c3?0cQcs P`Q   Q0(38#AcQ*3301c00 `X00@00"0` 8p @@p`@D 40g 0Bl Sh0Ű1p` @ ~~ ף)\(\{3PA-PQ@F 0S00 01ɀN  phh6l6|`r`P 0:S jP `VpFPW N h|0PPT`V_pHPNLg@P`AoPpVA`P xA-A`P@pP `|PPPW~PqpATX  P>UI QQ |1|!`0 t0 V00 m``@ v P =D0C0CS\@0d/@D  n@D0P0T0S00#  1PWPࣶ LN  h|U,hGP@P0P P0p0 000h@% qxv<S# 0@-@ 0 0!R !x# \# @-\F=<;:97310/.+,+)('%#" uqpo  #8qnR V@6VJ 0V & 0 aQ S  T n4ЍPPPP010 00C0B Q$RPMP00I x3 0S 0V`1!(  x 0SM 0V`1!  x 0S6 0V`1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p V`1 0! xO 0S  0V`1!xX 0S 0V`1!0 *RS 0B Q@ 00B S@@@ x: 0S 0V`1! x  0S 0V`1!    x 0S  pD 0V`1!ex$ 0S 0V`1!X V  x 0S] 0V`1!G +  x 0S p (  xz 0S px) 0S 0V`1!x+ 0S 0V`1! x 0S 0V`1!xn 0S px 0S p  0V`1! py p p xp& qp jp cp"s R 0Vp0y  V@ `1 | x 0S 0V`1! | xm 0S 0pT  0V`1!u ; x 0S4 0V`1!f ; xX 0S  p/ T- e* p# p$ p7 p#l x 0S 0V`1!(P x 0S p[ x 0S 0V`1!  xi 0S p 0V`1!$R 0@C p7 x 0S p  0V`1!x 0S 0V`1!x 0S ppx! 0S dp@ x 0S Vpz  0V`1!  x  0S Ape  0V`1! PZ X PU S PP N $pG PD }B P? x= P: s8 0B Q@ 0 B  0B Q$Rh x R 0p0 V`1@b P K p  P ? p pO p P % P  P  P  P  P  P  P  P  P 0s 0 S p  0V`1@! P $Ry@00 P  P  P  P  P  P ~ P{ y Pv t Pq o Pl j Pg e Pb ` P] [x 0S ,pP  0V`1!q PE ~C P@ y> P; t9 P6 o4 P1 j/O-ϟ oMMƍH0@00\ !TR !0Ts0p0 ` 0S   R  00 \ D /ܐ  @(匐d 000@0h0X00PU @%U0T  ` J 0 R 00S0(U` P0`r$P0 0FZS~;:Ly]_ p%nWWN,VbsPdP    RZ00sV p=*X1rrYXOX.>TqCtˠn@qPF0D,\ TDTl(80<@P@dP@@0@ 0@00'@00Fp`A@00F S$V $@GPU"0T$0S( @0S @C0倀0@0S0000XX 5*: 0 6 30 oލЍb0P00 P:0 0g  x S 0S0q-0r00S0 ` 0 00 @TS@@R00SB r0@ y, P L 8 4  V  0a P }r0, @P0L08040!$R    P R<  儠 `@VS 0000S0r00Q(1S 0010000S0G?0Q(Zx ,0@DT 0L,0p000S0bQD bP@@6 0 ($0 PCUz<0Q0(吰?0400S@@0S 0!00040S  x|0t00. p7| pR1|0P @x0P0CD0 E0P@0 $t0S-0r0|0s80 `0(0 01 + @)Pp DQ`h>0(00000S0p;000Qy( 0 00 `000000S0Q(|@T0D 00@00\ \0P00 D0pC(00 S R00@D,0,0@@0,0#@00NS `Vr0ڸ|p @ @ P@ , L@8@Q(r0^\0P00p  `s0\40 0<0K R  mRdp 00! , 0g 0@!000  0g @0SQ000GpBV*}p(Pp@ 0`FV \p Q 0 P\0P00 }Y@1 Q 00 0 XC@ ? Q 00P? 0P0c@! Q 00 0 :LPPU\00/s` L ,0 4` 0(`PUSp4UPEI0CP QW ,LXX ڐP? X@@@TT80 0ጀ@JZ P@QJZ  @80L^@( [P㔰吰 Q 80[ P80 80[ P  80Qu sQh,V)ڌ@ `0/( P@PIY   R@ Q S[ P J[0P00b w8 10R+ S0bB- C S!!/΍L!CcS00 a000AB0LQ*npL0 h00Ch0h T r0, @@, @p , / P@L@8@~80 [ P 7 80H00 00 0 H0Q 00PQ  H0000H00@0Sr@#SH001HS-0`r0͵00 S30` 0QH0000  0H0Z0P00(r0g0 `, \ ` Q(00X @p@P L 4 , / s0\40<0 P0  \0=mPy_XL`P`,8<P#" . A S J$\ ,\0\`pEE ,\ S 00\00S0 080SP `0@w`00F S/@A@00A S$Q0S 10`aS0H01 000 H0S0\ 05p( 0SH0  H0 @b@-@`P MDpY@0p0 000@Y Ѝ A-@P`pY0 0@YO- M4@P`p08Pjrc T ЍO@3 v0:ɳ` 0@|  0PL0ST 0S000p0t 9 P )Jpo  46OD5@DT 6 4>N0.0>X,.,>;`p.>N 0/`p 0P t 0XPJ@H0DZ0K=1 PgTD@80( 000D00@COo0B SP@ES0C00@0CS% =010x<, 0  0|ЍO;t@@C>0 SA. @0c 0c6"B0@DT06A0@00DS0d0800800Z80( 0C800jD00P 0P|Ѝ00C?o200P0J@00 40X <0$ H0t0S( Rʘ;$04 S00Ӣ?(01 ?` @Р $0X  \;`p 0P 0 0t 0`pP  0[`pPE0 0P P @Y0<040( 0X00S$00P 0 $0S00R  \ Q  RH  Skt0S(0Sʌ0<040SX0$00<00<0 ,00 |ЍOg< R T RpPC^0P6Pe0080P @PD 8 RQR00 BPE0A8 0DQ <0Sl X@P- `P) R`P" Z  <0R0P   0`S80`0800P00<0( R$8 01"B`C 80@"ET 7 `p@ 00 0 @0S d 7P$t7 ~$0`S uAo $0`0(0h0<0S7`01C 0  0r؄ p 0 f @0p`pp 0PhlHؠ`P X%  t6Z h6Sp`P 0<0P 0P`pP  0. 0P H PT8SY\0H0vb$( 5 ` uA 5 0P  1P! \0H0V 5(0@c01  0$B  0$` 0@`S 0 = 008 P 8  00UL0SS@0S$0S<0SZP p$ tPP  -00S0SU0S S P P W 0W9SpG 0P0 @}X$48 DP gP! ]`P '@P X0S|$080SSZPa 0$ 0C0$00040  ypP0 0S 0kPQP 40S0 RIWQQH R  R R S p PS <P9X 1tU TU m p@ P pg e 0U (0000C0-$0S ` P P 00 0(00(0100CT <`P <0R0P 001 `0 ?aCoc?`(?yPD?t' ??@$@@0 ` 0<CP`00  0 0`p0P@ ( < 0{ 0P } 0PC! t0( 0R?0S\0H008P@<0_X  L1jP`p!$$0S 1[ P   P0 0  0 , Q0|Ѝ<0`d \ 0t0S h0 P(0 +Wp$0Z5 P\ U  @PT  PPM@PGl0W0SpG P @PP8   ! ]PP, P 0@DTk t9Y h0(0 0 040 P0(00d80@ P(0 0C (0P <0SPX0S$0000+0Q$0S X0S`0(00C h044  0 `4 0` uAW0S0Sz 9Xw p90 @0` P@h010(0H0S 0S SL  0Z `p PA P 9 P @X PP @W>0S 0007 Qڶ0Sd46S01::S0P000ZbQlHP#h0 PH(0 @$ P !(0 Ph0/&$zT P p0SB0T(0 0(010P0 @&$`00C0X07X0$0h0 P(0 @ p@B00C0 X0|9X[ W1  00S `1 CR0pC08000 1バ0C00C Zx 00L0C Z@Pl"H ^H  bH `@Px 0t0C0P0( 0000000 0-P 000s0PC@0P0P0Pe0 $!1 0 9P U%bk$ 1p0X@@"ᐡ\`#P#Z 0 _EpGPEPW@ 0#X@`0!:?C0CP465640V| 0 $p x0`pl P $#iP \ 1`pP` Z 0 x0@0 #$\*8 V瞯<HA??N4Y7P  B\,$0SI ,0 0R0 $060P0 "P z P@P`m@PP X0 0C BX0 ^\0$05 @1Z `pd!d1dxdP D\ 0# 0T$\R \ 1gPRaT`P  0>P  0($5P `p0x ,00$0S&0KS$0! $Pj $ 00C 0$ ( 0h0 R# 00S S SP 000 (0000 "AQ!*'Z000  0c230$0 S D0S 0P 0 ^Z"0 00Q0000 @00MZ"0 0 `BpP 0p0C0I0$00 00 0Z"000( 0000 @a!00 0 x04#$\`m 00T0 00cT0  [0( 0 000KPF0 S0``IX00X0k  97Y `p,($#\0$0T0 000000 0(0~P0P00PCU0Ez,`Vq 7`FPz`p, X0吰0C0 DPi !| x| | r|Qʛ p8  &\ H 0[ 0P \0x0\00cx0 #H7R @ 0a0P04060P`$#@Y 5\ 0T#0 0 (0P [t 000(0 0Q00 N@S 0⊐SQЅP S@80\0800SQЅP8$ H 80 0C10 T 0#0 0 (0P= S`p,H$0#`Pa @00C1 P0 CnPe5P`y Ad90P00(0PoS!00`p,0Z` p P,b $0Sy 0 |{Q0r !P0 00C  0Z `p,V!0Y0$0X PR0oPZ P000  0C吰0$PI 0SK@ 0( 00 0S; 0`p, $000P00P00Y!08 0$00# [00S 0 UY 00P0`p, 3S 000 P  @1 @d@P000!00rX0P Sጐ !000Sg0SD00D0a0吰 0C0f@-00SO-@ 0Q@P MPP`PV  0Lp@P  "(%(!( Z"8J@ Z3pIq WG N@ "8!8P0LL#8S 0Y 0  0 Ѝ @P   ! R ``O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WI:Q0 [ \ 5 0QR T0#03\0SuWa*0 GV*0F@S3 F\   V0WN 06S  ЍW*@DPD@ Q0: Q0Q l  l>P:00XS Q0pBO)AoR^" 0[0 k12000 QS0T0l1 c, 0# Q:|00Q )Q  0 O-M<0 =XHX8@`p00S 0 0Pu0@0P0  DB0SG^P0D= PPb P0 Q DS ZH P 0S S SD `Pb@00@0 0c 0Vp@ ! VT 0 PeS5q0 0@00S Z 0 P\Pc R  BPPb SP0E0CSڣ0S& PX 0Sa P0 0UX 0p 0 Q U P  U UE^ PLU 0CC10B P0DSy`0 S0 S C U 0S S S 0 UP@"00ЍRq  BPP+\~ -\  L^ ?L NZ @\ #L@NT @Pl '@Ѝ \ 0P@0Q 0S00 LS S80S 000 0 b@0wU"00@C `P `D21 2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf 0 S_ | %U@"00Ѝ@P0M@E  PL `K"V`pKW  J` 21p 7 ` PE~@QP!80Sj80S 000i U U E%P 80S800c8080S `XT0)  RP!@L#80ST80S P 0 0  B P\ \vj 0`e  BR "@` P3 `2 c 1P5 $ ` 0 A-P@p`* P  0 P  0 PA-P@p`@ P  0 P  0 P0 00/ DA-@< RP`pn3 ^@ P 0 W@0 p0U0`PEPU 0 B P @` pV  0 B Pp0U`98C- M` p @P 0  B 0C2S P 0l Ѝ6cz@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ pS0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/ltA-@T0000Pb1 !0^2, l!p(  ^2,0D10C#10RA! @^ ^@DA0DC1T0R @@-P@M: Q @ 0 R Q @ЍQ0@-@ @^3#1^HP1.P2 L+@L+l0n00@O-1!0 M000000 !1 0 0 30WЍ`pD00@0P(@0  `a O0< @( R  00     O| qR@P0TD00D0 0D00D00D0 0  000  먽 Lh `1A-0@`T@p Tp P1 Tpp8#8S$Q-* q2 q: R 0X00SP ^T@X@@@  000COPX@ TppPZ@W@00?2  0a|A-P0 Q@`%; S V45S pV R00S D S0 Sp V pSp?0+ A-paPAU CQ R& BU50e0345@@ 0 QARAL^ R Q(0P&Q Q/.PU  sp A T/TA A Bu03>10^020B 0A-ˠ a LRCS0\8 \TO:|10@o\0 ^# QR=0b035PPA@DT3!#1^ !1. !2 A"LA^U /B R s၃p AT\ A Nr4̠ @@QPUP@E 0  @T@?H P9G-@  \PP`p!! \Q 0S6C 0*4>70 0S6C * Q 3 "\  \Q4>7 0$>' 0G- PXl X` PC Xa`  P)2Q>8 qD ?qV   0@)pY00 S X Y  0  $Šˌ '5  ?@pY 0 X``@pWuVVA Ϡ? pAAG pa2GA n2.! N3! 3>a  O-T M0! # Htd{Ġk[ @R) X# ZHM R?[` k? 2 B0 `b>6> 2 0k 0K55[@Œ P 0S 0 ЍOE = Ѝ Z* XJB0  ?{D? ; K2 k404(; 0h# 0H<#@<Ƞ@ X X+0P QP 0`Ġb ЍOP  Œ  0ŒJ Q0 002 0O-r M0!J# DŠUe [Š"kX LTW T@ ^ 0$:[ 0x:820Ao ЍTL Y= ?Xb h? 2 B1 b>0>2 0h 0H<<Ƞ[ 0S   RP3P#(1R$1 ",!P2PP E!E2D5 ЍOY 0A ЍT PŠQ. ЍO% T! @I?x'?8 H2 h;1;$8 0d# 0D:#: @  @ ^ " 0 0@  1P/P / /BR30!#11S041 #<120A#ac// P/R30!#11SP41#<120A#aK$00 0A#aA`/0/P Ϡ`P03 !0##1RH$1",!020 C  0c0C>b0//.P P03 !0##1RD$1",!020 C cA.c00 //d.p@-K@T0TUoJP& V @DOoUB@T p~T03@d0 D  000V`p@  000pp@-@;0SM S^ #  0$", !0 C0c. =Ѝ^ h <$;S 4#6>Ѝ(R03:045S ,?S/ | ?S/  s;p@-!0@S. ) T SP\M M P03K:00a `00Cà0cT'R: QP3:PR 0* p\0D?oR20S p@P!PPE%Peà$!P0  Ap@CBCR @pp 0+*;!0A-ˠ_S  _% \ \ RP0V _R^\RF AGA!@L,lS^ Q03:00!00C0c @C0$aqW` }@~@G? 7\S00 AQ3:,)H);0S ;0S P /45S 0 ;S l0l !;S /45SP/P @-Q ;0S ;0S ?S/P 3# /R /45S @-45S /;0S ;0S ?S/P 3# /R /45S @-45S /p@- !!:S$&O3S%C>c0&0T @c PC22 Q pQ{pa1^ Qp|  000pPS X  000p0C?oP20SVT(0@-0!*P M!: %+ %U  C!A Ѝ0@ O Ѝ09P :#:S % Ѝ04>70 -Ϡ M\Ϡ Z Ѝ Ѝ-Ϡ M\Ϡ ЍJ ЍC-M! P D$&F#z o \ @po& W \" Ѝ@U  Go R \B  ЍC0 W 0 0 p@ E%J +ህA!p p0#0 0P# 0S 0AAAЍCPOP 0ЍO-D!j,MF#_Vp `@$_% Y Y  0pOp \83  ,Ѝ@Yt ,ЍO1  0 #V 0 0 `@E%(K$ @0刅ᤊ E `F 0R0O:p0?/000嫰 0 E` 0 *) r\ Qc0S0QY0 P^ 3#P0 Y`F PP0 #0#* 0E 0Q0`,ЍO(1,Ѝ R0 #000!*R0p#!`!*iÎ!)`#Z Q p#pQpQ[ ` R0 \3#`   ! # QP!   00 / ɠ@- ʠ,ʠ\ l!Q  QP/> X4>70@-! # Ϡ\Q^ ^0030# P  00  + @-! # Ϡ\QP P03# ^   00   A-$a$1`pP0MS3 U10AT !0S 0000 @T 0 0S00 0Ѝ@0!0D1S<000S 000x x lF 0p@-@P0p R pPQ`00App@D `80 0QApp@4 xl0  0#10/ P30 R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P:pP   ! D`}P03#01S412s2sS/1J //@-@P0@0O-0Z  @ SMpPA PaU* F B  H  ^'* 0H0C X000300 ZP@T   `d` X`Z P` @T@T 06S @ЍG-0@pR$A0 QPiV'10SP`P\ 00001010i0S l1 zPP4 @p PU `@00SaPP# 000S 00PU 0C  pPph0iV0S <0 ,0R0i < xql (G-P0R@T`塢ڃ0TP$ Zp  !pG0   a!  \2)0L0C\0003R @@GpG \ -0P!1^$23\ *G-0@P@DTpD !1PD*32\ ::P @ P@a0 0S 0S Q 0@A@DpQ$A3 ! V @ 00S 3 #V0`F`F` 02NS @0@PpP 0 0Q@3A! p@-@ AP`DC0 P `R C*\0 `l3DR<* 26p S0pR4 c5 # 502,13p0 p?C-@ MP`p7P Đ%T@ 0Y0   CII5` Ѝ P `!300S   Y0 C@@1`0S0/0 R /@-414QPP@M5m`P3 pP-0S  Q- p 0: S&DP  8#800@ |0$  t0,  l0( 0 0ЍF00Ѝ<0F00FO00P < Lp@-@700CS00 P7pP  BR  /p@-0rSL wS aSOP kF 0 pLP0S! e C+S ^R)# P0SPPp0KS0LS0DS0ES@P0p@-S4 @L7 P00P! !& 0S 3/PP೼000P @ P |00 `v00aa17@0`` 0ph4PE 0P000@-!@R !P 0C 0 0 S /4p@-Q1P0@0S3 0 LJ 4000S8 0"$0 3/0P:0,p00P @ P 00< R 800pzC0PZFIU4P 00L5  0@000 pnE 0 @00 @-Ѝ/p@-@P@TS S S RE 0 pH0p@@,0p@d0p@C6@000 0 0000/<P 0p/@-$E/41S{ O- @fQM  Q 5/p <`?`  +dl+kh+&dlk&@kh+&dlk&D kh+&dlk&H$kh+&dlk&L(kh+&dlk&P,kh+&dlk&jh*T&li)j&+dXi*h(\g'+d)lh*gt&`dp0ex%j*(n.jd+)h`l'n&lx,p eT('lP`X d%xl( `+ẗ|x|FGEPKJ`DIpŐlĀH`ĐŀPt l [`0 `pA/`4-pf APpM_ĀmZQ 0phPUQ 0phPJQ 0phP@ Q 0phP6Q 0phP,Q 0phP"Q 0phPPQ 0pzhP YQߍ/COCp,qꌆaQ@-P @41S  P bP0{CA-4!@ pPP/1S 0L1 @P!<PPPUQPMoPP Qp W >Cp_oR9Cp6Cpp@-@P 0@@A-@`dP] VapPWPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V B0@BB@SSC-`p@ M. Sr$QU$( P 0PN VV0( R{⁐Q 0(Q^ 0& P  Ѝ0Co$!? R (aБ P^Y P 0RX%Ƞ\XRI0C p(q !$ P$$(  Y 0( ^ \ :0  P7B00,1  Q$-(y( (R!  Q (剐0$ 1 ($!o`0 `mPp Rl$|O-,M0 0 S ! rp2/0, (Q0 Pu @`P@P\%$P 0  CZB 0@PUpWW 0 ``PM 0@SP㲀1UJ[K ,Ѝ 0 6lPPu/  $`vlPB 0 $ 6`P# 0@SP㲀@1  P\ \4 \  ᰠZ"[ 0L `PP  5eP 0 hPp@@,Ѝ$`  0JlP   eP(q@GT 1S(Q0 @-@ ! \ @,(A 0 ,1!A0S@-@0@ A00,1R@-@1  @0@ ,!@0 0O-`Й0S ]MH pPw*@P Uq  @| @P 0 p <* 4ɟ4 00 84  Dn@@ j@PXP V P0 S40R !Q!3^ thȟ ^ ^@42= P3p D H 0$p eP8ɠ3 LJ<,0( pQ>PVNP WP  0)p pt 0} Vp 0Sm A/ 1 *4+ )4p+́* (4) (<' 0<' .4 .<0 4< <0 4< 0#<  <$ 0 4< $( 4< (, 4< 00,#<0 <400 44< <840 4< 8<0#<< < <08 8 8Ġ  4   4| pp $ <  x0$0 (p , ( 4$,0p ,(048 < 4x0080 < |@ <4, 8p | < , <00@)Ġ| )  p' pJ0  | S!tpH (( x 岠*LL,| , S[,CC r A[X3pWTA^P  8/@ PH( vPD 1DpN8ɠ0  !N[V QU0 aPP$4Q$#Py 2ŸrR@B  ` `]ߍOPY>P| 0>p 0 pp>P>Qi>pW/ <*  8004 D]>@ Y>> pX ڗ>00>@P>P>P0a{>@~>@Xu XaoHdO-(P`P10p5fS@(Pp6 R ؑ埼P. ( ,0[ D`D` S`1 005,`5Oeꂡ ]P ر " J= ᨽؑ@-@ 13/, (Q0@-@Q {+00 2 > 0 O-霆MS`p & 0 Z0 P U E Q[ [ R Y  YYY  =00 Ѝ P 5%0  0 @P 0 10$!12ܺP- 0@S0 200X5V00L500D50 0<50 04500,500$5000 S S =00P p 9 20 2 80Pp` 0 0`UP U\3UX# 2Z 00 20120QSpE  000 E9@ P0!03w/\ 009 0)P0 "  *P 1S0S1S *0 29 20 29 20S 28 2BR1S " , P}P r R < "4 " 8(P0<S 0%4,<%<00.4$`<.,,4<&,| 4& 80<$0480 < (0480<,0 4480 <*$,00 4*,80 < 40R$0SO(PA;9oP`ppRi9@-@-@ / ?!BCN6 @P/P/0 00P /Q0*   BR1$%&'()   " "        "P0/  O-RPMe @T Rp ?o2` qAWsp 0R0 \\S 0  0C1"00Q!  pW ` `  0 1 01 p S pr pm Vj0S0`S 0]P @0 0C1"0!0a`oobR@H 0 =0A0@Ѝ@P PB WpGq0X  0 @0 A@`0\PЍ001 A0@0@\P0 01S Z 0I`a]P0Te 0A1Q=11/C-A MT' }TP# `P  8ڷ 0 շAT R0 X 0V@T Ѝ0]P 0 00 0 1 01 0/p@-Pľp U@ ;p p80@ɾ8@@C-!1 0CMM0,40@PP; P10L!,` @ PC*0p AqFp@ p#  ዾp U p W 0 0 ,4 30CލЍl)0P70 P=k7P@7?00Q dR`RP |QO-@ş` LMQDpP %00 2OU  7004%,5 0 D0 30BLЍ w0Q1S4 Q$P䁄-  00 0!00 B{R00:!R S[0 0Pʰἰo  R !$ 0P0 崰0U P 1  AP: C  [ *00C @ 1 A01!8 11! 0s0n(0  0R 1SR  W$ U} 20 2\(U S w0S1*S: pE 0000 8000S0,p4040,0 p0 0(00 <0@<0$010 0S$`U0 #P 0㸱0 R4!|1 B00C S010{/ⰰ1 2 Y 0 LpR #0  PPB # 0 z R[p ! {0!i A  BS0 0P +1 S0"1!LA60084P O O-@( P`M G ഑ 0f p[0p pp I1("818#8CS("(p ^01QA0c8#8S 0C8#80P! SA(0 . Ѝp0Q1S  ( @a% 0  P- p p p 0 0R1S0C1ŁW. V1`0C0 S4Q]Q?X@a (00(0j)0I 1@P(00(0= 1ԡ0C0 0CVY:Vp0 @agP 0 @1PM Q10C0 0C ?"P p qP;(00  (0"0!0!0 $"Pu 10C00C 1P(00 "!h0 B00C ⴑ@P 10C⣠ 0J(00(0 }"pp@-@PQQp !P 0 0f"Q !P 0 0Y"ppG-Pp,aV0Ff  1!@P `Vᆐഡ 010C08#8S0SX PP  p  "   J1 8F1V ( 0 R 0 1^1 C`fh&hV 0F8#80 \ ("( S10C1 ! R dP  0! 0vP!O-Pp@QM !00 2BT T M400@Ѝ(@ @[ @Ѝ  `P RA 2@D@H $HdZ* P  0P !Aᴠ@D@H$H0JZ0  jPT 0p 0B8R#80010C08#8SP@0  `P 10C08#8S6 1 1@0C08#8SP /!zTPr@ 20 2ЍP !10C08#8S  ! T 0` 0! F PH  0Sa S] 0S0|  뼡,p W`q  뼡` WY  J! P P" 1 Z0C00CR  1H $H @01p1 0@1 @p01  , P@ `Fv 0   P 0   F  m   `PI2P^ T X} TS 0c300  o  P , 0R Y \ qW`; U q0W `0G 1P WR  B1H $H @V0`F1@1 0p / P`Fs A1@D@@DH$H vp@!   P[0-M 0P ЍQRO-`Ÿ JM Mčpt" R  PRLI@IU/  P t200 "2 0 4 30|Jލ Ѝ >0X0 0TXS 00; Ii0$ U"* 0S @0C/[007P0: S 4200 R I R*2?00A@V# 4- 㺸p!20S X  \0 RK [ P200W p P 1@oy; GX; xR Q0P:Q0Q:,@-@-@@! $ @ H p@-@[PX#c.`RP$ p@豹 0@-@T M 000 @啲P 0S  ЍȿD O-@0lMdP X0o, d8i,dp *0 S00 $0U EX 00 000CSxutsrqonmlkji71a V0 03 000XQ( 0L5A 0 @8D @<86/ Y``10 0,Q1$0C00!0ğ B 1 ! 0C B 8 #(!!#Ȉ0 000Sc  0S  2 0pPK  뼁[K P p,\1#0C00010C08#8S 0C8#80S 10C08 @ #8  S  0C8#80\ 0 000S  P p  LЍ! B("8 1V10 ]"     n 0,0i  4#4 P 0 0 0RX2 @ 00 K , G"ȀB p C !X *("( B∀H 0 1010 0 0 rp3`"h      20 Up00S7 l 0 0` =P0 p00VG- `P'@PN `V8 2 > 0 `(  pW' Q0: R   4P9 `10C08#80C 0 P0 0RpW 0 10C08#8R p W0 R  p 0R  P ` nC-@P`Qp$M a00 WW 07J  (0pGW][:YX6U0GS'00$Ѝ(0}W% ,0u110C0 8#8CS  (101ⴀ  P,0p1! B ("(R  1p  jP弁pP 0 00 P(0r00㸁(0p= `P] 2 [00$Ѝ0S 0S  0X~弁  0po 0S !0!0  P^ W? !W< W(0#XQWR p W!  PC H⨀H(弁W  q1긁0(0弁{g& b⼁n(01ḁ0C08#8(XW% p HW  PH(꼁,0WSDq X0G 1, P꼁,p 1ᴀX0C08(#8X!弁 X0H 1 P1崀ሀ!0  1 nP pp q0C 0( j각 0H⨀H(a0!1 p崀  EPp@-@`PP ӥ0 00(0`00Q(0pO-@pM,0 01 !PD a`F`h&hV2 P`X%XV! @H$H @ 0F8P h 00!01@0 @w 0U @EH$H 00@ 0 Ѝ "  U ! B ("(RQl0 0P Q P !@ B  B  2 PP  2 a0S0 > %a 0R P0F 1P @VT @D!H$H@U `E!`@1 0P  pPF A1@D@@DH$H VP@!  XP `  ἀ@P7   㼁0S0 2 a1 X0C00CRK 뼁0@S& 0H 1'P[ " PVQPO Z PA F`  A ` @Dt  1 01`01z P   ("( R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ဳ @-@P , @ (m$ 0"O-@2,M0\00$0(P 00$` 0p@ @` pP 0 0u$1` !0`!%g#"," !00 &Z0e!e!   0 t10\0 0` pP 0 1 cIC$A$ 00#l! !00 %b !b  A@YIH$*E$00@0000000 00 0 0 00 000 000 00,Ѝ|XC-@PP M' $q`?pW($7 )#0(0 `6`p` b8"#4b4# 0 V@h # Ѝ 08R(@R )p@ bz#8 s#)p8 bm# 0A-1?`@Pp @f(X( P 0刁0 0$0@pG0($0p ?W6@`G?`@`` 0$ <@P U 0$ ?pW (j 0$ q0 0$ ?W@`G?`@`(`@ W 0$ <@P U 0$ `R @-/ L@-@P 0 6@ (" 0"R @-/ /@-@P 4@  P" 0$$茆O-B@6\M0^~?@0P0D00H 0 0p00$00000000(0 0,0000(040,0800<040P0H`8L 0 @(00 @,0 0P$0 `0Pp`p000 D00h$7$)'90#%ɠ%'nj) "ˠČ 0#ˠČ<0 "(0   (&Ϡ' .,80  * $ )'& )80冼0姳 . 0<0 0 0 $0 ,  04 +  !@0 S(00,0403`0~?00L`Hp@P@`       @0 !1P"0?0#`%o#,.0#.,',YW) " g Y i WP&8P[T "PP< !Q` PPqQP0yQ@^vp'Q禉0Q4PQႆ^P%"#-&S%a` " P08{t`p' 0 0 <0#0.0` `!4`0( PP0, !NP/*! B@$*n /!!bp`&,#@$`& '@.p p " @.$@0`@`0P$ PY0p(,[ P@`@@0@ 0 00 0 0 0000 000 0000 00 00 0$0(0$ 0(0,000,0008 400 40<0 08 <0\Ѝ@p@-@@DQPUP`  0pRPQp b(!o Q#!0P0H S@ Op@<R Q b!2p !@0A-1`@Pp fPX; -@0D 0 #@0D  H00H0L00L0pGPpP3WR`G```@0D ;  SP@0D *H0L 0 H0L UpW P@0D q0 #@0D H0L 0 H0L W`G``P` @0D ;  SP@0D *H0L 0 H0L U`R @-|/G-@PM 6 PH8I `p `@ U e Ѝ@-@P 4@  PV 0$$h|R @-D/mG-@PM  PH( `p `@h U , Ѝ0 ` a!, a c,/0@-<PM0AP@;P񏐽mdm<840PLHD@<84|xtplh|xtp<84JIzP;DPnE@5Py|{xsrqponmlkjih{xizQPedMl]\[ZYXWVUTSRQPONMLKJIHGFEm[6Pv  6Py 0P9@0Ġ 0P%0H 彠p Hߍ?CP 0P 0!@ 0\ߍ0= @2S, DP(੧00  j 0Ϡ@P000H Arp h0@ P000H Aap D; ? 0 0!@0H Hp HP ߍ 0d 0 F0y@0Ġ 0 P`@0ĠSH@0Ġ 0d 0a 0^ 0[ 0 0 0 0O 0L 0I 0F 0C E0 D0 C0HP* EHP$ ? 0+ G04@0Ġ 0 0y 0v 0s 0p 0m +0j *0g )0d (0a &0 %0[`Rp a@ U 0O 0P@0Ġ8@0Ġb @0Ġ@0Ġ B0- 00P@ P0H Am0pH0 <0 ,0p@0ĠX@0Ġ Li(`4JJWO-P 1` ȁ1!004 4PU 08  R88P@PX`0 A@ Q0 801248 Q!:0 S 808P:P8ݖP 8 ` 0娚`P 80008PP8l00`g꒸ T 8 O-ɟ M@pD,\($ 0 PU 0H"4S3S1`90U 4000Hh00 P.00e d0R 0h@00S d0P01 0CX 0 -?01HB000 Zp90 pS000S0!Q0:X Y 0c/d0P0c/K0  00S 0 Yp 0 SRPU 00$ R 00"00'p7 0 2 30ߍH2SL708 R4003 4P0P\ R400P4`400刀@ 0  Ùp 0`U:` 86(0_Vࠓࠃ6048 X00Sr  0\ Y``VP `PP$XY0”2  \8Q(( Q &P`00S 0 SRPU J00$0Sr00t8Qr 4Zx ` Z``q XPF 0SU 0 RP ZaY0MX  R+c/w0 0( Y2 0 SRd@T 00$0S ,0S  !$0(0S (0@TP $ ] P 0 SR@T 00$0S?00 ZY0 0c/d0,0 p 8Q 0 SRPU 00$0S00c/dp x@ X P2 `0 R(SYPR`WY`P2 08@04*tRP?%P0 S (0( PC_oXRPU``  0S0S \40 40 8 \R8 \P0` @ v` 0 SR@T` h=00[@ @ h M`{(0P`2 ` ;8@P@,@ bY$0S@00B 0X0 0 SRPU 00$0S/@ h @ a  h x H ` t \ A-`PpX@M@`@V000,0 0(000i0@GЍ| @- A0@ @ €1Mp@-P@Q 0P ! "0 2pp@p@-@P` VP p0-P@  P 0S RP0/P*0    PP0/0/@-4!41 0MQ020' 0S0. /!PR*/ "RR /@ 1@D0Q R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ D  /O-0,M "!  P  c 0pS PV `0@"P`@ (PP '  ;/P ;/PbW0 0P``V0c   F BR R  L B@ER !R6 0T0TG SX:P0C 0 0 0p0pSpP0@ᐨ(T **p@Pc`Z* p  Wp ;/P T T  0 X0 W p0p0W:,Ѝ  `;/ 0P 0D  P@V. ;/PW W  00R0 0 R0T 0f:W  000@D`W 0XW   S W0 0 00   R0 0 S*T W  RW 0 P  WF  P  B B@ER !R AI;/P  ;/PN `P0  0;/P  ;/P0F $0;/P ;/Pڅ00DP 0;/P d;/P ;/PPWAD S  ;/P`  R0 RP=0 C 0N[P1 0 C "! R  B B@ER !R A"! Rw 00ST;/P?P ;/P8;/P~ $;/P$`v ;/Pa ;/P Y ;/P0 0P $;/P`X 0 R0`P-0 M0 Ѝ`R Q0P:Q0Q:@- C- 4PS@ M  $3/`t  0 QP` 4P4S  $3/000 Ѝ00A- 4dpV:@T@T 0P0S  00 S  0@P0`0dp@ B ! A-`M p᳛@P0: StӑPP ˅P@ P 0 !tdЍx00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0@< ,` 0SL@-  00AS 0囒O-4MS{@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0    Ѝ P@ $ 0  { QP 1$R P0)|00@000dS0  pq0Vp 0  $6/Ѝ 0000O000Q 0A00/0@-S@  R   0 0Sp@-@PT @T 0 `pp@T P`p  0S S/P/$(0#   @// / ////@-P0S`@M:Q !S@Ѝ0 0pI P G@FЍT 0 @00O-0S( P% 0S" p@p" a,0T T 1 !3/PS00CS@D0 T,0@p2P ?0T` BB \|  i V`! 0 0C00`@000CS0 0T` @pQQ   D R !,03/`PIʼ0@00 "R( Y `1`! 00PVQgRJ,03/`PY M 00CS@D0 T@0Tp  P@0S*V* 6 000vP@DS*`A 0`V:ҏ0P 00``F0 ``i  0Y0C00 00KP   00C000Z`  0005P s00r 00n0% p@-`PV 0@0@DT`0@T` ,0 3/0Pʼ0@00pD0Spp@//0p@-@P0 0 Pp 0P0, @ᅑ qPp̴ R0  R/ S/@-0 00@0S 0  R 0   0 0c0   0R0I_0 P @P 0 0 $0  @@-@`p`pPM   iP0:*C/o" R  S L D0( 0R Ѝ ; 0 Ѝ;0 C-#3 0lM0d000RP@ C 00  "2 0 d0 30lЍ 0p0S ` 0Py X"X ` 0R00p KP0 0S!$`@ ߒPc 1 0FB0/Q/M-,+*)C'&%$#"! C- ##`00  00t 0SP p 0b `` ` 00 `4hPb<  Tp@-@0MPᨏ00Ta媐V( ⻐0T1S O0T1S子0`啐 00UTX!\!R Ѝp@胏\!㚐00Ѝp@z00UX\! X\!0 000S/ xp@-0 00PUp@0X00TQZU0` TQUP LpX1P0X1I0T0`X1 xh0h 000S/@-@010X10CSX1 @(T1O⅏0@!D x0 000S/g̬ x0 000S/p@-P@0U0 \AQ\ X10CSX1 p@`0T1OQ0p@꤬ x-X X0 04M 0,008 00 0 ,0 304Ѝ| Ы  噖t,@O-MHP@0@Q0@0BU PR"S0`8 R>  "   T0"] \haa0 00000 0#0 0#0000``0000T ^pp@gR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@8Q `T ` R\ ! ݑR00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/p@-T!T1 @0(MT0$00: 0PS` RT= 0ST@ 0 0 $0 303(Ѝp (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@괧ԕ p !l! O-p`M@P-TP0 +Tp S0T W  p S  0/j  0 ?0 0 0   P p P=Q PS \4 !Ȏ\ @00D ^a0DSW0DA0DS.70D S+| Y[Q PS \!S@` ("00!"00 0S \0F0 0 ЍS@ `?0t0T0i XR A B0A PR W  p\ ppX @p` QWKppK0@-BR"^L M @000 Ѝ0@@P00TP Ѝ0 p@-BR"^p@ @P0T0Pp@- M@P`0 pUT 0S*<P  @p Ѝ  @@vp Ѝ$S T@p~@@-0M @ : ݍ4P < 00 0 0 30ЍO4x  80 S( 0 / ̎  0 S 0,/ 00<0 S, 0 /00D 0 S 0,/ 00T<0 S, 0  /00(|긍  0 S 0, / 000k<0 S, 0 /00<Y, 0 S 0,/ 00DH<<0 S, 0 /00P6ꠌ 0 S 0,/ 00X%<0 S, 0 /00d h0 S 0,/ 00l$<0 S, 0 /00xꈋ 0 S 0,/ 00<0 S, 0  /00 P0 S 0, / 00 <0 S, 0 /00p 0 S 0, / 00<0 S, 0 @/00 80 S 0,@/ 00v<0 S, 0 /00dX 0 S 0,/ 00Sh<0 S, 0  /00Ä  0 S 0, / 00080 S( 0 /00@ $0 S 0,/ 00X80 S( 0 /00B꼇 T0 S 0,/ 00 @/ /H-Mh 0ЍH-M 0ЍA-`p@P0 8#@T0P@@-M/"O R ?#0!PO$: P!Ѝ  0S RP/0    P/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A -- M0 09 ЍЍ/0@-0M 0 0000@>S@P  !0#00  P0ЍZ0000 @-0M 0 000@>S@ "0!,03,0  dP0Ѝ700@-@W@Wp@- MP 0 0000`@`0@PP  BP< (0 0 0 30 Ѝp<  G-QP@ ` S V 2" RpSR Pa 0Cj /o?o BR00 b8VS& ?o/o0CSpp0 c08ϠT \  Q0SpᢏVP00B V0 0T0d0?oc008?o/o Brp!0 S c10pV Veo0`08 @c0q< Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /o 0@-@$P  000x- /-$0$0 0M 0Ѝ|  RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 0000@-Q @% ST 0 C0 P @D^TPPU0N QP Q  00S@R S Q0 S 00 /U/ S R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ ^S QNP  S^ PU@Q @0S Q RU // Q#/  //s R RS0  0/U/00 0/ R S  Q  R  /SR  Q 0/0 U0/0 0/0/R  -/@-\0 @@0Q00R S 0Q00S0 0/0 0/0 // Q#/-Q S  BPQ P0C SP PU0-Q S Q P 0S 00P 0@-M | @!00圈圈00喈 ᘈ4 ,0 0 0 30ЍOxs s 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/4 40 00S 0M00Ѝ/q x@-@p@-0@ ,ppP^0Pp,//////" //O-㼱` Pp U4M s i1 00( 06/4Ѝ0 S@' (!S0S S7 2S@0SQ00P00^) 00@[0 0 T 00 "R 0SPD @RUl00 \00 S00000@P|hT//O-˟ MQ0 ; 00$0 0%SSSJ 0@p` 0FZSZeXW_UTSRQPTM[J;}|{zyxwvu?>=<;:9876s43210/.-,+)('&%u#"A  TO V V @ 0,`,P@X  6 Q ZK:  Qc ^ Z034S0C\ [0Մ0ʄ R*f @HT@Db [ 00ʄ@T*\00F`00F Sbp   0Ϡ0 0Sp0-p 0000t& 0ST{00@ P T @Q0N @X  Z*  QHQA [0ʄQ*p03,-  t QT{@ P0X08h`p`|0PU t0Q  _ P0~  BT@0d DG` px`0$ p 0t 0ST{00@ P|` D 0 0 000`lV` pp`{@ 0,P,`p`@p+``pQ ` `*VS 00F S@`A@00F S`500< 00 0 0pt{SN P 00  , 0e 0N D L$ Z  04F HP@ 0 [ 00ʄP* 0Q [  [  0[`ʅP.10e0PQ 0 0LN EP D L P00(: ` c & BP Pß|c &h `dX0Pc* ` PCN0C D Ly S 0 000  0 X  0000V h 000 0 k< 0 0u0 Z0J0H",2 0 0 30|Ѝ0 0 /    V@0` @10000 y ; 0 @  7    @ 0 0 QPv00d D00!@ Ϡ 0@ @@0(0"(;0000 0 @ Ϡ 00`@0O0JNT0 0 rn d cA-`T0T 0pP@PU J0PES 8/`uX@pWb | 0SS S 0R / 0R0@o/ @- oO-,,@ CM Mp4čP`0@  0 @0 44 30,Cލ Ѝ 00 00p0 `0p2P y}t 0h pL+  }  0}/갚a `a Ha ,m@G-0pS+ S'QU$ X!`@0`S  0P 0#S@0S 0S0S0S%  P V Q@0 R!R  "R0 R R \O- BMM!dQčHd2 hԀ&h Pp 0`V' 0  YP@P ULZIZ0 ZP~:PH <0 0 4 30BލЍ_ 0^ O-LL AM @ MTč4 0Y/:0`x0(SP05 R%S3 #ttx0'x 0@T YY0  P pW t   0FYPP D0 0 4 30Aލ Ѝ x (R귙] \ O-M Mϟt p / 0 P @T 1S 6 S`1  0 ?t@X@0 X0 p tA @0H0 ^0S3 S90PpP@u` R HP' p 0 ] 0奂P R!R㇓ 2P PpU`@P0ST `u岀0S`V@ 9 S 0S< d - L - @ T p P  Tc0 <0040v?D0\@4 0` S1S < 300S S00X01< 021帑Y[0H0tSp080400SAT <0CP D0PpPPw 0;O8@  P @0P P  4 <0 @4 D 0 T<0D \@0S  H0SQ <002p0^ S00H00SS *pt`P|@600P @9/P"8`0 0PF 0  Ps |+: 0 6 30hݍ ЍpW 4@P{D0Ppw} !GD0Pp0 e  0 : X0T D0pd4000S70X08<0PS\0S  }P@U  0`F0P?$P 0,0 蘰 P(0 0E0, P [0.(  QO `1  0 T90 X0L@0 Y  @00@01$0 0 0 SO@0b0!0\p?A9c!YP 0S @0P Xz0T(0@' |  ,@0P@01 Q!  (8 0 {P0`1  0 70TX0 @00 00x  1 01 0@0`1  0 (70X0 @0r0 M 00 X6PW0&0< p X9|LP 00 @q @1W㲐@D0 `TPv? 0WP G  0‹2 0U 000W    ‹0v@1粐0 0 p5H@X0 0@0! ~P0D p@0P ~y0$0@$ {  (0d00@0hy0$0@L$L {0 AQR `1S9 0   0@ H0@@`Tiʋ |@ A`!!! Q=   30 @| X0Q 40H RC A aV *Pv|@0p t@p6/P񏐦]0+S .0CSV@T0POPPU a0 2@X0 0`!02 @HX){i S0\01S< 3`0`00S S8P1< a`0 ~P 00 `}P101@PD  &VhP p ` \}0P\`0P 0D TP B("(R D0DI h}P0d0P0@@ d06SF[D `\ <\ hhhe`W dCTbta\a_`_^ ^^]t]\X4XHXXWXWVVUV,VTT|TSSSSDS,RR 0U6pSZ06H`("( DP TP B("(R D0D }Pj0d0g@e0P x0 0@$!$ KzVW0 0R 0`1 d 0 L1t0XP0 &0R  Rw0!0@! z 0 P 0 1 X@ 0&0 R  d \H0S] =00^w0T"0t"t y4& G("( 0R00 P T B("(R D  R,#y|Pʌ 0 ]0@ 0~P`P 1011S100 0 30 X0z,<0d0d000 3@X@0" j&0 R  Q$0 4 X0 Y00g0d0@0P #w0X$0@$ fym0d0j  `0 ^`0+S .0CSBY@W0P v0$0@% =yW| 0|p0 (0d0q87P50 @ /@r05 @Xyv0%0% yP0 @ v0&0& x/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@s|P$Ѝ0 {|P 0"c110$Ѝ000$Ѝ00@-$MP@N|P$Ѝ0 V|P 0"c110$Ѝ000$Ѝ0M0- 2a@@0Ѝ/M0-  0/@A#b@0 Ѝ/MbO-@ßBM M 1Pd$č$p000 S00- 0p  P@QP0| T0T PN0P0A !< S  0 ^wT40 ; P0 0000 ; PP0 P0. R x`10$430OBލ ЍS  R 0S0Q4 Q. Q( R     r , "44 .$$p8(#8"(vRRRrB $@ @-PP@ ,O4ONC-LLP AMM č@`p04" R3 v 0@` Uv P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R` @@H -vD D v*RD? \N> |*MMO-嬡 AMM  čRzpPLpPG `vPPB t @+0?P7 0S4 `  0S+ 00@ p'2P00@S 0S0S 00@ @K @ t @獬 ቬD ,0 0 4 30AލЍ虑= = M@< O-ß CMM`,č@pPX\@Q0S  .S@0SV:T d10S#0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $IQ000$0D DR @@ 0S+ .S& 0P0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@1( P/d!  0Sx0h 0@$0000\0@P@Tk0!0$  00$0s}0S 0S PV0 gO0  PꙐ; : O-p0Ÿ\M P@`&T V 9 0 D#à  #4 : 44U@ 0U 0 \Ѝ10>  0 tVX0 0 0 FOP0x 'xnPkP0SUPPH   B RX00 0 BOP PPMPNPGP @ຠ\Ѝ0 `F 0S0   7P 3P 4P0 +P0S 0  @<0\Ѝ7 HFG-@0`P p)@D T@-)P0W O0`  O O "440(",40@$  lPx  J0@ʏy p d10 d1~ P  `@ o`0D@SH _H S`\  S S00 Q`@0S SP C0SQ0 0CQS000008qP PP@0 0+ 0~:P 1#S;S 0x(S 0l(Sw 0`(S: 0T(S 0H(S <8R0sS2 S S(  8R2 S S0S0 S S SS@@ ` `0&o_AP`@Q"0A'A+S? d7R2 S S00 R00S @0 S S00 0S S 50  00H00@06w 0, 0KPj< Rf0P 0< 0R@p0}@PP0d!S 0 0 2d1 1 As0 |3嵦1 |tpA τ0`0S V `0`SH@DH` .S`0SV Pp.O`FV00W0S 0 0P $ )0$00p4 0 5 30܍Ѝ4 RB T T Z|44P00$0l40p000Pp(`, T T@ TT  ;T RO@T $0 ` ;T 0000@@T P 0 0P  @0劁 $h1P @@T;T P3P0 0000@@T;T   P @ Zl@(`,0p4Pt 2R2 S S0Si0 S S SS@@_  ``m _AP@`0D`SH  \R?* S S00 Q`0S00`069O<P.dP `"n1=C` lDQ XaD@`oQ<0 SQP@* P  @0劁h1P0- qA`>`Pa 02 Jrl* H* 'X:0: domasearnamesortoption 9in$er7܆55# list`Lch111!1 p@-P@hlHM QP  T 000HЍpp Qx#r ccsV p 0xP00isPT $000HЍpA-p RP@`0P  R P  @R0P\ R 0  0 O-h4h0QM n0P0 pg0P0 0@P($    ?`P{ @lPY 0& SQ 0 - 0 !#Y㌰pG 0P ` `P lP0`S Y 0@000S R# pGPd @0Z* @ $0  T Q A PT pG #Y /[5 0 iR00pQߍ @ $0P PEQ*$P0 0 0  PY a 0p S : PC U 0 :` PE0IⴰR 0 ` VPE$` R PE` T$ (  0 PE a T ` Z  0  P巣 0 0 Ji 0 Dix夣 0 r| h@-<0< 0@P @M7 0 0m @-$0$ 0@P00< 00/x @-@P @'700mD 4@-@P^000@- @P  0 p@-@@000M   nmPP0 ]P ?>P-  0 Ѝp%Ѝp  0 Ѝp @-d1d0\!\Q Pp 0 RpGS` M, `5Qp5 Ѝ A@jP! 0jP 0S@ R jP@  0 `j Ѝ|| | 0 j ЍXX X 0 `j Dxdxh'l'T'8$''4'0A-0PU" 0U"0PUP!q@@``FYgP $QgP 0!E`1$(`P 02~Pw''v O-Ff@0`S M, 0 4 & $0( |V|FP@RB 1ȖqYT0i(1<0 BRQ#)16:  50(< ܅ 1 c0Aş0 p('(p4 < P 0(0 Pz hup40SgX% 1S H 40SkH6S (% 4 0Sup00S S404 RR 4 ,00,000Sğ0( 0 0X B2*3Q Pq Q^P( 0D$ Rp (40$1%40(8(LiP0440^# (0p Ѝ! qQ 0Q*# 0$|3p040(P8p!@(%01Rx$#30<!^ ^ ഇrp S:p 0("< !0(0% P^4+|20(  l20(<  X20(<  D20(< 020(< 20(0 208(  0聟0(0( 10( 긁(0(10(0 R 00! 0t1t00`10Op (4p Ѝ:p N5p 0q^$nqp2  Z 00K h,v uuDu0uԧthtltTt8tD$s|sls4srdr,rqqxxqdqLq4qqqpppptpPp8pD , O-,1M0 X A*1a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y$00 Ѝn m@-$0 0Sjg( , A-@@`V 0 CQPqdP pG PdP 0`0Xm@-@00 R \\  $0!0D0 0@ ($ TlXl@-@PL  0S  T0S@leje@gelP/0-` 00 0Q,000 P0($0 kp@-@P0`H P 0(S  1T  0 $000`pkp@-`0Pb@P PbP 00p. A- 0@S  P t00  ( $   PH1H0?:Q@ Q$10 p?  960@`@0O-i  ̣(i|dXh,hpg\gHggff df, feeHeeTdpdccDbataaa`D^^@-@P00Q  P    $00<0 0@ ($ h]]p@-l@@`VpPPp"0U1pPE1PSp ( 0$ 0p\QA-pA@PT`QV0)_@P  0 p"PP``p`@D A-p`@ _PP T  0 000P   jg  @-@@0/ 00(/[000/Z004/Z00/Z00/ 00(/Z000/Z008/xZ008/dZA-``PU 0AP ppR0AP`404 0 ,(0LZY ^``/-< <0  M00( $ 2c ЍY \ @-@}0`00@@-@Q 00 2 5 0 O-ts`Pp@M 0pF T 0S000 0  0 0$ -0PP 0 2* "V &= " 2? 0  0 1qp  Z Z 000@ g@PЍ <R 2"00@X 2: 2 (hP0 0Z 2< 210 010010 010 0|100t100l100P 0 R00   0T 0 2 13/pTb0-00wPP 02 2tu00r@Vn@k0S{Z} 2: 2d mPv 2 @0 28001,00P 8<,C-@`pQP M 000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH OP (0$( p 2P ;00 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p $ ЍR @-@`pQP M 00U,0`V( 2S * 2 P13/PPF `P 0 p{ 2P 00 Ѝ  Ѝv00PO-1PSM0:00 X1*q`I`[ 徘p@ p W 0 P tZ 2< 2ЍЍ]P O-MXr=*`00A̱P兘pP W [K D]@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 9 Pu 0SЍЍC-"1`S M2:rWB R"*T$* RU  R00U00SR v0  PpX U"B Ѝ 2< 2 ЍB]P"! ЍG-pZ RbM'*Q* U@0U @ RD0  P X U 2< 2Ѝ@EЍЍG-邀഑@ 0`P? pp Ip(1"(R B!81. !0` \ 01V 0N 0 L Ƞ,Ƞ\ L Ƞ,Ƞ0P08#80\2N0C2Vpp@- @UP ` PP  mpPp@-P`@Q _00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M $00 Vu 2+ RI 13/p)  0! 2$  00 3 p`0 9/P 0 9/P  c0P 4Ѝp$  0qp 0 ҖP 2: 24Ѝ?p`(0 0,9/P 0  0 \qP   00(!S$! 10$1P0 ]P @p0弐ᲀ 0p 0 S 10 B\x ἐ<'xP  $1 0$1(!00O- @T @0`0CS0P@D p M!P S RP' 0 0  dP 8#8R0 Ǹ Ѝ0 0S0P 0 0PA000@- M@ P p10 Ѝ0O-M 0`p  0@HPpJ  P6 D0@X0 $⸰†Ạ ะ + Rἰഠ B0 `p0`000SD0XЍ 0  xP  C("(0C 0@0 0MP @G-plŸw?`0 (MR$@l2 S:0JS P Pp2 S *p 3 P ZPpA Z1C PJ: A  W#: 0C8#p#ȅϷ 20  2 0 0 $0 300(Ѝ00C @ ష1px'x 8p 000   ` 00 p匨P202rh  A-@pPQ`M s00 2   Q `:1Qj0" B1"000 VI VFEXBAF?0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " Ѝ00Ѝ0PU Q:(0 $P0PU`POP  0 QP 21 sQ@--M0  @ Xh hP 0PSP000S 3/ XfZ 8 80 $0Q/ $0S/ l p[<<0 0R/$ 0S/k 8 xx[A-@T 0Sjp`/XP0P@Q0@ @@U;P 0A/P  b''h%O-@$M`zRT \pܴ4$$0Rab    tXpVBP b0@SFSC|Z[[ZZ[[[[[Z[Z[[[[ZZZ[ 463 3$$ 3$ $ 3  3$$ 3$ 3($ 3$,$^] `3$pd `kU$Ѝ $  ( ,  C # PU! Pp "P]U@P5 ` R!PxB `  p  BR MpPG Q]($R0 U tWS UX,$R$ ^jp4 Ijp0 W$RD $pR $R !T&@ $R $hjp P$R& U Q R  T$T&@ @ $a5  ` &@ T `   ᭊp Up$R UM-jp -)jp P  ^jp U?@ Pzti^)L%% 0,%(h%% h%}/<))O-@`MpPxQQ뤳3#@ @IXp#x3B RP!GP P( if@(hPF  H@ Pl`<_<_<_`<_<_<__<__`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X @i` `Z`r`T HyPP   `Pd 0)ȱ0V!Xq``pWpP @ ;% B RaaabaTb4baa4babb 0S U X x0S X  R 7/ P  R ?4$ bQ  $ YQ  _P0S PX >Q%),%))))*O-PyM`wOP0p I 00 00 Yp8 PEU( 0Ra S 00 0 㤐vPePRP&GPʝkf0@SdccdccdcccdcdcccdH0@ SPdcccddcxdcdcdaP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0Sp 0pSppV0#V PE4V& 5 P Q6P/[  0001c0SV0Sppp C C0S S/R <Vp0SDUa(0S0S 0 0 Vp ! 0: S UH/[0%ޏ V0: S0( 0 000JPU   G0P0 $0P 0)I0P @/P050CS"ggggggggg$ `P M I `00PPJ0S X叏0Sr 00 $  B R0\ L` V `,Q& /0  P@0`0 a P0` J/R  S/R/   C  R: x ` 2 3 0S S/R$ 0 SR& U0sX/ HL!R\0X\!R\ X00: S h C C `U0: S P1: S ,T : S!  Sn  Sf g S_ S L0S !viPL,0SK QF0(尥 0Z Z80 S80p1p!pp'Q zUP!P1: S p00Z0S 80 0CS!800 0gPR X0|XT D0S !ni0S !Ii宿N|% *%*K*$%*,%8*****+=+q+%+D 6++L ?+O-@PEuXMD&7Wp<868V@,FjP60Pfj0S0 8 PSP 9j4P0805HP40jP0%.(0@jP7P0\ X5X%HPcSP8P H08 00$%43/00P08004 j4Q 0U0!jP (jP 0 00000 l@0D 0 lP0; S @,0(D 2#!H8 01/0TP0P( VT2PP P0Os0 CS 01#S jP0 0( ,S* B"!0 0 j8PH0U 03/p;0SHfH0803/p,^PP܂ h`0ld 0 GS * X  0 $03/0  0-Q3  Q H0Sk0  0 -1/ s0P0 0 0 0 `0d 0 `0d P0$ ,!j 0,ؠܐPYZ0     00h0 l 0 h0l   000 Rj0 0013/s S]i S=biXP\`0N ( E(0, PU`00 XP\`= :#M/%| & 0%&/ 0&&/`&  P&,0zO-M Mps4#Lj$$H$ tUp 0 Q 0  s0(0G@-P񟗙 uutvtvtvtvXututvutvtvtvtvtvtvutvtvtvtvtvtvtvtvtvttttvtvtt u0utv00$C`İPE@D0p/SP/P0 S: p  _NPPU<&%ؼ<A-`P@Mn D 4 0 MP  L MP  L MP  L MP  LPl奷h3P0`3P P$PD3( 0P+( P3( P7( P;( P?P ( PP( P -P8$@Ѝ(P (P`T"C(0S ({P(0S (qP(0S (gP(0S (]Pq0S KP(!0S0S p X`PPa D1R`PU 0E /R ,BP(哿PU  00,0/00)v00CSdxP0$0u00S p&!0s00宙ř'h%\Pԍ'W\%\5\&8&]A-@PlE`p Np 00S VPLP PP ``P $ 0@.Fx%%% 0O-MPlHEp`薟F Np 6@X/ʼ60S ЍfP WP! PP ` pRP dP vP iP0`0 prPxP ``0`0`$`a࿿ [1ES ᓵWBu弅PU *LP$0 S0St( @[*0/S /P0.S0S .S0SZ 4 0 R  @  0P0SP$0pS 0S@ 㙵`P T\ჶPP0S <8 50C SVhh4h(phh0$S P PTE 00$ @JE 00S $ ?RR00R0SW3 $ 4E  @0SX  P | 0!0 0C0 JP 0S' '0S 5S 0S 0SLKP0 0~ >zX 峾PtJA0SmP h0S 40Sa 00?S] ,0SᖵD$0S 0?S 0SS D d000: S0S<0S 0: SIP1 0S!  S/o" R RP S-J 0SJ ᯾P 0S 0?S 0S0S g'%tg*ggG-P@jDwCp8a Lp 1 R1 `0C@P 6DpP vP0pIP '`0S oWP /P 0S 0S0`IP0&00S N;%'p@-PM Խ 7 $ 0H^IP^I@uJUITD0 00HP00¡CB#P3 gP 30S S! S  3CJ d3! l3 00T30S  R 4#6 R #!SR3s3 3 !20S ( 2 20S 0S'002@T$P0"1@x<B00CS00  0 D 0S60016 R0S 10S<'\0PT<V0 01 10SQ 10SM("x1d1POT10S P10S l1 `1 0S  160S 8 F@$1 I01 (  d0S0F0S 00q0S40S 007 @`|P@qTosꈕ's%''''ȏ'ď'4 s%%s'H%ԣ's G-@MP DiA2br@@0 S ֻX "$KpC 0 L1 0vP|7x IPdl%`x IPLd%H8 HP4\%T; 0DS 00S8 @0xL)0QD0@0 0Q)@0SZ L PUa0@S񟗷LT@|DGP \@@L& (P &P (P 0@0 00 @L7BL8B0@0 00 0 夽PL&|\ +D0S hx |HPT$A%%Bt @ht@ňt@Јh%,ۈƅgt@-nhFAO-M pehtA_@0o0C?o`DT20<$<4@@@ Gp$4 4 00S ST [@ Y`> Z``: JRPGPP! +H@ P꜡@`hP dP fPvP$@``j1 00T 00; R4 : _P @w+A0S #S!J+d2 00 0 o`PXL 0pL#>.  P (:p 2p G+ Gp ̀0S<0 0@0050C SR\tttt@tt@tdt[ e@P^0S? 0㣀$ p@ G p0 R qX  Pp P    3/P00 S #$ p@ t pZh000S @'%%,.x)')*O-M MP%sJ ^n s5 00 5-s5005r<:0 00P :+ ްpP pVP +Q A@6P񟗹ЦxTȨ`ȨȨlȨȨԧħ(`Ȩ ȨȨȨȨȨȨȨȨȨȨȨȨȨȨȨȨȨȨȨ̨ȨȨԨȨȨȨȨȨ0WS }055050p HpQ Q 0X(tȟS SSy `050505484 ុP 嘻P* 7*ط  pB0"S ꐷ  p .0"S hL  p0"S P 06pl+0z0500~00v01w 00 0s0g0e0c ^ ^  ^ QS00 00055e46V0 +1ou?WPE2%R U%RpUQp0%0;vP%5S 0EP80: S0550GS خ ԪU%R 2' WUz05-Ur1z4P$040}@ˊp`!`vvPP ZD\$iBK6%`76wTD00000 0CPP#2 CaDD]DrD=Pc`0  0S #P}p@=S&0#S  C!E㤫 Fc0E?o2?  C `V4APP!f/屼P-`vV 0`PDhW@00CS0 vP Pp PNU0 P00CS0v0 US00S:00S:0t42U51A01S)1S g*+Pd`d!iB5%l6Ux@P 0T,P! d0`0U0w0 0P}0PEUiP@}P  f/X0 T  9>x*P긝'T. ˓\;,L{m~ %%'M)5F'%ZHal<Ih%md&ؐ'PC-{7 0P !@㐐`p@XP? P:`00CS`0 @@T ЍX0 X @:'% Z:O-`@pP0dMԄԔԤ$`(`,`0`4` ` 0Fp0$@DTlUU!Z  :tPcPSPPPPd @"nP tP0 aP` rUdU 0RBp0#|dU4 RU SU" QU040  |pUY [/lUT  :  $б@ $ Cp0 dЍ $± $ Cp| 8⵱ 8 Cp( 8 8⥱V  H⟱T@Dz8PP`p p ~`TEP 8 dCp@j*Ph*`("(! W "0r`j5V!  P Q !W|*0P0U|THL, 0@Sxr>po>|:@5xX8 㡽5 P P% *PP%g:`V08 Z8 pᇽ0PZS  j: 3 > 0`||Q,% p;~DD({D6C|D(R_n}}DȪh%yaratcidO-0p OaMԯ$22242222322 pp .$Dpb>4 $0QPClo2 0000U1dR0 U% PPL0];p L7P  PPL0P;pd2SPJBPX0: S0d2232d2oPPS|0 t=QsP-0SP FL bzPGRP 3P@/PA1@P>ꤹS@'P6$0<<THTdP L HA@P:00H0000k ,2,00SP {d<.0d2+042(02%02"0202@`[`k @=Taߍ02 20202;/`/P 0S :p; 000P00S {:p- 00/`P Q i:p 0 0/ P   R Y:p p0S O:p0 0z0)2i000 0B BP 000S 3 S;3Ş)00\i 0t ؇P 000SX"\2R<RX2i/ᮦP PAPX0 : St9 r `P v8/ᘦP @)0 P6z X?`Ppb@p X:x\10@  X0,*a?X Ft?c:!14'Sd?̂038  \703L77 P 0@ pQ S\2S S 2S 2S, 0s x ?p d2SL @pV X!\1 [\1X! 0 \802T7,2P700PU%>pP  >P@x%o9P 6;dU CHPh CXx 3023,2 3(24T\2S(",2QX"\2 !14!8!P@0+ ^0 \ ñ ` v $!ijp  ZY0d2S*'0\ ᭳ ᫳[tPPL00<08 46P 40 S8 *"<02#L SX U[#<00R,b(H"L2R0;\2QP 0'%'xc, '<G'dn)' 8'U˸4Q g''rdAȹedAڹ'rP>)l!%j»'p'9vĺں9%('Eӻ̼1 SR Q  RQ!R!RS !14!8!2S2 BT/1{z62S8P" 9`p0 0?`,78P D2@T0[ 2<< 23S 992BS``2S ,A8$)0 8P ;;B68P c+0! 00"|7,00! 0,"Pr7? 0,! 0 0("|f7(o6s8 P hჰg@ T  @ET   @@]谝  R%TY! pYP0  y=0sFP 8@pw8d$qP"8[S 8O"20"0];PJ;PkDh-0O-xUM M@ 00@00`p0@H@ 08%]?p0C000005 `V1 0CpP jgP/ ᕷPZ4$8ZqPq?oY20S q PZ  jgPP4j/;vyScS PS4 TS9 QT4 86d CR``````8`` ```\`h000   t 0 )     r Rn : FPu  [ ZA\ ֱPfAS0S R) QnQoQ0 )p"pBp$0P@1  +A00,"($2$"Cލ Ѝ ᕱP' 吱P" 勱P  uT.@; Zmp@. A!N<P:pAB00 AX`V  7<p. :>04P)`CQښ. .a0C 2 0/u8',%edA(% h%P'H'`33!%@'Pi[{.OX'zd@'`~O-`@pЁБQ =p%W㰑 0S 0S p10`VA .P d)0S L#D`V.Z ЍyPmPPP fP Dn0@ S <P$00000000000000p=RW 0pSP  EP EP :X,'% 2O-4$M` K;P! m:P90pD刔刴00PPPl$M=p3W00S 0S 0S 4Pp(4 a X' 0S00P 勮0S 兮傮PY30S ЍzPOPBP4 FPo fiP@*P\\\\\\\\\\\\\\d \(\\\\\\4t\\\\\\\00 P2 P20{00b 0 (ip6o0` 0֯P00e @ϯP00^ 0 c  iPV tQ000M00J00G0 mh1 P :s000001000-00*000&000"p 00000000P0S ^QP~W00S 0ٓP1`I%~hZ 8hZ ((,(Ja%8 (L{\-9!%*2O-@MP8@ZVQ`(*PUPE10ŴcvPlP,HP8 TP3@ ` 9p@-α  F_qp@!±0 S < v<0@Zy rm@ Pxxxx8` 8";p,2 R Q!  R 1,0Q ĮP,00S  0( @WP@Y00-SF 80@0$0 p0ᷤ@P?Ѝ$0pw1 4?$040P ?000R0Sp c```8;pW0S60S } 00 0@@`p @$@ @P Xm 03/p TM,Ql%0 xh"%@-,@,@@ ("%O-@P8M -`,@垰F8 0♰v`^  p p r6 R|,0 P8 /P0T 4P0\80DpHP88F U1 6V(pCE C`0IPHPU 0  :p 5pO005S 0(0,00(00 0FIPPPx%xqPzZ`ZNZU 3AZF CZP0 ip 00aZ CZ LZf a J0Rkt\|\\\\\\\\\\\\\\\,WZ$00!0 0 P $0DS -(K0L0J0~O0{05xN03Xt X`CpM0nH0l5$00!0 0 ᔃ $0@S* x9qI0X00Pp 00J p40kZ0{mJ Z =0Ȃ/Ԃ-[mPH0SI0SO005S* LPO0S U5S5 ( p0 (0S  0C!P t@P!@Mp``p! ᆾP|! nPd! 0S1H!3/ 0\@ PH=`Pᅿ0(4P1!" HR #40 op" PP 0 " 00 XpS"% (#%,X#%-@ (@#%(-#%%Q< M(p#%#%,A-#%R-#%c-p-#$--**&-r+jT&V< i--i< iui -m@-P Dp@F (p@-D@D~P@({ zp@((%tp@-D@DfPk@(c btp@z(`)%#!A-|@|p `(PK,HN0`K8P@C@@4=,>PEAT()% +4$ +G-`M5PhPv6P0 $p) P5\5@P Le6H2HP8"0 8288@ 6 Hp HQ K6P  @ p1a 0e0 @ p[0 @U xQ080<0@0D00 0000P0 0 080$@P  84 HL@P@T@X@\@HP7 H3444 0400,0@@,0( 00P.pPPUPh0PP 0/`Ѝ<<:*<;v;/<'l3<J<Ct+%HBBXAlA(O-p0P`M(006唖Fp0 7pt6Z0PE `V0S@PvPP`@@0V|P 0SЍuPfPFP RPg Lg@P<O0P0 n0#S "P00 $$00S $ $$00S VpP n0#S (P $$0(0Sy  $$0(0Sl00i0P lP0q 0q 0 C0` @fE[w a84640C @RI0cS pS< bSBJJPEU ]P0 0U8U U,P 88 0,3/8 RP cW U@4Zg 3PӬ0 0C?oR20S^ qXUJ "n뻬00 0$u,0$00S XU 0H 'ꦬ0S 0P0 00010S!1 0S 0ͩP0 0  Q00s  1000,0 038o4P7Z @0 $  V443&SR @0 #  H4 03  @0 R T D3Pq(00s  73pp0 @0  4Z $H=,%(==m==)===3>h% >F>O-P@`p'M M $PP '6p*6춟p0@DT00SfT T!q^@P XkJP㈦e{2p`Rګ0S*  XAP? a@PP񟗦ll,l8llllllll@ll`lh5pP50S $PX l눥PX%000P00 0C 0Tp èP  徨P 幨P*YP%  xP p ᩨP <P( l}p q'^Ppq/l00 000#0 00$00 0P @(dPPdl (P(^Y@X W⌁2 PP(!|P( (g@P `HE0P 0(`p` q]P 00 00$0 00+@Pg@P og@Pg@P gg@P hP TP H P!Pf@ P Z P( (p` P( + / Pm``o 0V@ r0 0(1p` P!P2P210S4ؠ00 000$00 0 ( 2p1150Pa0SJ+S'- 29S!S@ 1Z)Y x\f`P'ݍ ЍN @%((0AյO,@Pi[{@ N@@A8(zd@(edAp@-P@TRp@-P@LRp@-P@DRZ@-p@-P@:Rp@-P@2Rp@]p@-P@)Rp@30O-nMM000`4PWIP 0~0 P !PG  >R~p> 0 3p@7x>pt>a0SH>D$RX$r R  $t gt00<4A @0<4x00<$ 00p N <4 L!H -9+`PEB@D4TG$T44l8H00<@ᓦP p< $y劦Pt  k << l ,<$$r $dT4S`P T3 2"Fx2ŸS H$L4P*pg0 L4H/0#! 0_pL2 C  g0, jpĞt   (0P 0T+ /!L4HϠ0# 4S 0 )?X %뼀04$$ST RQ  X  0,p0 XR00R104Qg ;R040 Q$ Qr*8(nH(LRLLvL%`,%NENWN,L{h%L΁RLZXS?SVS|Seh%MS!M8T[T>Mp,%CcCXOMfM.xSMMGO(MMMjN}N3OP(NNNN(U(^ NOO^ XOOOOO-P|P`,%PPQ?;PQL;Q%QHL4 Q} QQ040S[R0[ 4S$ lP 44崐S04144 0S @4S 0 0@4,4S $4R#1ѣ1,40 0 0;Uu B,t >,0S "p@) P+ 0d!t(>0]DMP=.X R04ʃ1$4Q :$4"+ QT4S& -d0<"tV(,+++`,\4$H1H4L1x0<$0@ 0,p2tnP Z > [PbP  4♎p   T4 v &.0< H'O-0pIM M␹i4, /pP_h9`4pGs04WZ h☤  ᔤYa) 4S<44S $$4R0(h+p  h,p  4 SP,0S x0$V $tZ0 0q 0$J P$H 1Sh  $$4Pa*` eZUCUDPEU$, (`<vbPEUU <l6 ( '8#80( R&0C RI ("(e044s04=0 00 d0 %p6/0(00 ,V0,P0@ 80 00  00*00 +0 0*00 +00!00  00c 00 l0 050!00 < 0,00 1 1 40(40Sd00; T$\0P0<$dh+p 4S 7*PP#`$I]`P#H  <(@忠P04(0(00`V Z 00%p"#8$p = 0奠P0 r0 4P ⤠P#0d3}p$p4S80S4` 1S 1!0"@ 0S0₠P 3"b|11   $Ĕ!<#\pT2   kd$ pܑ U!P pe 4 $$s(4S 0@j&?W  s" $tR $4&S 4%㏟X0; 4 44 W  0U)p0!dpWsX0:S Q 4 $S  0 _ jh)0S Z `)O$!KHX0⫱AX+( [,%jN}N(3OXO1%ZRLZX?Se8T[T>MGOZNNN((a NOOa OOOO-PG-GMM@ph  ,p40@D@DTQ&@@5P,<\| ,Lt3040300335(x3 p0,0p0L3000<3080,434#  3@| 2Dt 2Hl2"d20L0`|2"X\2d"P<d2D"HL2 p0V0  2W6 2 p0X01!x$ 1p`p0x0p0\1 t)p`P%t  Nqp`Ph0 S d   0`YP b0SR0Sh`lP0 3A/ߎP 0$ 0 0 @x=$xV@@Pxb 1GލЍTc %,A``Ra?Saa1aff=aNa]alaGOQs(}aO-`PML d`cP(NPFb (P'pp((px `PpI8` X.L+pAH 0> P U ZK > <;S'P $f $6f 0T =TT PX(  =0 2S1<+02L0WC.p=0S- C@4P"8"!!4!!!xd"      (!@!L!!!" 09 0zl hh0P 00R0S 4af 0;8;08;_ 00;ppGX䋟h;h00S 0KP  +;KP= 0`ad h`h000S0? P< ) 0< 0: 0 Ea@0 0:0@; 0@0 00 008;0ꨊ h1h0P00S0? :Pڌ 00v 00s 09p8 hh0`0PS 4t hh00S0@S ec 0; 000) 0 0 000) hh_0 ɟ Lh00S 0KP h:080X)X9 &PL zZ 8JP &P mW<09 ,]d P 0: 0 >0!.8u 828P80PS ̌p 80PSUpȌ 刀pp]Pt  4~`Up 0@ @ 8 0PUP 0C S0400000,00(00$00 0000000000 000000x0 0m0p Ro PP@^"8Wo "p$8; 00 d0&p^8; 00 d0&pP8; 00 d0&pB8; 00 \d0&pL4 pDV  |0 x;0 E y;z+吙0;0; ; '0cy;0z;(0x;P+@xP d0R&P;"0#10@00 0`c`QH `    ` 0.&Pbc0S PP c0!&PU 0  00 4&PHd 260 X! Ut``0 T&P`l4l$4%`㰙!2P(10Hd 0`[[[[,Q0Q4QPPPP;㗙4d<;SS%>؀C 0 <Puc`p*O 2qR 0Q 0Q 0%hrN% 0;PUc@XP O @2QR 0Q 0Q`"2R 0;IP ' v"2@P0IP20S 0 N' d@P 0IP@P 0IP2 $p0崗$p00 dT廌@+9@0W0 00 D P1 HppW $ P 811%P`dAQ D])%PE $1% 0%c`#)ll m"n.)?neAnn%,m4m`RMb@AMmjmmmmmm.)U\&)n.)n{Gz?Gncn$)D&)nh%OooƜoo.)l/)Sloo.)oBp$8%|@0&)-C6?/)pop_p8~A%)$@&)@@pph%$)p%)%)pKq8%p&q/)%D/)q.qqqr-rRrfr~rrrrrrrs2sDsiswssssss t$t55556@6H6P6X6`6h6p6x66662 0#!$m 0Pp#x         $ 0 tPG D 0 kP> Q77$7,7      0 LP 0 #$$0(#"(!0 8P  0 .P4  0 %P Q Q l p pt n0 P  r0  P  0 P  0 P  0 P  0 P4  0 P X 0 P | Xp; 02 \.0SG S Sx U1؃0#$$L0(000"(P 2S@0IZC U I 0K@0 @0C@zp  JZ  @0I)0C9! @ @0C0YIZU& <;Z   tPU (  ḫ cUP P JZ U O-M`P8@0L-S@ᑖP. @,4 t h#p+40SP a`F0pP[PTPijQNpGK\!PN  cZ]P@ \3pC d0@S=@=@=@=@=@=@=@=h=@=$=@=0=p=@=@=@=@=P=@=X=@=`=L@20SFK@HGG 0屓 0p Y \ZZ'R`PP`0b 2 R { 0 S o jU+ 0 !0!00X  $p4 ,pt0SX` pb0S1XP0pp@@ 0Y Vp;Ά`ꜤD/*u%Bu"7uuuvvuv3vpvuIvO-PAM Mʍ@`xP lPd70`W00-S% @/P ڒ)PLY@ p0K0\Z l`F0S0`@DDA@Dv  "p .6p0StbLPt63 Q X 嚒P -00 `@Z-00  D0B5S񟗊Ct@t@t@t@t@t@t@t@ DDt@t@t@Ct@t@t@t@t@t@t@t@t@t@t@t@t@t@t@ CtCCt@Ct@CCt@t@t@Dt@t@t@t@CHDCDDt@CD 00S XP}X0 0w꤄ 4P X00i00f`400b `4 ^0S HX V 04 R00O@P H ܃ r300S P60$010(0.0,0+t0C?o 2R0S0$0P㉒\㆒Pげ@"v00 @DT3a00@`FrS; RS iS/ tS xS 똒弢+\0p 0@00@00S  0@T0S n #R0B(0/S  Z(0S  0@"L[r0S (0S p|1 0h0P S 4L *(0S ( 0@r )@{a P+ 0 PS@T[<~*V5P/*5y%MyHx,jxxY*x08%xyxxy;h%b<8%<4@%wyyyyLNyy;O-PLM)@pPph/4 p\?<,#@DRQ0I 4@@0SRCWvP cP SP- TP0(3 LP d0@SIPIIPIPIPIPIPIPIPIIPIPIIPIIJPIJ0D003030800H00 30$30,3C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0qp,4y 0P 0PQT)QrJZp3V u`(os`F P% 0SU030#:U 5%P|m P l2 T-P&T6K/r003PvTS0 0S0# G@~SPEX: P~ 0 0<6SR46SR 0&2RRPh2 01~(6S |#RP W0`W  0ŊP ~!EK/r0D,6S m/`P 0PQ! V+~<6S:46S: d1Q0@6D&S|1 0 00Rl!  H&`R\! $&RP! 8&RD! 0&@R4! 0!Q   @ o @뼏@:|0PT괤(q*%,¤?xw*}Dr*8r*"7?h%%1Ni uboåۥw*=@YCF"nI^A-Pp`IHM p10PEU* HP h0@ S ScTcTcTccccTcTcTcTcccHHIIl1yd1T1 P1 `q 4pP p 1!<qPP tP Lp$@@Ѐ@(@ @s V\P 0P0S %PxV SP XEP0 0000 r꣦%, B%(w*yt Ct 0G-`HMp0 7,S,C, p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 a0@SfDgHffffHfHfHfHfHfHfHf$gHfHf4gDgHfHfHfHfgTg 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTw POV ДY 000 0$HЍP DPPp  {O0S  %' 0 Q`PGPV qh V '`Fůw*,%(B%% ӯw*C-Mp`i-=PPF! VF pSPU 6 `V V 60S aP& tP8p6 R +h&   p<6U@,V`F V"@T P PP,PV 0S A@D +P`VI  tP9@PA@3P񟗹kiikiiiiiiiiiiiiiiiikiiiiiiiiiiikiklil l,lii8l@lTl\lhltllillzP0S<0S{00\0Su00Sp00Sk00Sf00Sa 000@00=00:00SQ@0000.00+0 03M $0S=<0S800S3<3PKP0$0:(U 0S# 0S 0S`V Q PF 6N0S 0S 0S`V UUlP \P XPPEUnn`jo`j`j`jn U3 UUU  U4 @U U0`0 0 , UQa IPJ0000 0 ,P  * +$0S , * p qpb*j@T X 0"600"$0$P @ᐉP ዉP`ܶ^|*%,h%,FYiG-@PpMaM Fp10S QġPE R ލЍRP fP74p.>P` FMWOJabP1 JP/0: S2  S)J .P0 JN@n` 04S00`:i΋0S Jp @J a.PJ Z.@PJ0@겹|*%Ϲ`nٹC-PGMM  a 0M3= <8=8X@8DX}Px=0D80l8"=`{C0L `XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxx8_}PP   ➁P:?  0LnL  J}P< <D}@P % P H0P XPg0Pl ShŊl 0 j P4:Ty | P :h(q\ P 9T(X(g8 c,߇P 9h(e40GDS4w{w{{{p{{{{{D{{w{{{{{{x{{{{{x{'P03Hvp2S lm P IUyyPH t圄9PB/PE0@ *  pd40pEWQU H4 000`eP L,}PE0S#3 4# 3 PkwP HvP303 Z`pp h:dVyP\304}Pz4S @SmzP  (HGn P 4SqR[zPl l PnRx,p`bG1/΅<01 1> 110101$1Yy4㊂#(2R$$h ip`g Pd Q18C8S {uo`q؁ؑy00l V B/o" R TzP  \}y=`S 0 0000 lz18C8S+`#RS S=?o20 S S lz18C8S 0 S ` S S Sx zxe+v(>+%h%Jh+qhi :I%wDM%VPM%~f+@f+DA `% @-@`%P᪃P 1 q px10SAQ\1PI 㧁D1C@千P 0刃P 1 nPbP9P0P 00@0c0@ S ꐈtttttttttVP     h0  X0  H0 T TT  婁0S(k+%%z(y(xO%n h%A-`5P 0S)P10"P1 0Q 嵭U 0S ,P4!䤭hPEl10S `10P HQ0S,1,囂P#P ~㗂P.qp 000000SW +|PP`0S UPPt00S8k+>(+9#IZQPYhP 8E+(%4(h%,ԣ%'(+ 0O-pMuPED, P4/ᯆ4PP 000 0 P0X0R0@T/`P@@8$9pB,40HXH[p 0S u@P ~@;#P30# [ -R R -R eB kR R|# QiR eRX#P#sPPPEP IP -Pd Q@"P꜒̒,\l|00~l2lyX2\H20P^Up0Sm ?SPPi20`^Vd0Sa ?S``]10@^TX0SU ?S@@Q1100FDꔱ<00 (0\  `0n !1R, S` \0  0 Z-(, ,A>^P  rPY  %0S%   S`0S   Rڰ1\0 1, ,00+*+:,h%R+%vP,*+*$+L{w%w%w%,9+A+H+P,ht@+i+h%+++gtO-@Pp`LM @  p1 UV Pp  DgP uP GP000`0S@0T PUP  ) p  !CP0P 0S UC p U  p T N p V p|CPU _ ThtPL@@H 0)C +,%+,.,8, mvl?,0O-@ll%0h5M@`5`@X5b P5p@cD5b/4U4@T0$%5%U5%500%tP]KP P \PWxmPC DP3 fP5 CP6 /pP7 rP # pAyNT( P00: S0S00+ Lx`P, p|P 00SW p 3 B3 CP@00ꤣ夃夳pvWpO`P D ttOphll0@ Jr@P4 P /$ E}}}]ۀ @(@PXP,4@40(V,@t@P 3 L2O0082",2gPW 1QW |lyN 1 Ѝe T5( 40S6 s4P(Ur@P 0x 0U0 0 0 00 pP ,D(40S(tr`-,'(3,h4,8,03,`#, -,5,d%,83,.,h%s +,<3,,-,/ ,,, Е ĕ ,:43,+,@+( ;O-pKM(0 `HE 88`0 `  pPJ5 W_Y CpP :0(Pu ` 0!0 04QX 000sX%X pP02 0P` PPcPPD! A ] ! ApUaUbPEUԟППППППППППLzU" !0  0 00 0`3 1 H 0@u$300q`o p00: S) 0V0[0S3 Y   0,`P<  ( P (!x x,Pt( q(yP\!b`PP (h(,JVG ,]Z(,0!@P5 A P{I  [P"   5P0S 5 pI0S ,T0 0/X0 N@p% 0SS RQ"$0p00S uP@0 z TP Pp`긖,%%ht@,vp&1Pt~< 0O-PM`P 00@|P |P+ߍ*. ~]C`?@P1X?/01012211B "L122pppN&KpἮ\10 .0>p1F0[X18X1`叮0  F1|!1hQda0  F@Pw\1j >0[ >+00. X18X1=0YSpVPMP 6PR ?PI 4Pp㤍N@P񟗯l(4fP j@PP񟗞̦` =0P1`<`F@pԌ}\1F3\1Kw0000q0\1lH _@fppcph`0 P P \1P F0#P\ ?0[ ;0  ⪽@P 0 P  &84'0 00X1 wpxx q  ↮1S P 7  [ ݭ :0P }\A@ @0 Lp  pp A( \ X1 Q 0P819:\!p*X1 d [pDT $P)(< $X11Z xPPY* 9Y) 9+ 0)\1 ⢗P} P S *y 0 09兪z╪pHx  W !0S L 帬 *PQ }0S(  vX!\10\1808"/0  X!2sP8"/0 ם2X!s"/ ͝p= X1`{  ٝP%D]X!\1 0\1 00 8崩p 137 Z ⏟zPtwht 00 7Tp}0S $\X0pGW}0STZ|0S |0 S X1\!8 0\!'zp|0S &|2p|0S &H% !P q  w#t㞟X1 I S0ЯpT9 V_p5 P <$\1A>\10L1] 00 6Lpwls0L1L 00 5LЧp(ݫp &_p P \10\1Q|ͫ)_d叫\1 @0\18!pP  <X1 X40  ⁜p` X!\1 $  $$ 43{$ Gp   ₞Kp匫 00 4sp@倫|!RX14X11  ⑭P+p0v!P0!  R!j00|!R00SR\1ݪ X1 0㌃匓 Q01Z:  IX1  ՟1PU3X1\!( ; W A? =墪 ⺟ ⳺1R@T 0S 0 @,@ 0S   _ 0S ṝ᭫PpP P ( RW  R   0010 S   0:PUQR囪\1@0@k/)`\j\1$ =D 5<%  %j,FY ,@ z 8;C(%)`'=Ndst=I&:%L{/6L_@Ck{ 9T2=%  Q/0p@-x@0Ppp@ P T0CA`p@/ 0 0$010$]I$O-1!bM0 Mb  [ !1 b0 0 30Zbݍ Ѝ  0 "m !l\ $fz`  $; 0 0 +Hp0Gp( 80G( Gp` x8_S0؀00 00 P00 @G0 wP x8##[`@*wP0 l8 40GPiU P0 l8`>\\=>=>0ƒ S"*0@- R P@ 0\ R^D00"@ 400 0^ 00"@0/;;; p@-`M PAP!@ `` */4T*///*/@-@w@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_RC3 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC3 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC3 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC3 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC3 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_RC3 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC3 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogxfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgcdn.NetBSD.orgftp dirpub/NetBSD/NetBSD-11.0_RC3ftp prefix/evbarm-earmv5/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32gamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressnot ACK or OFFERdeclined duplicate addressignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d {(PY'^;b{lB|s,|'Ld'h'$'7Y7<'4'':''}ܤ'4'x ',',v( (P(p0'(4(ϵ@(L( R(  H;;](`@\(`@MlHXe( cӝpen(hPprtv(t@y(@(@,(,2܌(ď(P(ܝlb' pushdnepopdne...x@@.H/@@ /</|.8_X /h/@@(a@@"/<unblock and -DNO_CONV?x̻|pz`100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLinkj j kk#k/kl?(l;lPATH= X2t,>f& uduusrA>cuumuuluur Qqpu\pnuuv uKMb    EOF reading here (<<) documentzzzzzzzzzzyhozzz{ {{{{%{*{1{5{9{@{G{zzzszz(n9érIsx ;s}-+?=SX@M}V}\}b}h}n}u}}@.rrrrrJ}J}abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.''0t'1`'1̜'8'0'0'0'0؍'0TCN  oZlanf?  z  AFM$D8P{ b!K\ .                  q+~X=TqT r &vH(jpˌhw0 ' LPP3ȴ00`ŁPJ@afThábՁ(6؁86OrtMqXCYX0/4w /uhaA0L||Y4  ɘ9 C    '<j  XlZ:$>ۅ?P>P>=X=L>>>x?s@S=@?@@wD@p>=% ??f@imquz#y3#3233#I2 :@O7@AQZZY @ćʇbч؇ C$C C$C'391:@G@i+OW@H@` P %t|@   $ @ @@ @(@/@7@@@E@J@Q@Y@` @^@d@m@u@|Ȗȗϗ֗ܗ@@ !'-5:AHRX^emt{05Ӕ=Jhn•T*bfksx~f$@ ĘʘT*ј֘5ޘ$(3BN^=  '05:AJRZ`dku~Ȗ͖ԖٖT*bfksx~f$@ ĘʘT*ј֘5ޘ$(3BN^T*bfksx~f$@ ĘʘT*ј֘5ޘ$(3BN^D3ɲ!=Pf B a   ʾھ%8rֿ  &!b #b $6&b 1b 2>3b 4b 5Z6b 8e9k9r:;<=@AB:CfDEFGHJLMNOP#Q5RJSdTmUuVW\acde3fGgZhZiZpaqb sb tb uwvb w}x)8Jk.L^u +++Kksdb b b b 0#GZgy/7Od(<\wb b ',?Yb lb 5e[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]'$@ ĘʘT*ј֘5ޘ$(3BN^returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblockD) D) D) D(         @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readS!%@X!%,]"%I@`"%@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-/JQdo؃/lh"%} "%@@ ]k~p+ x: + + + P0 d0 1 D7 X7 l7 7 : 7 7 7 7 d: 0 @ ĘʘT*ј֘5ޘ$(3BN^<"%@ɲ!=Pf B a   ʾھ%8rֿ  &!b #b $6&b 1b 2>3b 4b 5Z6b 8e9k9r:;<=@AB:CfDEFGHJLMNOP#Q5RJSdTmUuVW\acde3fGgZhZiZpaqb sb tb uwvb w}x)8Jk.L^u +++Kksdb b b b 0#GZgy/7Od(<\wb b ',?Yb lb 5e"%@t<T"%@)$"%@("%@vx,"%̳8"%aA<"%@wH"%SFH0eC]SFU0eCcHah!IdontNeedEFImr(s*K>;||nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+^=rGy=iG};Mt?mWC 3KOO'yD<#*=(2<3Dh&FN\ M}-ar@Mjy֬-чH-чH$ZIчHIчH$IчH 2IчH L6 %?a  S'@ )Ѹ+ 2 *1@ )ѸL B1x )ѸQ [ ]T"%@q"\"%backupstore_gptstore_tbl](<`"%@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps&&&setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusT*F-Pprintallmaindo_setifpreferencedo_setifcaps,zi $%Iyi#%$ '%^#%'%'%$0'%-jTX'%n&'%.L#%\,<&%.X#%.&%/&%.l#%/l#%!/,/7/C/O/ [/g/s/@//// /0/@///M/ // /@F-Pinit_current_mediasetmediamodesetmediaoptsetmediasetmediainst1G11q"1"T*F-1" 1"`11@111"q"1media_statusmedia_constructor11Sn0(%01Sn0(%Sn1Sn1D(%1111`(%110Sn|(%919(%paddr_match settunnel2#%2)%print_link_addressessetvlansetvlanif3)%43)%44"setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchan9999sethidessidsetapbridgesetiffragsetifrts90*%90#%9+%990#%6*%66l@* #%H+%9*%9L*%9(0#%*%w6@* #%*%4h*%9?88>Z6Z6>L4L4&invalid major numberinvalid minor numbertoo many fields for formatffs@3A@A LAUAaAiApA@"*A{AA A4A ^?AAAAABBY )B@5BFBTBkB@B'$(BBBBϱBB;CECPi[rAI=,PC^? iAA ?@AV?@WC^CcClCvCzCCC bnorripbgensbextattbnojolietbnocasetransbrrcaseins;CECPi[rAI=,PC^? iAA ?@A@DV?@@~A{A;CECPi[rAI=,PC^? iAA ?@ALA UA@D~A@DV?@aA;CECPi[rAI=,PC^? iAA ?@AV?@;CECPi[rAI=,PC^? iAA ?@A@V?@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror;CECPi[rAI=,PC^? iAA ?@AV?@GG9 G G@GH HHHH !@FFHFFF F@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv;CECPi[rAI=,PC^? iAA ?@AV?@~A{A:QaQQQQ9RRRRRS6SJSjSSSSS#THThTTTTU;U`U%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@aBaCaFaIaLaNaOcS babb,bc7beKbf]bhbibkbmbnbobrbs cuc@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@ i@h ipip ipip ` i#i@ (i $1м|^t0 Non-system disk Press any key to reboot qqqqqqqqqDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYß֟4]Ϡ;mݡ5UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_printHXdnzv+z°ϰհL\X #6;LQkyDZӱӱ18W[w˲4Kch\˳bitmask_scan]hw.disknames9uy}***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20260107  " $#!%Z^\`[_]a<8 @8 : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for datazH2\ >::,V_B!,l@3,t*,.,;/,0,ʣգd#,A", 1,#1,"2,(4,19D,F-,MT-,^-,hl4,q>C ,{,,D4,,@#,d%,c&,ͤդb',c$, a(,(,~),(5,46,E7,P^+,p8,|8,9,collect)U#@ ĘʘT*ј֘5ޘ$(3BN^NAME=$'Bmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds@ ĘʘT*ј֘5ޘ$(3BN^ edit_fs_type_ext g ( O O P c d r r 1L P epP u`P edit_and_check_label @ ĘʘT*ј֘5ޘ$(3BN^disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijz0  p p ܷ 8 < 4 Ĺ , $ и  disklabel_change_geom ȷ p outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_defaultHR,(R,R,dR,pm_from_pepm_whole_diskgpt_freegpt_create_new Ь(LXx@T<8 <ؾ(l,0FFm$ ]$ + L Q  ! Jd؃ @ y$'$(5BBBxBϱBB$:L gpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC]SFU0eCcHah!IdontNeedEFImr(s*K>;||nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+^=rGy=iG};Mt?mWC 3KOO'yD<#*=(2<3Dh&FN\ M}-ar@Mjy֬-чH-чH$ZIчHIчH$IчH 2IчH L6 %?a  S'@ )Ѹ+ 2 *1@ )ѸL B1x )ѸQ [ d 1k'@APZjz mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new  Կ p@LP|D8 HLTld@  mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************uy}control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2jewdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optioncbxcdeefghi~j>klmnjopqrs!tju).v4wx;zyKAQB^CDeEoFtG~H;I$JKLoMNOPQȚSTUVWXZC146|38~}!(8JXV_]dlqw}IT  ^)5ATao{default_configread_configrt_compare_protoHHrt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtrt_buildrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initp,$sscript_buftoenvmake_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os\6 $)-4if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp7dhcp_bound  dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifazz { {zzVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\Btԟ45TtcCԠBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~p% $  , 5 cC@L!H!D!cs_path:X bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_maxăL؄d|5 cC8ĉ !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_popunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %smemstream_seekrshrcmd0123456789abcdef %x:%x:%x:%x:%x:%x %256s 0123456789abcdef0123456789abcdef0123456789abcdefkMGTPEBKMGTPEKMGTPEBkMGTPE_getttyent: TLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~_fts_readkh?marshal_new_auth_authunix_create_xdr_arraygethostby*.getanswer: asked for "%s", got "%s")& @"NBCDB  d'@Bʚ;0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as5gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef0123456789ABCDEF_xdr_bytes_xdr_string0123456789  %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC 0123456789abcdef0123456789ABCDEFQ !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG @Cisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB 0123456789ABCDEF0123456789abcdef/& ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::TX@ش N`'<     ` $ ,4 <  D H P X ` h p x                      @ < x0   ,X h  l   X d P $ D L p h T \     l 0 p     < x   ( ,, hh     XX X  Xx ( 0 4 8 @H LP TX \ L .` d  h l \p  x                 0 00 0h$08@DLT\ h p x  t  d!` !9l !tP$!|(!-!U | || | | |`p|w!ts!`w!\v!X|!`ddgnts,(\'&rbmn$#"D#x#tcidHL|QVtZJJJJJ  ddyekdY QXI80atadhfhloobsltsT!T!\!\!yaray4D~pxwdXd(HTp|     @Ldp,08@HPX`hpx|HP0<HT\lt| (  ! !p (04<DLT\dlptx| (08@HT\p(<HTdx,D\p$8L`t(<Pdx!HܤHؤPhHܤ ؤP~ WbWj\Uj,c,fWhWkWlWm XoXo#Xp4XpXpIXqSXrutZXvwbXwoXxxz(zwXBgCuJXOXPXSXTxVVXXXZXZXXXXX YY Y ('Y7Y(t-@v(t-xtHt0 pu5Y(p|`|@}(th|ttHt0 pG YX Xu1Y'Y/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin̐'}-+?=###%%%}''wawwEVweIFwIiwL`lwmwC"nwfwwpwbwuw0w xq sx#xhZXvQVV,xxܘ'@=%%d W]{rotǟ Vw-lt Uy:NhtSc$ttH2tY7r4sMV0q{$Аb<`3DĨ(Dݨ |!%  ... ...>!Q6Nxt0W1WnnTjnx "#=4dH Hm%#%#%; "%AabCdhlNsuvW:w:z"%"%#%#%#%\H A.,#%%%TH .H$%TH L/|H T.V|H .VTH ;.#%|H .V\H Q.#%%%\H . $% &%\H .4$%&%\H ,.\$%,&%dH 6.< $%dH 'x< $%dH $#%#&C $%dH \r+#%'0@ %%&%X%%,%%dH .#%ј@ (P%%dH %.%%ј@ (|%%\H ^.%%%%#%&%#%#%$%$%(%p$%&%|&%X&%X%%%%,%%#%$%#%tH D\,#%\,LH o.#%$&$LH 0.#%&jT&LH L.#%jT$jTdH E.#%ј@ (&%tH l.#%.LH /#%$LH $#%&lH -#% -lH Ln&#% n&lH #% lH d#% dH 1F <(%tH Sn#%SntH 1#%1tH (1#%0lH T0#% 0tH <H0#%H0dH 2H )%LH 24)%2LH T&2#%&2dH 38I )%TH "4#%4lH T" 4#% 3dH 9#%M )%dH 9pJ (*%tH l*9#%9tH p(9#%9lH '4#% 4tH 8'#%lH l@6#%* 6lH @#%* lH 09#% 9dH 9#%M l+%CK>I>I>XK>DI>J7.I>I $HH>$JI>J>I>I>J>I  '@@;CECPi[rAI=,PC^? iAA ?@A@V?@~A...... ...... lost+founddA.##.).xm/֡#^k Z T   //p=|Cwzr$ƚn& Ϛ!֚"ݚ#$%&'()*Ț+, -/1!1-293B44566%Ѧh%Dk  '-3<. (prog_root)`poU5PU-NO+ "L+3m V #m x ?m a SXm 8 pm 7 m dG m p7 Gm a x m $d m 4M Km k 'm ^ zm ` m t1 m Ld m K ^m O |m Q Pm ` m G [m @h `m g fm g m a lm v um  E m H8 m t1 xm J m A wm K bm H  m  zm _ 5Pm p7 m @N m r m q m Z Lm Q m m m O 'm `T m B 'm x[ m `T m Q m Tw 9m 8 m Tp (m r m : m B m : m |q m Q m 8e m td m t1 m r m pf m Q Cm Q m Q Xm K (m I Lm I 6m (b m 8 m \Z m a m ] m j .m (t m A m A m w m (Q m  m k m D` 'm d\ m 4q m h Tm 8 m I vm u &m `^ % m o m (t '<m 0F 'm 8 +m `h mm l m 7 3m j -xm G aAm 5 m p_ wm Hv <m  .xm X ZXm \I m (t ]{m  @$!?v`vL?  ~ <<3:!GpB <?W >]LY tv`X pY |4J $DLVahozB  %F.;BO.V]pjN\z+z,>La<^ov  BB2.J]kV%b4R%V% R%z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ b% b% b% b% b% b%Hb% b%"" b%Hb%Hb%Hb% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<IOTX is a directory is not a regular file (use -f to see it)e%e% (z$ ">rB; %7   #-2:8L Vf r(z!9 &f)5e:%6#4/ =+K,]-l.*?GpE'<//'Fp ;^F-rB , 1f8jBtP J Y eoWmkRkRkYcWbkCkc kG ky wb YMYrWcav%ܨ+bu%@+ *JBu%+icu%ب+du%+ &u%Ą+<XDu%( meu%Ȩ+zfu%+Fu%Ĩ+&gu%+Jihu%+iu%+ ":ju%l bpJu%!p+}ku%H` u%H Ku%h+Lxu%l+mpu%Ԩ+,9Gnhu%"+Sj{o`u%ܓ OXu% pPu%H< PHu% xq8u%+r0u%"+:ps(u%!+S u%!+tu%ؘ Tu% uu%Ш+A]Vu% wt%"x+sxt%(  Xt%A+:yt%+Xozt%+"t% ~t%!|+?t%8 #t% "t%A+.>t%`+Tvt%d+t%\+t%(x @t%P+Tut%L+p xt%H+ pt%D+0Qht%$@+ l`t%$<+ Xt%8+Pt%!4+Ht%!0+P !=@t%!,+S8t%( 0t%! +(t%+  t%+2Tt% ut%+t%+t% +"s% Fs%!+\xs%+s%+?s%+Vs%+!-6EY9 b<k/l #)5=KW_ iovp4@u%LQ!   % 1 > J W e q }        + (press RETURN); ߫ @v%@v%Lv%tags643{}abcdDgGhHilnNpPqrs tw xy !:#=++-e^H-i^C-k^UK%%X_ 4%q % %Ԍ%P %ps  %DP (d%LP }D%P  % T%0T F %\ Hj F$%\ l  % ĉ%%FT%(T (m F%\ m F%\\ n F4%,\ n  %# %/ %F %LT g F T%NT i $ $%; %%u 2$4%.Z 2$%.2$%. d% $% % % D%[%ZcĂ%uF%j(o F$%fk F%jT o s t ,t uo T T dT X ,` uq Pt tt T uc eq dc gq hc \hq ^tq ]q _q VS }S pS S S ,S ,S ,(S ,q ?,q lR B,8R K,TR \U :|2>4>G>t>>>>>>>=??@O@l@@@@ZA^AfAyAL(A4AABB#BvBBBC5CiCtCCCqD'EEEFGHIKLMeNnDtNOO>PPPPQNQQ]R:BRHSSSS-T=TLT^TrTTTTTTTUoVVVVV*W?W^WWWXY|YYoZZZ5[\]_^x^^_____`1auaaaa!b'Uc V7Wa ӇU܇:4;gLj-ԣԣ։[}ˊҊOTZߌd؍"=U~ێ[p͐-d"B_u˒Ԓ!1B_2”˔Ք"*2<GYjy:̕ݕ n+>S^p|̖֖ۖ1EYۖ:hsɗڗ)2GYb{{ĘϘܘ =^zě ,Bt~~1 P vz]]a Y/ u :b G 2vNTZ6.bij$0ou{ 10&F '()*+,.1/ftp@1l@*< :*ɵ 6>4 # ? 7@ܫ Q AP BP CP D .@ E P F $P G 8P H xP I Y p D t x 1u 1eP u  '6CQ^kz]\P?]\@Kn| Cg k o s w { ֹ  ; 2 p  ' e       U   ! g cC ! "  # $# %0 &: 'E (V )h *q +{ , - - . .R%/: /Ni0~1 2 3 4 506 7 8 9 : ; < = > ? @ [N%\2 \B ]W ^b ^t _ _ ` { { | } }i~   -dd-ddTdd:dd:dd , 8@@@L`T\h<HPX#`#h#p#t#|$$$$$%%%%%&&&'''((($)0)<)D*T*`*h+t++,,,,----...///6;,;80D0P0X1d1p<x<==>>?222333978 :44@4L4T5`5l t! " # $ % & ' ( ) * . + , - / (0 81 D2 P3 `4 l5 x6 7 8 9 : ; < = > ?  @!@"@#@ $@,%@8&@D'@P)@\*@h+@t&`'`,@-@.@/@0@(`1@2@3@)`(4@45@D6@T7@d8@t9@:@*`;@<@=@>@?@ `!`+`$,`4"`D#`T-`d$`t.`/`%`CCDDEEFFccdd epe$#,#8&H&X0hx|$(<Hptx|8D H T@X@dlt|   @@@@@@`` ( 0@40 33333333,3333 UTC33%%xPNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sžȶ%Զ%ȶ%D% 33UU33UU33UU%lq$pqtp%%lq$pqtp% h%lq$pqtpP%̼%%,H     4 8D d   x   @ 333333333333333333333333333333333333 33 33l% !! 0000000000000000 h-33333333؟33%%% (root)`33 %P%C ! ! ! ! ! ! ! %% %%%D!H!L!P!%,H`P<L 48@|LD@Service unavailableP$A*aeabi 5TE  H6 T7xܭoAYrV`.T`0 AP:D"MP(onѽ%oΛ\WJ-;W8q&[ڎJYn'kGݭ?9,~Bwڳәaʝcw#Em\5a\.y>dǽ9DgZyG/;^lz 8{gY{{،̯jme\ZFug}q9xq!b񱴏40o?S9p5[hZFc^3򟹶eKj7"݌|ksD>fnN#tl#k4 EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf /B8H88lP$ V$ $b,$, g0$0 tt% \y% %!%!0Hu-!p!+D!!MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5770 5804 6487 6775 7483 7539 7613 7709 7884 7907 7930 7936 7945 7967 7971 7975 7978 7981 8086 8289 8528 8969 9407 9442 9457 9469 9475 9487 9536 9556 9596 9613 9630 9645 9692 9730 9778 9860 9984 10120 10161 10199 10236 10271 10281 10330 10480 10486 10491 10495 10515 10625 10645 10651 10665 10677 10688 10725 10759 10783 10885 10922 10944 11043 11098 11156 11167 11183 11235 11403 11610 11781 11845 11897 12169 12719 13248 13680 14018 14351 14464 14479 14488 14648 14819 14969 15133 15156 15180 15195 15270 15410 15587 15742 15754 15834 15935 15981 16007 16077 16088 16097 16110 16136 16151 16167 16180 16235 16246 16261 16465 16698 16727 16742 16811 16885 16958 16988 17026 17080 17499 17525 17554 17658 17764 17949 18061 18176 18280 18967 19226 19366 19402 19572 19613 19749 19772 19809 19854 20105 20201 20255 20354 20365 20402 20439 20466 20475 20509 20516 20541 20568 20603 20617 20631 20660 20674 20691 20700 20722 20740 20757 20768 20787 20813 20831 20854 20871 20886 20901 20919 20946 20973 20995 21034 21052 21084 21312 21386 21429 21475 21622 21778 21822 22101 22128 22487 22671 22823 23004 23151 23309 23330 23378 23388 23396 23407 23418 23428 23435 23450 23462 23500 23530 23569 23622 23680 23701 23708 23727 23748 23755 23778 23800 23820 23842 23873 23910 23932 23946 23992 24021 24055 24095 24130 24158 24206 24215 24224 24229 24238 24247 24264 24268 24273 24279 24283 24321 24330 24357 24377 24400 24419 24446 24468 24500 24516 24521 24531 24554 24576 24593 24610 24623 24632 24641 24647 24674 24681 24705 24726 24750 24763 24782 24807 24830 24846 24852 24864 24894 24902 24942 24953 24964 24975 24992 25009 25023 25040 25256 25560 26008 26224 26488 26760 26812 26848 26884 26935 26952 26990 27004 27011 27028 27031 27036 27045 27057 27068 27077 27098 27140 27178 27194 27225 27250 27285 27341 27381 27402 27422 27463 27492 27540 27773 27808 28015 28034 28071 28132 28170 28209 28365 28380 28426 28474 28497 28533 28543 28553 28564 28569 28632 28680 28724 28785 28818 28919 28937 29076 29098 29221 29235 29245 29268 29373 29429 29545 29576 29581 29607 29646 29656 29699 29709 29725 29740 29758 29781 29811 29832 29858 30055 30098 30102 30108 30114 30119 30130 30144 30173 30205 30217 30264 30314 30354 30381 30397 30406 30449 30455 30463 30467 30487 30504 30516 30547 30803 30852 31428 31455 31487 31515 31567 31573 31579 31584 31605 31621 31643 31672 31813 31947 31960 32096 32098 32100 32102 32119 32132 32150 32177 32181 32187 32192 32200 32206 32246 32248 32258 32273 32290 32324 32356 32394 32423 32452 32474 32517 32543 32587 32723 32725 32805 32851 32899 33004 33106 33145 33212 33219 33280 33344 33348 33355 33477 33546 33834 33972 34113 34194 34241 34247 34270 34316 34319 34345 34388 34453 34515 34585 34653 34746 34965 34990 34994 35030 35048 35076 35118 35162 35226 35276 35352 35374 35426 35470 35509 35543 35573 35604 35629 35638 35650 35658 35669 35681 35700 35724 35773 35790 35814 35857 36179 36182 36196 36209 36221 36228 36239 36246 36253 36262 36272 36289 36305 36355 36363 36371 36381 36392 36410 36427 36448 36470 36479 36489 36516 36522 36532 36551 36567 36585 36605 36614 36625 36632 36649 36668 36689 36699 36716 36722 36738 36753 36768 36789 36811 36830 36840 36845 36850 36868 36887 36906 36912 36931 36951 36971 36989 36994 37000 37017 37033 37054 37067 37075 37095 37119 37136 37144 37155 37176 37182 37194 37216 37230 37239 37260 37278 37287 37321 37344 37371 37403 37426 37446 37457 37489 37505 37516 37529 37552 37574 38082 38112 38143 38171 38185 38386 38608 38775 38862 38879 38897 38914 38943 38990 39001 39020 39042 39121 39313 39341 39459 39481 39622 39641 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_RC3. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_RC3 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_RC3 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_RC3 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_RC3 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_RC3 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_RC3 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5767 5794 6360 6660 7301 7348 7461 7554 7588 7607 7625 7633 7642 7667 7671 7675 7678 7681 7803 7988 8216 8736 9087 9116 9129 9142 9147 9167 9186 9207 9266 9283 9297 9319 9364 9390 9431 9509 9627 9741 9795 9824 9856 9895 9901 9934 10057 10064 10068 10076 10100 10182 10188 10195 10207 10221 10230 10263 10282 10294 10404 10466 10485 10604 10655 10707 10719 10738 10790 10994 11202 11393 11453 11502 11769 12228 12894 13317 13639 14064 14196 14228 14240 14418 14615 14776 14910 14930 14963 14977 15046 15159 15331 15466 15486 15598 15690 15713 15736 15795 15810 15831 15846 15867 15887 15912 15926 15950 15962 15980 16190 16440 16461 16477 16530 16598 16671 16708 16734 16810 17267 17293 17315 17422 17529 17730 17803 17887 17987 18482 18720 18871 18905 19040 19084 19223 19264 19309 19356 19600 19733 19795 19889 19894 19928 19962 19977 20005 20038 20045 20070 20088 20114 20121 20136 20151 20171 20211 20228 20248 20269 20291 20306 20326 20348 20363 20376 20390 20402 20414 20428 20451 20474 20492 20535 20586 20623 20808 20871 20907 20956 21047 21177 21230 21490 21537 21898 22048 22217 22357 22477 22609 22649 22696 22706 22714 22724 22732 22743 22754 22768 22793 22835 22868 22901 22936 22990 23015 23034 23056 23061 23067 23097 23114 23141 23159 23180 23202 23221 23231 23261 23287 23314 23363 23391 23418 23471 23481 23491 23497 23507 23516 23536 23540 23545 23551 23555 23590 23599 23630 23647 23674 23695 23715 23734 23760 23773 23781 23797 23828 23859 23880 23906 23919 23927 23938 23944 23968 23978 23990 24008 24019 24039 24055 24081 24103 24119 24131 24151 24177 24183 24213 24227 24241 24264 24283 24302 24320 24338 24561 24867 25285 25486 25726 25910 25988 26043 26110 26150 26173 26207 26218 26226 26249 26252 26255 26261 26272 26284 26297 26327 26371 26384 26397 26434 26448 26459 26470 26481 26498 26509 26556 26579 26628 26869 26902 27157 27178 27211 27264 27290 27317 27473 27479 27522 27542 27561 27590 27597 27604 27611 27616 27665 27703 27737 27794 27822 27867 27884 27985 27990 28067 28081 28091 28115 28238 28319 28429 28457 28462 28478 28507 28515 28556 28563 28577 28590 28598 28617 28650 28670 28690 28906 28937 28942 28949 28956 28960 28974 28986 29001 29034 29047 29102 29160 29196 29214 29232 29250 29287 29293 29301 29305 29326 29343 29354 29376 29554 29598 30300 30324 30358 30377 30422 30429 30436 30440 30464 30475 30480 30543 30664 30787 30800 30934 30936 30938 30940 30950 30959 30972 30999 31003 31009 31014 31023 31028 31055 31057 31070 31082 31097 31125 31169 31216 31232 31254 31265 31298 31318 31367 31467 31469 31534 31583 31632 31736 31834 31875 31966 31973 32034 32098 32103 32109 32218 32277 32528 32669 32796 32864 32901 32908 32935 32981 32984 33005 33050 33101 33160 33229 33276 33381 33524 33549 33553 33587 33604 33628 33680 33731 33803 33869 33967 33984 34015 34051 34085 34109 34133 34166 34186 34196 34204 34212 34222 34233 34247 34273 34321 34344 34364 34405 34704 34707 34721 34733 34740 34759 34773 34780 34787 34796 34806 34823 34839 34887 34895 34903 34913 34924 34942 34959 34978 34998 35005 35022 35039 35046 35059 35094 35111 35130 35150 35160 35176 35189 35207 35227 35248 35258 35278 35298 35311 35330 35343 35367 35390 35403 35414 35419 35426 35444 35463 35482 35490 35509 35529 35554 35572 35579 35586 35599 35608 35629 35642 35650 35670 35698 35715 35721 35732 35763 35771 35784 35806 35828 35837 35858 35876 35883 35906 35925 35952 35970 35990 36003 36018 36039 36053 36060 36074 36089 36108 36653 36686 36714 36743 36751 36788 37100 37277 37354 37371 37389 37404 37426 37476 37486 37503 37525 37584 37742 37766 37896 37921 38047 38065 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_RC3. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_RC3 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_RC3 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_RC3 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_RC3. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_RC3Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_RC3Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Groupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5655 5682 6258 6618 7303 7364 7442 7537 7577 7599 7617 7623 7632 7658 7662 7666 7669 7672 7794 7979 8207 8736 9154 9183 9196 9209 9216 9236 9255 9278 9321 9341 9360 9383 9427 9456 9497 9563 9675 9789 9843 9872 9904 9943 9949 9982 10060 10066 10070 10075 10116 10253 10263 10271 10290 10304 10313 10345 10386 10399 10524 10582 10601 10720 10776 10828 10839 10855 10894 11144 11316 11488 11543 11578 11828 12232 12531 12799 13160 13340 13659 13679 13692 13881 14025 14221 14355 14375 14408 14427 14528 14683 14871 15058 15078 15157 15255 15293 15316 15406 15427 15450 15469 15493 15523 15567 15600 15623 15635 15653 15921 16240 16271 16306 16370 16445 16515 16546 16576 16668 17159 17189 17206 17346 17487 17684 17803 17950 18117 18675 18971 19152 19197 19360 19414 19549 19585 19645 19695 19986 20095 20152 20249 20254 20289 20324 20339 20363 20396 20401 20426 20442 20465 20472 20489 20504 20523 20555 20559 20579 20597 20609 20622 20640 20664 20682 20701 20728 20755 20767 20788 20818 20848 20873 20906 20941 20979 21232 21301 21356 21417 21535 21694 21748 22009 22060 22436 22591 22735 22875 22983 23168 23198 23241 23251 23259 23269 23281 23302 23311 23317 23349 23390 23426 23464 23501 23549 23573 23585 23599 23607 23615 23643 23660 23689 23710 23733 23742 23761 23773 23817 23855 23882 23926 23954 23981 24034 24045 24056 24063 24073 24082 24116 24120 24125 24131 24135 24170 24180 24210 24233 24262 24284 24306 24328 24355 24367 24379 24398 24432 24465 24486 24510 24523 24535 24548 24554 24580 24590 24601 24625 24635 24655 24675 24692 24718 24742 24755 24775 24809 24816 24845 24868 24891 24907 24922 24937 24952 24966 25154 25459 25890 26081 26316 26504 26546 26596 26650 26698 26720 26761 26772 26780 26804 26808 26812 26821 26832 26843 26858 26889 26935 26948 26961 26991 27005 27017 27029 27041 27059 27082 27127 27150 27210 27462 27489 27751 27769 27796 27845 27875 27906 28038 28045 28094 28117 28141 28170 28178 28188 28196 28201 28254 28303 28343 28409 28442 28486 28509 28610 28615 28692 28706 28716 28740 28863 28944 29054 29082 29087 29103 29132 29140 29181 29189 29203 29216 29224 29243 29276 29296 29316 29532 29563 29583 29589 29596 29600 29615 29634 29660 29669 29681 29735 29793 29828 29847 29864 29876 29911 29917 29925 29929 29950 29967 29978 30003 30181 30235 30926 30945 30980 31010 31056 31062 31069 31073 31097 31113 31119 31194 31344 31463 31476 31544 31546 31548 31550 31560 31573 31590 31617 31621 31627 31632 31641 31646 31673 31675 31688 31700 31715 31743 31787 31834 31850 31872 31883 31916 31936 31985 32085 32087 32163 32218 32268 32367 32462 32510 32600 32607 32668 32732 32737 32743 32846 32898 33144 33305 33460 33531 33584 33591 33618 33668 33671 33692 33738 33793 33852 33921 33968 34073 34216 34241 34245 34279 34296 34334 34387 34427 34503 34568 34662 34683 34721 34761 34797 34821 34844 34883 34913 34920 34929 34937 34945 34959 34975 35003 35055 35072 35093 35137 35479 35483 35498 35509 35517 35536 35548 35555 35562 35571 35581 35598 35614 35668 35676 35684 35694 35705 35723 35740 35756 35774 35781 35799 35816 35823 35833 35864 35883 35902 35922 35932 35951 35964 35984 36004 36025 36035 36054 36073 36083 36100 36114 36137 36161 36174 36184 36189 36193 36211 36230 36249 36254 36273 36293 36318 36333 36337 36344 36354 36363 36384 36398 36406 36426 36452 36469 36477 36488 36519 36524 36537 36559 36574 36583 36604 36622 36631 36675 36699 36726 36741 36758 36772 36803 36827 36858 36865 36879 36894 36913 37458 37491 37519 37548 37556 37593 37905 38082 38159 38176 38194 38209 38231 38281 38291 38308 38330 38389 38547 38571 38701 38726 38852 38870 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_RC3. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_RC3 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_RC3 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_RC3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_RC3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_RC3 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_RC3Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5749 5781 6273 6562 7107 7153 7257 7343 7379 7394 7412 7420 7428 7455 7459 7463 7466 7469 7580 7765 7993 8469 8803 8832 8847 8862 8870 8884 8902 8923 8974 8990 9000 9020 9066 9096 9149 9206 9317 9438 9482 9515 9554 9588 9595 9628 9705 9711 9718 9725 9754 9866 9872 9883 9900 9917 9926 9955 9967 9977 10078 10140 10160 10280 10317 10373 10387 10408 10445 10655 10830 10979 11014 11066 11283 11597 12121 12483 12773 13166 13301 13314 13325 13471 13650 13781 13915 13935 13968 13987 14070 14185 14326 14451 14465 14573 14666 14695 14715 14791 14808 14826 14842 14861 14881 14898 14910 14936 14948 14966 15167 15406 15433 15450 15506 15568 15628 15659 15683 15742 16088 16118 16135 16243 16353 16493 16567 16643 16721 17213 17433 17544 17575 17702 17738 17866 17893 17933 17979 18195 18319 18387 18487 18492 18528 18564 18578 18601 18634 18638 18663 18682 18708 18713 18728 18743 18762 18787 18799 18821 18838 18851 18863 18881 18905 18920 18937 18950 18961 18972 18992 19021 19050 19074 19109 19144 19171 19358 19407 19439 19487 19584 19717 19763 19955 19985 20307 20436 20576 20716 20833 20968 21012 21055 21063 21073 21085 21097 21105 21116 21143 21177 21213 21244 21279 21315 21362 21382 21399 21417 21422 21429 21455 21471 21492 21509 21526 21544 21561 21574 21605 21630 21661 21692 21727 21754 21807 21817 21827 21833 21842 21850 21865 21869 21874 21880 21884 21919 21929 21958 21974 22000 22017 22036 22057 22073 22086 22091 22099 22114 22140 22159 22187 22205 22216 22222 22228 22249 22259 22270 22288 22310 22327 22340 22361 22381 22401 22412 22425 22447 22454 22479 22494 22514 22526 22543 22560 22580 22599 22776 23060 23370 23550 23761 23949 24015 24062 24117 24161 24181 24210 24222 24228 24244 24248 24252 24260 24270 24282 24297 24316 24352 24363 24374 24413 24425 24435 24445 24455 24471 24489 24538 24559 24604 24848 24874 25128 25143 25169 25226 25260 25295 25437 25454 25503 25524 25540 25569 25574 25579 25585 25590 25629 25664 25694 25749 25782 25828 25842 25921 25926 25980 25994 26004 26028 26114 26162 26268 26302 26309 26324 26351 26360 26399 26406 26428 26447 26463 26481 26513 26532 26549 26706 26737 26744 26753 26761 26768 26782 26800 26819 26829 26841 26882 26927 26956 26977 27000 27019 27057 27063 27071 27075 27096 27113 27122 27141 27287 27329 27839 27847 27871 27889 27933 27938 27943 27947 27978 27991 28000 28046 28172 28263 28275 28339 28341 28343 28345 28355 28369 28384 28411 28415 28421 28426 28435 28440 28467 28469 28484 28495 28510 28538 28582 28629 28645 28667 28678 28711 28731 28780 28880 28882 28950 28990 29035 29110 29176 29211 29292 29299 29360 29424 29431 29437 29536 29592 29868 29992 30103 30165 30203 30211 30233 30282 30285 30306 30351 30406 30465 30534 30581 30686 30829 30854 30858 30892 30908 30933 30981 31017 31078 31132 31213 31235 31274 31311 31343 31367 31394 31420 31434 31442 31452 31460 31474 31487 31499 31523 31564 31590 31607 31636 31960 31963 31977 31989 31995 32011 32023 32030 32037 32046 32056 32073 32089 32132 32140 32148 32158 32169 32187 32204 32217 32243 32250 32258 32275 32283 32300 32324 32343 32362 32381 32391 32402 32416 32434 32454 32474 32483 32506 32526 32537 32552 32564 32583 32602 32613 32623 32628 32634 32652 32671 32690 32697 32716 32736 32761 32778 32784 32792 32802 32814 32835 32851 32859 32879 32899 32921 32929 32940 32963 32970 32984 33006 33023 33032 33053 33071 33080 33111 33127 33154 33173 33193 33211 33232 33246 33266 33273 33292 33307 33326 33871 33904 33932 33961 33969 34006 34318 34495 34572 34589 34607 34622 34644 34694 34704 34721 34743 34802 34960 34984 35114 35139 35265 35283 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_RC3. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_RC3 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_RC3 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_RC3 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_RC3 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_RC3Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_RC3Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..