08P;&`g'&<  ';&`gZP''`'G. G.;&`g'&P@@<@T 08P;&`g'&<  ';&`gZP''`'G. G.;&`g'&P@@<@TU ;&`g`'G.yA;&`g;&`g;&`gQA;&`g;&`g;&`gGA;&`g;&`g;&`g\A;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`gC;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`g$f ;&`g;&`g;&`gRmKC#;&`g;&`g;&`gX`hpx$;&`g;&`g;&`g (08@HPXQ$E;&`g;&`g;&`g`hpxYR$;&`g;&`g;&`g[I$x;&`g;&`g;&`g (08@OmI;&`g;&`g;&`gHPX`hpx][$;&`g;&`g;&`g$>;&`g;&`g;&`g$;&`g;&`g;&`g$s;&`g;&`g;&`g$;&`g;&`g;&`g$;&`g;&`g;&`gA;&`g;&`g;&`gm;&`g;&`g;&`g$;&`g;&`g;&`g $;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`g$Q;&`g;&`g;&`g (08@H$;&`g;&`g;&`g $;&`g;&`g;&`g$;&`g;&`g;&`g$;&`g;&`g;&`g$;&`g;&`g;&`g$;&`g;&`g;&`g$;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`gA;&`g;&`g;&`g}ΐa*}\qd&Y̩S2+Aq(Sc] &l":Qe.ZP> kIˇ?4߸5 ]jB? H 2j]EG. . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4@#4 (O"O"W"7+7+ ԀԀ,,W"7+7+NetBSD@ ;PaXUXSRffffUVSX&7+9s 9r[^]UWVSXǦ&}P PLt,1t&tuAt[^_]Yuڅtft 9s1u+r 9vu׃ 9wtt_ t1uC tuS u9rh39[Jt*tQ"UWVSrW&E9s{*s;9r[^_]UWVS1WH&}u ,0;6EF `+t/uut<$vT7+E9s ;}r !$7+E9s ;}r $kmED$D$F$$ `+QD$ zD$ D$$D$Z$^,$SW&Iu1ƃItЃtLp${_[SWÖ&HuYƃHt(|$Lp<$_{t?t<$B{tЃ_[UWVSh4 h? h0, 1t:PYxOvh0,j MXZ3hq$h0, h0,j Mj2UEU MsMU HE]UVS1ۋ` tVPZYu d C܍e[^]USԷPhH h0,h0,h ~  CtsPh h0,j|UWVSE tuh ;IURhc@5@,| t5D,h jRux"3"Mx"3"Ex"3"WVSQRP5D,h ZE tx"3"RPh 5 u5D,h 1e[^_]U5@,XUjhc 5@, t5D,h j1USRj EPSc xU:t Sh+ j$]UPEU PhD  JtPhZ GEEEPhc5@, t5D,hq j1UWVSSuE H1ۃv>PWAZYtC@ uދD Eh WZYuE FEEPhc5@,} t5D,h jS1e[^_]USu Sh j]UVS1 tSPZYtFSh j$ e[^]UWVS ]u} ShD  } ~ShZ iF1}{EFE} t!vtt>uhM BEEEEEE먉t9Wuhh jM9MuB}t }uEEE_ESEEDEEċ]9]}t#}tEЃ}t}uEEEԅu.u9uCE4 5D,h w )}t}uuu EEUU9~uuuh jk]lSE^u h j1}EEuĉu܋uuUUuuMMPh c5@, uEX@EUu5D,h jNEEPE4 h CE rh rYElU9U|,h,h\#XZCtCPhD#_Xj ^CtCPCPh  CtC"PSh(  Cts؋C4 hK w C$PhY ^ZYuKXEm1e[^_]UEd,]UE$,]UhL jUhb jUhy jvUh jgUE E EE]Uhjjjuh x,|,Uhjjjuh ,,0,Uhjjjuh l,p,Ujjjjuh a,,Ujjjjuh#9,,X,\,Ujjjjuh P`+uj UShjjjuh Ӊ‰؉,, uj ],u(Ujjjjuh ,,,u(Ujjjjuh ]X,\,UWVSu,,X,\,>WXuWh j=S~Y_u ShJ j/xxuSh] ]hjjh EP uu뺋,#H t uhw  P,WPZ_,t/#=t ,,tt h m<X,ƒt!uh QBu^,Lt>!t.t ,,^*,,Bh j,we[^_]UVSp,uXD,,H,L,, ,;,,rgj,D,, ,H,L,X=5P,uT,E D,)EU}t 13A}uke[^]ËH,L, t , ,Uh h\#j.UUh h\#jUUSË@4URs(PZYts$h\#jS4K(E%= u!HPhm8@QR @ C !jjjQR Bu@uu8uK ]USQ9v SZSPEPKƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h; jDC4WPs(Xe[^_]UWVS]uVh`,jC4uu s(P(8jVj$8؍e[^_]UWVS,}t , , ,,EUEUEU}u*, t!11;E} yt㡀,, t(jRP5(,4,P Bu@u 5$,hD IuSh,Ɖ 19|4 u5$,hh 18t5$,h\#j11,E , tQE, ,5,5,QP,,,,,,5,=,9}uA9uu' y#0Ph"h0,%h* s5!,!,!, ,Z5!,Vju迸9uyG!,!,[0Ph"h0,hd @S1-s!,!,CS S~5!,!,_X؍e[^_]UVS\!,d#,j?{h݉!Y[{ tSlZt|/uSh Sh h ,S ,ujxh 2@V YP,Yt(h Ps!,YZt VZ1/SkX5 ,h\#h ?Ve[^]U!,tqPYy60P5 ,hp&h0,9h ?P!, ,tP,5 ,) ,XZ ,!,!,1U!,t-Pz ,YtP+5 , ,XZu<Ujh#,h,A yj , , , ,1,@=uUSUE !,, !,M,Ћ] Ӊ)~,@[]Ã06$ 1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HÃ1UWVSӃu]1$!,28!,$!,@ujjh$!,h$!,th h\##=Y^$!,(!,8!,^u+!,vDh uPp\0~h@ h\#":Y[the h\#:XZ !,= !,~!,P!,$!,e[^_]US]=!,uU D !,!,= !,x!,P!,$!,[]UU=!,u !,!,U= !,x !,]UWVS hv ң[18t‰EE U׉=,!,u7U}1 !ÀAutȀB9uύEPnjYth h\#8XZe[^_]USH!,9L!,X#,P5P!,ZYu[0Ph"h0,hk&78X#,HX#,uaD#,tjtJjH!,P!, X#,u D#,ųu١L!,PL!,P!,M 1]UWVSRUL!,=P!,@!,su1;U t619~, 9uK9~@19E~@1FЋńt@!,X[^_]UVS5L!,P!,D!,19~@tD!, tD!,1҉[^]UWVSfEp E}u.h4!5p#,_Z]tjEP Y^uD1Gh4!R贛^_OP$",Zy }Ku PPX x E~x#,| tf%,uh 06X멃u'h R&ZYuuh ׋X!,jEP6 [_fE T!,9X!,X#,=}\SRMZYu[0!Ph"h0,Dhk&5X#,HX#,D#,tjjT!,X!, X#,u D#,uΨuًX!,EHp#,p#,8pZx "xtދ$",PRR yɍe[^_]UX#,@!,D!,L!,H!,5P!,|P!,X#,HX#,ZuD#,tj3tjUWVSPp#, t u h K4X -6ƅu p#,8u@p#,?5",Ë=",X9=",|^SYt=d#,tj jsPEHUjjjRVI;EtGSZyh1e[^_]Ë ,Q,y ;,| t,J ,Uh,PXZUWVSu1ۃ=l#,tV> NyV_ H =`!,9d d!,X#,؁}U|WQpZYU=`!,d!, X#,uD#,tjbtj=d!,u d#,C9F `l{ `!,9X#,؁}ULQM5d!,ZYMUuNo0Ph"h0,hk& 2X#,HX#,u}D#,;tl= `!,d!, X#,uD#, u d!, QF @t00Ph"h0,8h ~1!uhB!FPjY_Vu P]ƒ u$z0PVhp&h0,hQ KuSRUǃ xq>!Uu7RmZy4-0_PVhp&h0,hi ,2R%ǃ=L#,uWhu h0,Q tE)؍X؍e[^_]UWVSW11 ,yh,^(,P,s=t#,9 x#,X#,؁}U|WQZYUu`A0sPh"h0,hk&+X#,HX#,D#,tjo jA =t#,x#, X#,u D#,uɨu١x#,u d#, t1f,9tlމ߉",x#,0x#,p#,f,@tf0Ph h0,h +f%,p#,t x#,x#,p#,e[^_]UWVSWp#,C{ u)ÃEp#,FTRP Y^tEl!,9}\h!,X#,ށ}VR_Zi5l!,h!, X#,uD#,tjtj h!,5p#,ljD s} usnExtx#,M| th )Y1vEl!,9~Vh!,X#,߁}WR)YZ=l!,h!, X#,uD#,@Ch!,25x#,NjM}t/s2PR_Zth!,D } )s!l!,9 h!,X#,؁}tVQxZYuV0LPh"h0,ohk&(X#,HX#,D#,jh5l!,h!, X#,uD#,=@h!,Me[^_]UWVSQ]utuh XZ} 9EF95\`+}h,h$^XP^vs\;t.ˆUPh XZYUtF-   /B000CQ<\t빸 1e[^_]UEH!D#,EPhht@j x$Efv``+Efv\`+U= ",uE",E ",",",9~ 1; ",~hd)%&XUWVS$",}t~} t 9 ",~[C ~K ",tISPZYtF=d#,tj jvPjjjWu(<u19$",uh &X؍e[^_]UWVSP]U u hd)%%XS19 ",~BPJESAY_!{$",uSvPqx6;utV6Zuϸ1e[^_]UE ,DBuh o%XP< ,u!,E!,1UE,DBt ,EPh %XUWVS$",,p#,EDJ@t t E@p#,޹p#,0U?& } $ }^@p#, ,p#,8f|y@t t@p#,܃tSj hp#,5p#,rǍ vp8"uh A^t-u16UBQ@u^t -uօuhd)%#[j hp#,5p#,2rÍ v8"ult@p#, ",.h$",]tP%1Ƀ/QPZYrp#,M:)@p#,DPp#,@PX,t(@p#, ",;u $", ", ",9Et9 ",}؍e[^_]U ",$",",",x) ",",",",p#, ;t(,t# ",у~ ", ",JuJ p#,:;u$",9t ",t1]UVS!,11Å t]9!,u!,J@ԉt!,[^]UVSujpZu+0)Ph"h0,Lhk&!FV CS FC؍e[^]UMU 19tz\uBPQZYUWVS=@#,ujEH!D#, ",PjhB!h ykh g^tZP[=wJ@ PYt:WPYXZ|3/t 3/D3h S輜5 ",jhB!SjcUM=X#,tI D#,QU=@#,uj+EH!D#,jh#,GUWVSE$",1=`#,u3t x#,| t>f%,p#,;u1p#,Bp#,: u)؃u ;.u{ tԍ<X#,S|Zu# X#,uoD#,tj7t[j$",t PFXPPj0ƃ t9u\#, X#,D#,u른e[^_]UWVSQu",X; ",|1ۋ",zX#,9t9u%SFEW=á",$",XZUSWjc/ u X#,t$195 ",~FPVj4/ u)ϋD#,tj jSX95",M~WVVWYXMXABy ",19~",)@$",=`#,t R3XZ\#, X#,uD#,FM1e[^_]UWVS}5",ơ",",)C=$",Y9~9 )C)EE1X#,VjYu' X#,D#,tjt|jPEZtEG$",PPj-ǃ t\#, X#,u D#,uu6l$",@PX]EF1e[^_]UWVSQ] X#,Suj!- u3 X#,D#,tjj19 ",~CPNjEpVYZ=`#,tW0EDXZE8G+]C) ",5$",\#, X#,uD#,t{1e[^_]UWVSu 195 ",~@PEuXZ1;]US_UCЋ=#,9 #,X#,=}UWQZYUu[[0Ph"h0,hk&X#,HX#,FD#,tj.j`=#,#, X#,u D#,uΨu١#,ЋKS #,B9|^5#,X#,Ё}U\SV^_U*#,#, X#,uD#,OV#,f u u~Y[xhEH$",X#,5#,Zu X#,$",PPj|* t\#, X#,uD#,t1e[^_]UWVSu=#,~ #,y#,1X#,W5#,XZuS{0Ph"h0,hk&X#,HX#,ucD#,tjtOj=#,#, X#,_D#,uͨNΊ<\uFFBDtF9D ؍e[^_]UWVSET#, H#,t h `jEP£p#,XYJE #,95#,X#,=}U\SV^_Uu[S0Ph"h0,hk&X#,HX#,D#,tjjX#,#, X#,u D#,uΨu١#,!L<% s=#,9}u #,p#,p#,x=p#,8\ux=p#,@1s p#,< uD#,) #,9^=#,X#,؁}UtVWY_UE5#,#, X#,uD#,jqp#,H p#,s#, x|#,؋5#,9~S#,X#,=}VRl_Z5#,#, X#,uD#,#,@ #,ދ|#,#,9@FPT1=@",u h Sh@",PJE؋5#,ZY9~RX#,=}V5#,ZY5#,#, X#,uD#,'.#,)ߋEHMt FD7D2p#,Bp#,y #,9^=#,X#,؁}UtVWZYUe5#,#, X#,uD#,5#,=#,|#,#,Ѓ˃=`#,u",HP8$",PRPX^_B1p#, Bnt#ptltp#,: tp#,Ã=`#,u9",",9 RP3Y[Pp#,X=",1 p#,Ant4pt%lt%p#,9 NWSPNp#,벡$",PPi_ZS1 p#,Qnt+ptltp#,9 p#,뺡$",PP [^5",=",6= ",u h ",; ",5",=",9}9| h 1 p#,Ant#ptltp#,9 t%p#,Ã=`#,uS0$",PP9ZY#1 p#,Qnt'ptltp#,9 t^p#,뾡$",PP^_1 p#,Qnt8pt)lt)p#,9 ZP5",5",5 p#,뭃= ",\1p#, Bnt#ptltp#,: tp#,1=",ul5ud`+",= ",p#,Plp#,w u݀8 =\#,=L#,zqq@DA@= ",u ",",Åk1 p#,Ant#ptltp#,9 tp#,Ã=`#,ub=@",u;!thSh@","  @",",u@",RSeY[9 ",\#,1ۡp#,gt[B tL0 αj hp#,5p#,U#, vO*ptruR@p#,s8"uh  #, %#,߃t #,p#,8 tx u h 5#,X#,tt6ƅu+ X#,D#,tjLj##,9t'tP5#,>XZ5#,", X#,u D#,uut#,Ѓ=`#,u!Ѓh#,h#,Y Y^yt#,t#,#,p#,nt5ptlt"$",PP_Z1y3 #, #, #,@p#,밀pup#,p#, Bnultp#,: tЃ˃=`#,u5#,5#,5#,f $",PP'[^=",5",R= ",",!; ",=",5",1 p#,Ant#ptltp#,9 tYp#,Ã=`#,uSO= ",U1p#, Bnt,ptltp#,: p#,뺊X]ڃ1Qu p#,p#,DA@?Å ", ",u",",PjZY p#,Q8"uh ``+1 p#,Qnt$ptltp#,9 tkp#,",P ",``+9~PR"1p#, Bnt#ptltp#,: t p#,á ",= ",t",Ph!XZ = ",m1p#, Snt$ptltp#,; tp#,t #,@PX#,@P`_=L#,h$$t[y$",@",PjsZY]",jPPE 1y@Ah 1*%p#,8 s=#,h e[^_]UE Puh'h$,7UVSE8^u@8]u@]tC t<[u4PJҀw(tp9t  t @]u@1[^]UWVS5p#,< tQ;MtIZ<[t<\t!5Se_Åu(h $6^z uh<  Y1S멉)E ,%,9(%,X#,=}UtVSoXZۋUuS 0>Ph"h0,ahk&X#,HX#,uuD#,tj>taj5,%,(%, X#,u D#,uѨu؋(%,5p#,ߋMEp#,=d#,tj jPS萿Ã؍e[^_]USp#,< uh X< u=0%,u$hS XJ p#,R t8u Ӌ0%,P8X0%,t=",u P1Y9j70%,Zu(軧0Ph"h0,hk&VO",5P#,S50%,5 0%,t+h'h$,SP̯50%,0%,1ۉ؋]UWVSVp#,Pp#,M1ۀx%u8Huzp#,=D%,h [s9}ep#,Pp#,D%, p#,\Pp#,D%,2< @%,p#,M8 uD%,X#,ف}|WR貶ZY=@%,D%, X#,TD#,tje[^_]e[^_]UPEEjEP5T%,w[ U<h Ph h0,j菙UWVSÉdhW3`\ Å=1ۃ8#)tSWVZ ؍e[^_]USfX8u1ɀt []{[]UWVS} 5T%,\fDž<X譖uJhPj[ u{8m8th"-ÍjjP~[ @u>8th jqvf8utSVWY y 8#Oh%)?jW]jfDž=X%,t fDž9DžjRjY fDž9fDž9T%,jSVZ @ua8fu ftR(@ufDž=X%,uK"T%,@uՃfDžft@u KfDžIe[^_]UWVSQ}u VWC[ZÅuzjj٣XZu hR jt;s jEPW8ƃ ?tE8thh jbtD8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}XHpz}z9zu};zu 9u{;Mtt9u ;MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEU HZ@9BD[]UWVS Ɖ׋EEE EE1;U}9xu90u,]9XuM9HtyB܋EEE9]}!9xu90uU9P uU9PtEE,Ck,RUQgZYt&UTԉ2zur}z uE1ɉȍe[^_]Êt"tUWRP Y_}ËBt1Uj觓L$qUWSQ`%,-%,wh%,ڞw ]]5t%,5p%,h j5|%,5x%,h j 5%,5%,h jƩ5%,5%,h. j让 5d%,5`%,hF j蓩5l%,5h%,h\ j{E$hr jfEPP$h jR =%,t>u`%,1 ujUeY[_]aÃ=%,tUE Puj蔨 UWVS}u cPh jϨ3}%,B9tT%,e[^_]UWVS$ ]5%,t(V\$V20Y^uuh j0Pu  ƒ W p4$蹚0ZtWVPˇ uWh j 5 jj0։( y 0h jju ։ƃ R Wh V ƒ -jjW ‰  V h _Xuh/ jE[^=jh h R( y RY߉R誡Z=t7w=bt%=bu;%=u&*! u hQ t u h] hjYu VbZƅ/ t jZV8 jZVP5Z KjjP@& %,tS SQPR( &,kP^Ɖ4PF8t t10hu 9vBFu h je 1e[^_]UWVS\]ƍ}ZE5 (,&x&0賟4訟8蝟EPS9e[^_]UWVSĀ]p$tV:V:Y^㋃p tV:V:XZ㍅xPDk1RPuuXJt5`+9Ήt}"Q95`+VPh e[^_]UWVSP] -E41RPuukEƉ׊tC|1ׄtuju1RP=tuPh j膣1EtZ WVuuC7VZ vWVuu|CkWVuugCk ËEe[^_]UWVSTE‹EJu E=EHEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉUEUE}t EșŰU9Uu‹E9uM] E} uWVE,# E =%,EEIu EE1 t1҉ËM ʋUщe ʋ}t}\RPE,r$h|`%5%,Ãt#ESjPVaUHt h 臟YS/yZ%,%,E1p%,t%,E<EEtEUE\EEEԋU+EUE܉UEs‹EmJu EE1 t1WVuuA9E 5E01҉ t1ҋMԋ]+M]WVRP\A9E EEEEuuԋE,"EЃ Et8ELۃ0EЋPatEhaRuuPh 3GPEЃP53‹EЋXX9t%ERQuuPhO juЉu]Љ]EԋU؃E܉UEEEEE]$tSS;Ut ]K}O;MFt }_] 19](9Muu܋E,!EujP2EȃEEE$t }]Sd9Us"<瀁}}E= u+}}EE€KEFEMQRPuEPE]tXpXjub6XZ9u9]EE@]k,PuĔ^XEk,tԉExVEk,tFF E܋UFVE$EċEtP4@0P,@(FV}tGPGltȉF Ek,Dԉx(}҃ P$]E}ĉ8EPEXE1 t1u}]DEw;UnE];Et\]ԋu)։]uE‹EJu E?EJ1 t1WVuu2=Puuh j襛EtP @@1ҍMQRPuEPYE0juL41ۋE;pEEE9vhI9uEtpp EAuu܋E,PujP.EȋEe1 t1u}C<҃<DEE}k,PuEZYu E]ĉ1ۋEEEĉƒE9 k,E}wt 10x}t7t |44px u܋}px}Єtw04w(,px}wp I9utGE@ E}k,}D$uu܋E,ujPw-EȋEk,Ur(Er$ t1u}Cȋ]E<҃<]DEEEN]ЄtKK9M}1ۄt_9]u 9M>Et\uԋ})׋EEIu EE EÉ1 t1RPWV9PuuSh j[E}ĉ8GEЋP9Ut,EuRuuPh j$E}8E]ĉE Eu%,%,EE܋UEԉU/Ee[^_]UWVS uEP F VM]_9EEr )ӉM܉]Fƒu >uFFFuEmE9v*Wu h!jGNFF1ۋE1)ډEUF@]t[ ][]E1ҋM])ӉM]E;Ev 1)EU1;EEFUUEEEeM1SQRP<FVe[^_]UWVS]E 8wEE 9MUS}HPH EU,hj,QWAh}EEPhE ƒyEqRPh'!jܕhj,3Wg}t EECEEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ0΋QRPhB! EEǃ<EPURvSE܉EUjEPURSIMM܋E؉ẼEE19~k,ŰD$EUGm<EEm`%,`%,h%,h%,EЋUx%,|%,ẺEMEPh ǃ yNQWPhS!0FPh ǃ yNjQWPhy!jԓ1eY[^_]aÍL$qUWVSQ9q%,%,,%,%,?%,%,%,%,1h !VWp ta#DtNJCl5%,뷃b$ %,%,C%,C%,u5l5z%,e5l5^r%,R5l5U%,@%,/5l54%,%,5l5%,Yl5%,h0,h!3(XZ ,)lj80h0,h!(^_=%,x8th#!5%,t hd!jYtjj)h,K!Lh+jjeZY@u h!jj h,K!hjM00h!@P@ uh !t|j/SD[_Åu@`%,׉hjMhj}Mj'%8%,P|%,1uph!jԐjz%,؉8hDj803PyP3h;!j聐W5%,OG9=%,=%,tl95%,~]%,4^FY烽 tgDž Dž,,9%, %,4=%,tj*y%,xtP%,0j%,dhDžldPh %, à t&v8:h[!jVDž1ۃ=%, 3,%,,4@TGXRjPjj($tPh\!XB 0XHt&X HX8<@($H 8<@h RV'1p%,t%,0YZ9t4VZyPhq!jPh!j ‰Ju MYtH‰;R0<8Ph!x tH;01 t1ҋ+8<9ȉ|;8<}3 ;8<Y08Dž<߭8ݝ8y11RPSQ21ډ߭ @!ܝ8=%,pݝt{\PSS ݅y+؉Ph!j2 ijPh! \`+EU5%,9Ɖ 9jS\6[_@݅u؉]Ph!%,ܝp H!ܝ8 ء%,40%,<0YDžDž8985pt_|OlLRjP811RP$8DžtGlL9 ;vukQ k4 JHJZH XH J HPW4 T0 T0VjQ'#XZtGl8hjP85\8P Pu|Ph![^DžDLJ<%,8%,0H8ȉ9w9rÉDž0Ph2!70Ph2!j 4Dž0Dž8Dž;U09048Zrى 89 +4im۶Ɖ2SQVPhr!'DPh%,VW(~Q8D\`HP\Ph%,Wi\DH0S, Y9Ѻ}uDž0Ph!@19w=D\`j\Ph%,W\D898}8SK t+4i۷m۶DQRSPh!DPh%,SW$~8E,]ZF(D0t#%,1DžDž8Ph!/90~k,D$Aۉ<Dž ߭߭`%,`%,h%,h%,x%,|%,DžXDžTDž1DžDž90ttk,N9Hu;V tyt_|TRXR01RP(&1RP1FV 9|,PQpQRPjWI(k,Dž;P}VTQXQ0)Q t pb멋T=%,t1p%,k,D;$p+$9~t$DPSh%!0pPh Ã9j0,j1SPh:!j0#tVf0:t&0Ph_!jÂ,_Phq!j裂,?$ʋ$(($(0411ۃ8t="k4dd081SQRP'd1)Ӌ$(+$(SQ840($Phw!jB8G8904|Ph!j  jh , ,jGX 9%,/ Ph!j臀 5%,=%,th$!hT hh.! SPhj!j>,5%,;K؍eY[^_]aUE UMQ1]US]C Cs4SqjS1]UWVSPj [rZ1ۅ'ƃ}kEP:rÉF X1;}}lAAA AMuqËMXu,kF t 48yYPyVyXZG@ EEFFE FVEFVj8q_u/1~ tF ;}}k4yGYPyZV~yX+P 1EsC4CH1C 31؍e[^_]UWVS]s$tVVnXZs tVVW^_{G 9w~k4xFYPxWx1XZe[^_]UE@H]UE@@]UWVSEXC9C@CPh!j}kCPs :uush!j}FC ksFFF FspZush!jk}K kKK E UAQMCSEUCSEURPuu#E UMA Q}} EENjEe RPu13 yEsh!j| EC1e[^_]UWVSQExGE19E~4kw N^9M U|V 9U UV} E )G@1Z[^_]UWVS]K4q{C,S0EU%EuuuQMg Mt)Es vEC C C[EEF}~NjEfRPss 1 E9CuaCCV}~EFNjEfRPss 1 uh! zYEC$Cs4SXZEe[^_]t@Ë@ tËÊtBRtUWRPaY_}ËBht1UWVS ]L 1󫍅xPAY^$,tSh[uЋ}ԉ t,t)ƀ,tC|)ƉDžDž 9 Dž4DP S8tGpBu,eE&,`+Xe[^_]ÍL$qUQ %,%,5%,5`+D!EM MuQQ$RPh!YMɍaUS]CtS P S tSPSCr s dZSzd %,X]USEPsH) %,%, %,H1҅u0&,Z[9t &,u&,u h8 !j0X4CXtYZ@]UWVSu EEE#`+&,%, %,M11ɅtJA9~ʳ9M}#t%,hL !hx hh[ !fy}9x4u }9x(u9p$t버t%,e[^_]UWVS]uuu SO trNj@th} !hp h1GGWX9w&~6Gth !hp hh[ !xwVw ,G [^WY%,`+;%,V=&,tGWu&,P= &,t+GWu&,WGtG4WPZWX%,j@j+Vj+G _4E UG$W(G,W0wE #`+G8&,tz8GC GtWP { _ Ge[^_]USEM Puh !hh h4h[ !wP ʉPHPPP s E]XPs4H %,%,%,@ &,H&,0@t &,H&, &,H&,P4JH8&,9t!tXYX tAP]UWVS Mu }uWVQa‹EZMt %,1ZU%,EEEPWVQQ EMUJ,B0xB BB4RPX r J1؍e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=`+Y,A0Éa,ڋyY I4 s RPWSQ  RPWSQ e[^_]US]C%CSjSN1]UE UMQ1]Uj0(UU P,&,PYtHJ ,&,@ ,&,UWVS] (&,C0tS4P4S4C(tS,P,S,s$tBFtV P V V VY^׋FtV P V VVXZs uًCpd>^C0^${s^ ]e[^_] ^UWVS]E EEEE@&,Etp9XH0udxu9w,uDu9w(uPFPZY9뗁~atuuh !tF 9t/ Fp9t(1SQ1RPuuh !艤F(V,F V$;EUruPuuh !Wuuh !? }t2tF(V,F V$9Uu9EtPuh! ! EUjuuuuVSǃujuY[}t%tF(F PuuhB !蠣hY !h hh !0]LEEE1ҊM t1EUEUĉEԉU؊$EtẺU\EEЋEU+EUЉEUIu r1ҊM t1҉EUEU+EUuuRP6uuuu 9uOE1ҊM t1҉EUEUă+EUEUuuRP9t"}tFVEԉUF EE }tFFuԋ}؉u} u}uEuEԋU؉EUEjuXZE9EEEEE Et EUEUEUeY[^_]UWVS ] }t$bƉ׋EVWVRPh` !^EbuE‰9u+ztE։9u 9u Tv9sE]Ã}thq !9h,ZYtCpStCHuRPuuEU}t h !耙XEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPh !D6,6EtM}`d)RPh ! tCpStCH9Uu9Et]1ۉ؍e[^_]UWVS u }^j8j E@EMAdLALA LA A$Y[}thj ËE쉃PXZ u =`+ƉEE} t h !ۗX`+EPjh WVuhj ËEp E쉃PEP P jP^_ts s@5`+} tURjh  t1WVu$hjp EEp }E}쉸PEP P jP}ZYutCHSLC419|} tMhJ !菖X@E?t} t#h !pXu uuS9u u9AX S0AX]tSAX1zSt ǃ ǃL7tX\+1tǃ`dǃt}uWj Ɖ_tCtPq ^tCtPK FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjS;thlSXZ؍e[^_]UE Puj`+ UWVS]FHlj1RPuu EU슋tC|1EUEUtURjW1EURPVtPu h !F u|1t$QPuu AF P@EUE~ vQRuu kQRuu k NjGEEjV{XZ1;EE$Et\u})׉u}E‰@Ju 1 t1WVuu€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et EEu } tu}}t EEETƉ׋E t1 9;uE|LEE Ɖ׋Es|| t19EMWVUE&ZY‹E9sE}u1PWVE| 6E|E||RPʋEuEH_X}t EP4PR^ ;EE:#] ]Et E!ËEU| t19r^EGމ}t(SuuuE}@,@0E@dpx E3uuUEZY9|C}t.EPjRuuu|E}Dž|E}u1PuuًE| }u뼍EPEPEPuuuuB|[EA}u}t1U9~|u@EiE@dpx }u}t<}uuUE~ZYPuuueE}s}~,EME uEMEM}~EMEtxuDžpp9EPEPvvuÉE~uP H1E@,@0I@u?ENjtx t1C,S0C CC4SP_N]{ E u$EtDNEtxC4SP[@p]M}tE@,@0Etu2EMEEMEXEURjPt5t5utt5t5h ! LEP }tDP4PRF}xUB%|aE|;EZ,J0tB BB4RPX||e[^_]UWVS u_EUEU t1҉E܉UURPuuW EU1EURPKt1ҋM܋])ӉtF|1)ӉM]]eEU]8vfBH4MQjPjjRt Ph !$Y[MA tP@F(V,@F jQXZtF(V,EԉU؋EUF(V,F 1҉EԉU؋EF vkBHMQjPjjRPt Ph !~[_EP tM]JZ}zP4PR:Ylj1M]M܉]‰1 t1҉щ‰UtVR Ћ]9]]]}-@@EUM]HX Mԋ]؉L:\:sR v:]9]]]} @EU]XkEԉD:8]9]]]} @EU]X k EԉD:BHMQjPjjRt Ph !XZEP M܋]tJ Z$JP4PR:EP4PR1e[^_]UWVS}cvfBH_MQjPjjR!t Ph !O^XEP tJZO(_,RW jPY[$EtG(W,G 1҉EU苷FHE܉%1RPuu&Ӏ}tG|1Ӏ}tURju1RPVJtPuh !u 1Ep tSQuumƋF FtZ< vSQuuBkSQuu-k ƃ~t*uuh! tFVG(W,FG vkBHMQjPjjR\t Ph !XZEP tN^JZNJP4PR:Xju ^XtG(W,G 1҉ W[Et UG(W,G 1BHMQjPjjRt Ph !ZYEP ]t uZrZP4PR:X17D6,t G0W4G(jjP0uu Wde[^_]UVSUE 9| 19[^]USPPh\!h0,T'h0,h!`+CtsPh>!h0, 'jUSSE] tt %E!h!s@ZYu EeEPhvd5d:, @u35`:,h!j}]UWVSQ}u t~^h !SYZu ELhh!SYZu E2hB!SYZu Eh!S[ZuEuh2u#vbZYvMEPhud5d:,  @u65`:,h!je[^_]US}t?,Shzd@5d:,  @u5`:,h!jVRPu `,=w`, `,UWVS5_,Ctt* t%Pσaw<w u;w]KAfw"k 1i 19u5 ,{$1TtDQt!@ u 9t1 [^_]UMU 9|]UWVSƉ׉M_,_,ÉEE1RPWVE)Ɖ1UQh D%pXZ}Ut_,H9u_,H9u u9wBRWh!: e[^_]U塸a+=_,tvPh!5 `,5`,5`,5`,5`,h! 5_,5_,5_,5_,5`,h!5:,h*! Ph8!hB!s`,`,5a+5 `,5`,QRP5`,hb!^,h!cs_,_,5_,5_,QRP5`,h!" 5_,5_,h9!  UWVSQƉ\ jEPV膮 >u#ËE8u. 8"u w܉1e[^_]US'P $3"Ph3"Ph3"Ph3"PShq!h0,@,j UWVSEM a+9uh!5a+ h!jMыEEUMj؉EE܉]]#]؋]#]SPWBuAtTa+a+=PuR2 1P5>,R  9a+uN#u5>,}e[^_]UWVSEUϋE E컬 !t7!EUuESh7!蔩XZU&ff=Ut1=_,t fuuShU!Q?ff=u+2…h!?fLJ_J1f=U=:,u Sh!>Y^:,tSh!>XZ1bEj(VP聫 ۋUx.pōH 2`,tLfLJᵃЍe[^_]UWVS9:,u:,5:,1Xƃa,e[^_]UWVS@}EỦMЋEGWEĉUȋG WEUE !EEtEl(!11}=a+E_,_,UEEEEM]ЋERPSQBPE܋UEUuuRP%RPuűE܋UEUuuRPRPE܋UEUuuRPRPuh !,"uuuuuuuhJ !v h,jdhc,< u hj !jEc,hA"hc,&kY[c,Uc,< <$u z Ћ ,DQu<-5j EPhc,;Ɖ׋EEh8&PEԃEPhn !u tuh9/"um t L =a+Ήʋ5_,11WVRPƉuhq !u ug _,ω%_,Ɖω uEt5_,1Et _,1Et _,1)Et _,1)׋EEԉE]hA"SiYZÉ]; t,hc,Zƀc,uhc,hu !  9uE| ;uĉE}.uuuuWVh !S ű}u}e[^_]USE PuCh ! ,H, yh,Y,P,؃ t7@t( ,y h,Z㡀,P,hj !j(1Y]UWVSEM a+u h !ja+u֋EEUu؉E䙉E܉UE#EƋE#EjPVQBu @ua+a+uhuP0 lR5>,P^ 9a+uTjWV5a+Bu@t>,C#EйNju5a+R5a+ 9a+ue[^_]UWVSRá:,u ƀA Mz΍:, S}8PRT :, e[^_]UWVSEu} u1Ӏ _,1ۉ)ډEUE;:,E:,!!u}u}E9:,:,E!!=_,t Es:,Kf9]t 5:,tʅu+_,9UE}1;ME}t%}t}u Ɔ낸 !%!![^_]UWVS EӋEEh:,@Ph:,+E =:,t hI!!jAEG9E|E9}|础:,] +} WRP膣:,ڹ1󫡀:,<fLJU }u> _,5:,΋E)M艊CKSCsV{KSC CHSe:,Ee[^_]UWVSEUE E M] M]9 `, `, `,19EtTtK}E9ϋU}29}} }!!!=_,}@uE2`,]Ã}!ډ˃|:, :,t#=_,2}X:,| }Bhj :,[^u ha!jfǀUE죘:,EU :,:,EU:,:,:,t_}t E:,Hu:,=_,h"!YT!!z6`,=:,d;:,X:,EU EUEUKx[ 5:,t;EU |9EE}=_,}t뢃}:,E 9:,u ;]:,H:,1+]9~ Fu%ud PPRʟ :, H_,1RPEU :,+E:,XZ!!9!!2l!!+!!$EU :,:,EU:,:,1҉Ѝe[^_]UWVSË@S t15`,= `,9u9th^"!-2Ysǹ󥉍1󫍍u0S ! StT"!Qh"!ǛXZߋe[^_]Ã=_,u x t1UWVS|Éס`,tP Yj/S^ZuS5a+hy$h`,b S`,Y`,u ha!jojPxXZy5`,h\#^XxPSZY@tϋuи 9E} 5`,h"!5`,h"!0Y^Xh h>,S貾 9t5`,h\#~f=@,Ut 5`,h"!S蛿ZS脿XtjYe[^_]UWVSÃ=>,u1Ҹ};#>,f=a,u1f=@,I؁=>,t#>, `,>,󤡜@,fa,fb,Uta,1b,u[^_]UWVS áa,fE_,_,`, `,11t#f}u&a,t9r $uɡ:,E :,19E~+f:uzti 9t@Ћ _,t_,uf}u=a,! 9'=_,t u)h"!.Y >,uh"!h %XZ=>,t_f=@,uq@,!9`,=_,tPh#!1.Y_PhR#!_Zt >, =>,uL};#t$1d>,trq@,!9tSP5`,h#!-=_,t1f=a,u3 q@,5`,h#!ZYua, $te[^_]UWVS(ÉEU EUE؉u=_,E8$!e[^_]^11ɉt<u ȉh'jhh !P^o&tPQRhA$! fu1k t Ph3"hP$!WVh3"he$! =a+RPSQyPh$!4Y[=_,u" _,9u1ۉ)11ɉ:j-j)XZttAM]EĉUȋEUM];EĉE|F1EUȋN1G묡:,:,)9E}|h'!`M]y;u 1ɉ uT1a,a,FuE;`,E `,|/=_,u&h1'!T^E@(u}=_,}uEEjhjjjщ¸?'!_E _,u,EEEEEE}t#:,:,EU:,:,`, `,EU11ҹuuRPQUMi$EĉU+EU;E}EE}]u)։]u}tc:,E:,E}9}}9}t&>t!9Eċ}}e;E}}EUE븹 `,19]t0t'19Eċ}ȃ;E}}EUCu(N1ڋN19Eċ}}EċUȉEUEU+EUȉƉ׉ u hE'!E9ƉE|E Euu}_,_,1RPuuu 9u ۃ}u ;]uWVjjPUM#2#&EUEPuhd'!hm'!h,jdhc,? u hj !j hc,[vSHƀc,t'c, t;E|EHPhc,h'!c uhc,EP蔵 EUEĉUȃ}tjuuuuċUEjuuuuċUEn_,t'uu=_,}t Ph\#jYPPY$uN}tjuuuuċUEjuuuuċUEt Ph\#j}uk}E EU U u }̋EEfukE } 1E}t }te}tE} _,1 :,:,;]u1;MtuuEċU_Z :,UׁǾ}`EU}̊EG]ĉ+EG}Ẻx HPP2E̍HPD;}̍_S[^E}t fǀ fu uEPkE }Pd 2=_,t h'!YuEft=_,=_,h'!Z`E̊@EċE̊XE%}WЙ=`,w1WVjjjщ¸(!1ҋ5_,N1SQjjjщ¸)(!ƃ(Eă?1ҋ _,1SQjjjщ¸8(!eM̉YY? AAEĊYE%QЙ=`,w1WVjjjщ¸I(!ǃ(1ҋ5_,N1SQjjjщ¸Y(!ƋEă?1ҋ _,1SQjjjщ¸e(!M̉YY? A(}u E=_,:,tKx :,u19EċuUw}E9:,~: :,EE̋EEUE$E1$E$E1$EEEEEE$E1$EEEE}a,t2a,1҉EĉU;uĉ|a,1EU9Ɖ}112a,1ҋI19M}39EE$M]11Ee[^_]UVSá_,u hs(!KX1ۃ=_,u Sh eY^jjڸ `,CXZu҃=_,u=:,th(!AKX1P=:,h(!u Sh(!Y^ :,RP1҉jXZ=_,tC_,9:,=_,A=_,~h(!^5:,j5:,5:,RPwf=a,th)!lJ^h(!J[a,t=hnU"6a,Y=uh(!"k Ph(!XZ hB;!Xh %JX=_,nPh)!Y[=_,a,PPh6)! j=_,t>u ShX)!XZ9:,} hq)!IX;/ :,RP1҉u Sh{)!UY^jjڸ `,XZe[^]UWVS ˋDž ! t DžT"!@uh)!1XZߍDžjh)!S1 t 1/9Cu苅9Cus Pj% ;Cuă=_,t.{ t(s$s sh)!-e[^_]UVSPEa+;a+u*=_,u!URhmdP y h"?^ `,119@uh)!B=>,u111H>,~ ف>,@uh *![E:,01C;:,}. :,:,:,@uSh*!ZYEa+;a+u*=_,u!URhmdP y h"ZXe[^]ËUmPh@!h0,jNUWVS|E|xhd,wSh$A!h0,njSb EZuhE!與|\us11t\Uh~&SUB 9}Sh\R$HXZ]e[^_] UWVSu} EU MahG8lG,p1pd1ld1pPQhJE!j@tPC1w,pC1w8p1w,PQhJE!j@UR0URtPhhSE!sQhhaE!VC tCpStC`Sd CHC@h蕹 _u jjX@1󫋃@ƒ<ftf<%GXf<%GdytDtSP1G4Y^tT$1RPiƒXZDžDžtpxpx t WV;Y^Ɖ׉ t19sB‹@@dT Xj諷 Ɖ_P芷 _Po FYBHqQjPjjRt Ph !>XZ@ fGt~O@@~J@Ht G G$GC8S 5F t)C8S< p)C$F FFFF F <@4PG^jjXjjS(Nj@tK KS1P1ZYƒ<f%Tf-fGHdAf@jtK K11Ҋ t1ҋAQ jhWfBjtffFBdp pXZ1ɉƍ19vG@dtA uى=v4ts sG@d1ƋD tC CRjPjjW@ DžN!Dž1p?_<҃| ;vhZ!5 f,h!E Ft)P$t8tGpBu Ej,a+Xe[^_]ÍL$qUQ j,j,5j,5a+D!EM MuQQ$RPh!覚MɍaUS]CtS P S tSPSCr s \ ZSU j,X]USEPsH) j,j, xj,H1҅u0j,Z[9t j,uj,u h8 !jkqX4CXtYZ@]UWVSu EEE#a+j,j, j,M11ɅtJA9~ʳ9M}#tj,hL !hhT!hh[ !A}9x4u }9x(u9p$t버tj,e[^_]UWVS]uuu SO trNj@th} !h`T!h1GGWX9w&~6Gth !h`T!hh[ !袹wVw mG [^WYxj,a+;j,V=j,tGWuj,P=j,t+GWuj,WGtG4WPZWXj,j@jlVjlG _4E UG$W(G,W0wE #a+G8j,tz8GC GtWP { _ Ge[^_]USEM Puh !hXT!h4h[ !iP ʉPHPPP s E]XPs4H j,j,xj,@ j,Hj,0@t j,Hj, j,Hj,P4JH8j,9t!tXYX tAP]UWVS Mu }uWVQa‹EZMt j,1ZUj,EEEPWVQQ EMUJ,B0xB BB4RPX r J1؍e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=a+Y,A0Éa,ڋyY I4 s RPWSQU! RPWSQU!e[^_]US]C%CSjSN1]UE UMQ1]Uj iUU Pj,PYtHJ j,@ j,UWVS] j,C0tS4P4S4C(tS,P,S,s$tBFtV P V V VY^׋FtV P V VVXZs uًCpd C ${s ]e[^_] UWVS]E EEEEj,Etp9XH0udxu9w,uDu9w(uPFPZY9뗁~atuuh !tF 9t/ Fp9t(1SQ1RPuuh !F(V,F V$;EUruPuuh !uuh ! }t2tF(V,F V$9Uu9EtPuh! ! EUjuuuuVSǃujuY[}t%tF(F PuuhB !1hY !hT!hh ! LEEE1ҊM t1EUEUĉEԉU؊$EtẺU\EEЋEU+EUЉEUIu r1ҊM t1҉EUEU+EUuuRP.uuuu-9uOE1ҊM t1҉EUEUă+EUEUuuRP-9t"}tFVEԉUF EE }tFFuԋ}؉u} u}uEuEԋU؉EUEjuXZE9EEEEE Et EUEUEUeY[^_]UWVS ] }t$bƉ׋EVWVRPh` !EbuE‰9u+ztE։9u 9u Tv9sE]Ã}thq !zh,FZYtCpStCHuRPuuEU}t h ![XEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPh !z,6EtM}`d)RPh !r tCpStCH9Uu9Et]1ۉ؍e[^_]UWVS u }^j8jME@EMA A A A A$Y[}thjrMËE쉃PXZ u =a+ƉEE} t h !Xa+EPjh WVuhjLËEp E쉃PEP P jP^_ts s@5a+} tURjh  t1WVu$hjKLEEp }E}쉸PEP P jP}ZYutCHSLC419|} tMhJ !jX@E?t} t#h !KXu uuS9u u X S X]tS X1zSt ǃ ǃL7tX\+1tǃ`dǃt}uWjrJƉ_tCtPLJ^tCtP&JFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjS;th+SXZ؍e[^_]UE Puja+ UWVS]FHlj1RPuu &EU슋tC|1EUEUtURjW1EURPVtPu h !F u|1t$QPuu %F P@EUE~ vQRuu $kQRuu $k NjGEEjV{XZ1;EE$Et\u})׉u}E‰@Ju 1 t1WVuu\%€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et EEu } tu}}t EEETƉ׋E t1 9;uE|LEE Ɖ׋Es|| t19EMWVUE&ZY‹E9sE}u1PWVE| 6E|E||RPʋEuEH_X}t EP4PR^ ;EE:#] ]Et E!ËEU| t19r^EGމ}t(SuuuE}@,@0E@dpx E3uuUEZY9|C}t.EPjRuuu|E}Dž|E}u1PuuًE| }u뼍EPEPEPuuuuB|[EA}u}t1U9~|u@EiE@dpx }u}t<}uuUE~ZYPuuueE}s}~,EME uEMEM}~EMEtxuDžpp9EPEPvvuÉE~uP H1E@,@0I@u?ENjtx t1C,S0C CC4SP_N]{ E u$EtDNEtxC4SP[@p]M}tE@,@0Etu2EMEEMEXEURjPt5t5utt5t5h ! LEP }tDP4PRF}xUB%|aE|;EZ,J0tB BB4RPX||e[^_]UWVS u_EUEU t1҉E܉UURPuuW EU1EURPKt1ҋM܋])ӉtF|1)ӉM]]eEU]8vfBH4MQjPjjRt Ph !$Y[MA tP@F(V,@F jQXZtF(V,EԉU؋EUF(V,F 1҉EԉU؋EF vkBHMQjPjjRPt Ph !~[_EP tM]JZ}zP4PR:Ylj1M]M܉]‰1 t1҉щ‰UtVR Ћ]9]]]}-@@EUM]HX Mԋ]؉L:\:sR v:]9]]]} @EU]XkEԉD:8]9]]]} @EU]X k EԉD:BHMQjPjjRt Ph !XZEP M܋]tJ Z$JP4PR:EP4PR1e[^_]UWVS}cvfBH_MQjPjjR!t Ph !O^XEP tJZO(_,RW jPY[$EtG(W,G 1҉EU苷FHE܉%1RPuuӀ}tG|1Ӏ}tURju1RPVJtPuh !u 1Ep tSQuuHƋF FtZ< vSQuukSQuuk ƃ~t*uuh! tFVG(W,FG vkBHMQjPjjR\t Ph !XZEP tN^JZNJP4PR:Xju ^XtG(W,G 1҉ W[Et UG(W,G 1BHMQjPjjRt Ph !ZYEP ]t uZrZP4PR:X17z,t G0W4G(jjP0uu Wde[^_]Ë@t@Ë@ t@Ë@UStPpXtPH[]tË@dtË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP  e[^]UWtBRBR t RPY_}ÊtBRtUWRP{Y_}ËBht1UWVSӋEU ΃tt RP:Y^CSljtȉlj{he[^_]UVSuE H$X(1y9)tNp1SQRP e[^]UVSuE H$X(1y9)tNp1SQRP e[^]UWVSE8X@ɃLȋu+F4utE4 1ۃ}( ;]}>E@ uuSh`!;b ]BD1H)EC뽉tpE@ EDžta+ttHt_kh1ҍ 9E~ىlE0u4xux[$9^$wBʋx0u4h)ly1ҋE9UE@lDžxDž|Džtht9l~Mux|N$^(uv4ht Ɖ\ @ptx|BS]D@Ht!@uNtAA EHllSE@ $Et_pwtwHi t1ۉZ,r0Bx}t !! 8l+h@U!h`!jq7ÃpkTtDpt RPlY[Bf]p]ptSQp[XEЃ_tuuYYEUEUDpTtM]19N ;EErEPdEx4X]G\)Ɖxx%x\9wxxXE@4t"p]uuF4GpWtEU UUuF4GHEEEXCEEPEPEPuuSWtuuPh,U!h`!j5UM9}#ƉЉʉ t1҉EUhxhtEtuEp h{ !hU!hL(șșE@d]S1Ҋh t1҉Ëp*Mpt)ىRPuEtȉD(UEvhE !h U!h hV !}ƃtt%RP<Y^DXpt pșBu3u.ډnutSQ[^]EvhE !hT!h"SЃt0tuuYYEUEUEtȉDXHpURjPpT5ht5t5Shtr2h,U!ha!j2T5E@ t ЋRBu:u5E@utRPUY[pLEP t]uʉtu4P4PRZ!)ӉM] ‰Ju 1 t1VSuu; pE ;EErE@duVtFHÉE1URjS1SQVOt0Pp`Dždd`hZ![‹MnJY u N#u E1kӋ+tA r:s uC <uA4QPX#E@ le[^_]UWVS$}FHnEtO`_dO@<)ӉM]% Iu gÉ1 t1RPuuK 1JURju1RPVƃtO`_dO@)ӉM]xsIu V1 t1RPuu 1RPhZ!guHV UtO`_d G@EU‰eE؉rEЉ)E+M]M]ЊM1ҊM t1RPuu]K!]~tO`_d G@`EUQ‰EԉE+M]M]1ҊM t1RPuuy1uk]CC EC <EtO`_dO@)ӉM؉]܉‰Ju &1 t1RPuuU]F4VPBHIMQjPjjR%t Ph !S[^EEp H]VB}Vt4G8WuЃuűuF <u v0E@4uPuEE pEHEXZEE}t=1ɋ9H~@ UE|P¯AAMX뽉Ez,z,Iu"ha!hT!hXhV !jt5G0W4G(W,G 3G(W,PTPTG W$pGE @0E @BBEPuK G>PGP1^ZuS 5‰E1 t1҉Ɖ׉1 t1Yt)C8S<)C$}u ha!j E p}9}tpE MAP9y4uz,z, y(x{, {, {,{,A%AQwE@{,{,EY눋Ez,SZ} 1e[^_]UWVS4E@(E؃} G,uEE xEE xE} 9G(rG,}t/wu u^_EtEPt@pE؉UvыE@HEE܋EtƋE%1 t1EEDE }P} _swQu؋}܉ t1WVR藭‰E PBB1ɋE:9vHEEЉÃB tǀǀ@A묋E @ EƋE<1 t1E$EЋEt)p@xD)p,EI] )C(}Ƀ)K,{ E€}\EfƋE @$1)ߋE؀}t U܉WEEz,z,EUE@(EЃ} G,u0E@(EċE@,EEEЉEă EudE@ tčEPPPugE @t9}t@ ljE]KdQ1E X]C ÈEЃeЀEE @$EȋEFƋE1UЋEЋ}t@ ljER}OdQEăM uEE1UŰE P}tZCr{<uxj,Cj,j,C@CC sha!hlU!hCha!djS8Y[E P EE؉ÀtfBfB@tfBfBE @$E؍PE P$E+1u E @EP,@(E؉U܋E؃ E܋Eu\tPL@HEЉU @4EEԋEPUr,z0 t1EtpHxLp4z,[AM̃HEVEЋE1RPuuƉ׋E1׋EۋMtURju1RPQtPuh ! EEЃE̋]E1ɀ}t&QPuuS ‹rzuЉ}FEvs vQRuukQRuuk BEEԋEMq,y0 t1}trzrC4SPZ1ۋE EE]Ћu)։]ЉuԋE‹EJu ELEW1 t1WVuuljEЋECHEEƉ1ƋEURjQ1RPSAtP1RWhZ!kEƋME|Nq u P#U E1kEẼ<ۃ、)؉u؃1ۋ} uq r]:z ur E<}}Љ4A4QPX؍e[^_]UWVS(]EE @EEZED1EԋE<E9C,rE;C(~tSCxSuSE z$KqN(v,Jtr K tQQBtfQfQ<)C,E @} GCPS8EEEE}9}CEHM}tu}M} U؋MW$O(ỦMЀ}uT>9Ewha!h\U!hhV !_ù}t }Љ4‰|4EUX<E)C,E)C(1e[^_]UWVSS] EC1Ex$tPGEGuhb!hPU!hha!^GuWuUZYtWSZYuF}S&Ce[^_]UWVS u} EX9G(r <҃<D 9G,s WVXZE<)G,G E}t@E@@}t UfBMfAE@t*E}t@@}t UfBMfAGE}uEC(S,]}CtS E@H6E؋EH1ۀ}tX ]1RPSQkӉl1Ӏ}tURju1RPu輥tE@QPh ! EEE1ۀ}t EP @SQRP]C QRE@E؉U܋E@ EvSQuuekSQuuPk EԋUBjuhu<uWV>h<uWV/(h=uWVh=uWVW  t%<<ۃӉ_މw4.<҃W,}tWWJEtfPfPe[^_]UWVS] t@ U f P8jǃ jDƉ<WFZYuWhb!1=@j,P.E fF8FF<S^X1e[^_]UWVS5z,1ۅtb~ uTF%}uu@u<~G!u~$t*O( O,tVu u( Wu u C v(뚉؍e[^_]UWVSuE UEU z,z,IutFPt `dV诗Z1;]E|h9b!hT!hha!,ZPh EU t1RPP¹x @ Ue[^_]0UWVSu {;{tp‰1 t1t)FpVt)FH?W2G"GG$Gw4WXGGjW褠 hCb!E8Ys8C S2C dždž4XZtRPV" tRPV dž u h_b!j9H e[^_]UWVSP]E PSjVS'jVSV tBBtfBfB:AEy$utCHSLC419| QVS: uVSVShNJ:uS1e[^_]t@P@0UWVS}w0GEE P]芎]ttMRPY[M]C S$ tȋ]CE @}ttȋUBDtȋUB~VE@H}tFFEO(_,}tFh1RPSQӀ}tF|1Ӏ}tURju1RPutPw(h ! EE@ EG(W,]t1SQRP.~NhvSQRPkSQRPk EU ] K}tPH P U R}tPPE@4uP:XEuOGE / EP]芎]ttMRPY[M]C(S, tȋUBE@UttȋUB@ tȋUBG@WDE tiEPރ]ttMRP蔺Y[MA0Q4 tȉA E@}t tȉAH tȉA$EtEuG0OG suG0Oge[^_]UWVSu]tV XuVhpb!j `DžPhd@u 1: usRhedAu ƃ u0*8tuhb!_X$B<CB(CB,C B0CB4CJ8KCB@C BBC$BDC({h̎$ϰƹ ߋShb!V=CPhb!V? C Phb!V?CPhb!V?CPhb!V?$tP聆^}=uhzd@u q @RhedAu S @uuhb!j' 41}󫍅PuǞZY@4ȋ9"9t8Ћ}LJLJ(Eǀǀ [Eƀ*Pj PEP1e[^_]UWVS,}jhPjWHtGjPjVWVu$U ʋMQ؍e[^_]UE ǀoǀo1]Ê u@ t utUWVSSÉ։WhV9^ tX1҉jh"PE Muʊt< tA1҉ES&$SURs ue[^_]UWVSSÉ׉WhS] t?1҉7< u<#tS&Y9t3PH u ttEVh\#&]XZE1e[^_]UWVS0Ef!UMúhh!P1XZuRhf!VhW\ uRh!g!z\V9PPPPPPhag!W6 u Džthsg!\VD[^tNg!URt VYP$ZvjWhg!ƅM oP/ YuVZ #E o1ҋЉt B߸)Љ1Ɂ11€tjhhg!ZVGGG GGPh1"Ve% Hu GGV+XE ;ot$PWh/h!6Z ؍e[^_]UWVS 1} hh!u.ZYuuhwh!Y_X]ڸv!^t uhh!h!WVPh$S3tWVh$S3t hi!} G1} Ƅa2=u.]˽&Yu\E ao1ɋ?u61ҍjh"P~ tj2WS2 9u\E ]hhTi!PdE ƀaPw!;tWuhYi!EX 1ɋu׍PShi!V2uS Z;v1Phhi!WE aPWhi!W?AE ƀa} a9tRPShi!WE ƀa[v!KXu E Juh5j!6VhV uVShj!&W ph!j2PWC2 E 9~1ɋVtShbj!Zv!_E ZtC@fVhPn uVSh4k!V j2PWbC2 E 9X~$1ɋtShj!2RZڸv!^t uhk!1ɋgthk!xE ]PPPPhl!S=0M \\\\\]t hl!{U[jE ]`c!tH8tp u Pà nYy?-Rh1l!UXZÉ؍e[^_]UWVS]CjP5- ^_1uh@c!hLl!ȾY[ F9~?{jW, YZu Vh@c!hil!:19~DBhh!u I)XZuu h@c!hl!R zl!WW_t uƄshl!hPJ$shl!hP1$ %Rx$RWh …uƋ{{9VhQS u WRhm!CPPPPh$Q-BtWRhMm!S ; ȋC AEV [6V X19s~4W/ FYH/ ZDže[^_]USRÍEPjhjjj jS8U tShln!RjJ]USsPh|n!h0,&Shn!h0,&Shn!h0,&$Sho!h0,|&Sh/o!h0,l&ShRo!h0,\&$Shuo!h0,I&Sho!h0,9&Sho!h0,)&$Sho!h0,&Sho!h0,&Shp!h0,%$Sh+p!h0,%ShZp!h0,%Shqp!h0,%$Shp!h0,%Shp!h0,%Shp!h0,%$Shp!h0,}%Shp!h0,m%Shq!h0,]%$Sh.q!h0,J%ShJq!h0,:%jUSRhPz u Sh\#j]Uuu u  @uuhaq!jUWVS(`؟ԟhsq!Rh*rPEܟП119П~7̟hW؟  ̟u ԟ0F`ܟv1ܟܟ9}J̟hW؟/  ̟u ПԟEܟF`벅u؟hq!jue[^_]UWVSlj։EEjh?$Ql t(jhq!SX tjh!SD u Ejhq!S' uEjh1"S  t}~Ehq!EPhrWhq!EPhrW ={,t=q!}uq!PVhq! }uE4f!Vhr! e[^_]UWVSÉ֍hPdzb1l󫋅dhx|hr!lPhrSVh3r!<|xhLr!0tplhr!q!tq!RPhr!hr!DRPhr!0Ph2s!~XZq!4uq!PhEs!^84f!hXs!D3$P iPYvPh&!P 5=p{,t h0,h.!ȮXZp{,Yh0,h@!訮_Xp{,=P]^ v PhQ!P@ j[PYvPhZ!P u3PZvPh_!P uE=t{,t h0,he!ح^_t{,ih0,hy!踭Y[t{,MPh!h0, /hh!!Pm e[^_]U=`{,iu=t,t jh@,{h!\ZujbUShЅ!h,,XZthՅ!h,YXth݅!h,XZth!h,YXth!h,XZ,]UWVSu }1ۃ= b+ÍF T{,s==p{,tt!}t!h,P[XZuWVh!h,؍e[^_]UWVSl]u }1= b+EF T{,r=t{,Sh!h,eK u=`{,iu =p{,=b+u(WVh!jd]S}u WVSg VWV- YXt%RU!PSM MUufJ"uWVS"Ã}uP^XfKEe[^_]US1ۃ= b+ËE H T{,s(u ZtfPfPxtP#X؋]UWVS=p{,th,h!!赪XZjjP_Xt^=p{,th,h>!芪Y^ދ[F@H P{, s T{,sV_V)#XZu1;5H{,L{,WVYXt{F P{,ra=t{,tSD PhP!h,f{uS^S"XZ"S\s s,C$, [uWe[^_]UWVSuE HT{,]V_Et8Mp p_Zuh\!YYE9Eeuu XZtMGt 9t@ߋEuI9tE}uS]S![X)=t{,tS Pht!h,,S[Ye1Et"Et G;EuEt C;EtM}E$}!fO=t{,WVøu}uS]S!XZS [_uuu VMǃ}PW[[}ufGufGGu!W"VPUVWv!fOuWPVh!h0,EPuu VfH=t{,PVNjE&W\}ubS1\S! EPuu VqÃ}uPZYfK=t{,SUøSVPhˆ!}ufKfK=t{,jSvUøSfGth݆!WXXZ8uFWz[WjZYtth!WW[Xuuu VPY8 uW8YXw w>,G$=,uuu V`ǃfO=t{,WTNjEWVPh!h,j{t{,twVPh!h,A1Uuu Vh6!h0,$5EaVPhY!h0,ECVPhv!U e[^_]UWVS=p{,th,h!:^_1;5H{,L{,sxWVY[uۀxtVT{, s؋X tf{u0=t{,tS"Ph!h,DSYSXZ[5,t[^ tO{uDf{t hɇ!SUY_=t{,tSPh!h,S?YS/XZ[뭋v$롍e[^_]UWVS=p{,th,h!^_,1,t#{ t{$C$SCXSFY[مuȋ,th!SGU[$XZe[^_]UWVSPp{,=`{,Rut6h,h!蘣#th,h>!胣^_5\{,uY[jjQƉס\{,EXZH{,9,,L{,WVNQƉXZ,,9ƉsIWVYXuWVhS!]S SMPhc!h0,ofcWVPƉ׃9u9tRPWVhz!h0,?CRWVOXZu h!RYCu h!SSXZCt S`WfcXSPCfcY[\{,;EPusCe[^_]UWVS=p{,th,hɈ!Y[f,j,.C jjPEUH{,L{,RP3PEU5,5,OƉXZuuOEUuuOEUE9EEEZE;,E,sff,j+Bq [E;,E,rj9\{,u1B95,,rBB1 \{,S9u\{,9(,,9։sQWV|XYuUh\!QXURUPhc!h0,)UfbWVNƉ׃9uM11 WVXYuUh\!PYURUPAUfbXZ9\{,t ]A_WVde[^_]UWVSjjY[t<Ã=p{,th,h!XZCtS(PrMfc_X[u=p{,th,h!詟[^1;5H{,L{,WV+ZYuыXtCtNPP xu SjSzjPPOfc[룍e[^_]UWVS=p{,th,h!XZ1;5H{,L{,sJWVkYXt3fCƒfS{ufCf{t h!S PXZ[Ƀ릍e[^_]UVS]S^uSh+!h0, 1Ouu Y[19Åt 9t@uu hY!wN ~u}t hE!V{OXZ؍e[^]UWVƉjhRP,t9xu9pte^_]UPhn!ZY8u"h!h!5({,h!h0, j,t#UPju u躻Ht @b+UVS@fCĆ,=~E,)f,5,jhh,THt @f+-Ć,5Ć,CPS,P觑5,CĆ, e[^]USjjj0)+CC]UWVSƉӉ9tR)ySh!h0, j%RP6^thF P6]F e[^_]UWVS=x{,uu 9uEfftfB1ƒ=,tf‰jEPW觹WwYf= E19]  }ߋ,tȉGffG=,t?tuGGG%)Wu9rG9=p{,th,h'!XZGt=p{,th,h;!ӚYXGW9s=p{,t+PRhU!h,'=p{,th,j 2&XZӃ?!e[^_]UVSjh@f+述Y[1ۃt%h  Zu V}X 0@؍e[^]UWVSX=p{,th,h}!Y[5<{,58{,5({,h!hh@f+1`{,߃h@b+,uh@b+h!shB!PhB!h@b+,^_=,u h@b+8h7%PDžDž Y[,!f,,%=@,jjz XZu h?!aH_5,=,jhWV*,,s{C ,5,=, ,, , ,=,5,=,,,,,,,PjjLP9Ht@b+Vh=hשh13f,)f,5,j5Ć,h,Ht @f+5,,Ć,+C C^5,[u,uH0z Ph^!h0,,tPDY#h b+SEZu ho!>FXe[^_]á, ,uU塤,%=@u6, ,u]UWVSu^ ~u:hS6贫F #=t{,h0,h!`[^F;F| FSft)9~=t{,tnRh!h0, YF;uCh7%P֠ZYt:;=H{,L{,r'=t{,4Whˋ!h0,E 1ۉ؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃjShI$hVV^NjP ѡ,5,_ƃt$@h %P˟ZYu5,7YSh!h0,L t$Fh!P萟YZu5,ZSh!h0, ,Ƅ=FVvhPSh>!h0,:hPS胠1RPSmH ,p5,Mơ,8Xae[^_]UWVSuS%_X8/u @1Ҿ1h7%PXZۋtm;thgu1WP ѡ,S^5,Yt@9uVSBP uȋ2lЍe[^_]UVSuIAY1ۉ tÅtnƋS 4؍e[^]US]3X]]K UWVST=p{,th,h[!}[^`{,hhuUƃ yBuh!h0,Qh0,藳0 Phԛ!h0,+ 1S ѡ,,0Nj[Yځ~RQW~ @u55,5,5,h!h0,10c Ph!J=d{,uURQV @uG5,5,5,h!h0,V0 PhC!h0,:$j%WVXZe[^_]UEU ]U=@b+#tjjh@b+|h@b+=@f+#tjjh@f+Xh@f+UWVSƉ׉ˉ t;5H{,L{,rWVh#!G< ,RPWVĠ,s{ S$=t{,t [$t9{ u9suh=!S=XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUhL!P<XZUWVu} 1 tC;5H{,L{,s.,RPWVaĠ,t;x u;pt@$e^_]UWVu} t;5H{,L{,rWVhm!*; ,RPWVĠ,t&H$9x u9pu@@ P$WVh!: e^_]UWVSujj[_Åt>NJ/t tF@PW3ZYt [u1 Ft[ 밉؍e[^_]UVSSj/Ph^Zu1,SeY/txtESh!:XZEe[^]UVSu,F,9v%)P6Se~jj$9tC/vKSh!9XZ؍e[^]UWVS}u hҎ!9[uYƉ<,uE50{, Zu h܎!d9X)0{, ,9w ,,,uS6؍e[^_]UWVSu=,uF50{,' Xu h!8X0{,Lء,19w C$؃(t,,C$, 1ECCDžuPE  EujjY_t Vh!l8XZVV_C[ٸ1Xj/V]^Z@PPC{G C_ Y^Et5uu RZYƅu h2!7_E UCS FC^1E E t)uu ZYt hM!7XًE U6؍e[^_]US]SZ,,]UWVS]f{t h^!S~8Y^{u&{t hq!Se8XZ{ t h!SR8^_s{ t]WVkZYuh!S,8Y^49uWVKXZt-x"t‹@9uCB h!S7XZ3,C$,e[^_]UWVS]} >ƅu hʏ!S7XZ9stsF C^ j/WZYx3WƉWC$q8VP赑fCu fCe[^_]UWVSd=p{,th,hۏ!藅_Xd{,E2hB!ufY^u,0 PhŒ!h0,uh!5fc EEE9H{,L{,ErFuu^Zƅt)GE~SFPj6Av}ӃEU1EEE9H{,L{,EuuGZYDžttj$GPEPhyuGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP膢눃EUUĠ,Mt@ESjjEPNE ,;M̋E E̡H{,L{,EUMԉuС@{,D{,E؉Uܡ8{,<{,EUX{,ESjj(EPC @t,0 Ph#!h0,uh/!3SXe[^_]UWVS}=p{,th,h]!$XZuXjj5L{,5H{,x,jPZ Ġ,[^u hw!>3Yjjjh %fHjjW*ƃ y*0 PhÌ!h0,Wh!2xPV:[Zy*0 Ph!h0,Wh!2EЍXjS LZYu h!2YSLVH y,'0Y Ph!h0,|Wh!F2j(PPV xV`{,Z,Y,1d1.1USá,u1u11 Ѓu=It'5,5,5,Ph!h0,1҉Ћ]U5,h!h0,jb+=\{,U=,th0,hё!jFfEHE=,t Pja;XZ:EPhm5Xj+R y0# Ph!h0,FUVSu ,;,v h !.X,Vu,P`s, e[^]UU|,E |,=~#PRh,5,h&!h0,jbU E,UVS,,,9s^t 5, ZVs ã,Xt5,4,5,5,5,hQ!Vhh!h0,-؍e[^]US] =h{,tSuh ,,P =d{,uOj1RS5,Bu8@u5i0 P5,5,5,h!h0,jO]U=,t"f=,u5,hВ!h! , !f,,H{,L{,,,=,t,jh,JUVS]u =h{,tVSh ,,P =d{,uHVS5,K @u5k0 P5,5,5,h!h0,jQe[^]US}!tuP ZYt1ۉ؋]US]X{,9Hj+}A,tPx Y PE ,Zuh0,hN!{jHj+]UVS]X{,P,=|{,tPj |^,{,,j:SƘZYt$,pSI4[j]h!"SZYhh!hu!,{,Y^ud0E Phu!h~!h0,chh!h$,{,u(0 Ph$h~!h0,'j,Sh,XZe[^]US ,$,EU]SPh!h,(, ,,UM Ѹ!tSZPh!h, ~,=~,u!h~,PhX~,5T~,hʓ!h0,jhD~,hC#h0,V$= {, ,$,EUSAPh!5 {,(, ,,UM! tS YPh!5 {, ~,=~,u!h~,PhX~,5T~,hɓ!5 {,hD~,h!5 {,$5 {,h!yXZ {,@ @t h!jH]UWVS} u=p{,tWh!h,@ EE];9ru4=t{,3";]t-!Ph!h, {CPCPhi!hR=p{,t R3C4Lj+h!h,t}t?SHK))PDPPCPWX!uSHK))PDPPCPu8!<SHK))PDPPCPW茺G!š@:{Nh۔!PZYt h!PZYtJt%uCDPjWP !?CDPuZYi!CDPjW t!@{atNt)CDPjW !?CDPuRZYi!CDPjW t!@t=t{,t/Rh˔!h,j =p{,th,h!uYX=p{,th,j RXZe[^_]áXj+x=,t0UPΌXUWVS }uԥ,,=,t1}t h!%Y=\{,%1Dž1fܥ,,tj/`{,ltɋ~2KSCX?h0,h$!p_X*e[^_]UWVSRơ,, ,9| =X{,1P,h P9~ DBu=, 1ۡ,؃=,t WP*YXWP5Xj+袅ƒ =,u;X{,9,}.~*=t{,tUh,h!:oXZUX{,, ,ut ~^X{, 9t)ׅN]>t#=p{,tPRUhۗ!h,GU ,]Ӆh0,h!n,ZYftCftfHth0,h! h0,h.!`n[_85,hG!h0, 5,5,hU!h0,=l{,uhDž!Yuj4X{, 1=,=,t1jS*_Zy>0 Phn!h0,BjjؙRS5Xj+2Bu@t…]=p{,th,h!xmZY=,u&\{,@\{,,PXNtX{, PShۗ! hh,,Sa ,h5,Vaܥ,إ, e[^_]UWVSÃ=x{,FC=TtP=ltIʁlt=Tt1$=,u$=p{,th,h!jl^_,pt=,3ȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRPKL_ZChs,s(;LY^C(S,C0ȉC0C4ȉC4C8ȉC8C<ȉC=t{,t5ܥ,5,h!h,߻5,h̚!XZ={,t {,V,!,t19@|,~ҍCe[^_]Uf,h=h=h= á{,ttU{,tt]UWVSx],f,,,EU ,M5,=,u}5,u=,}=,} }tEUMEEEE,Eċ=,UEu,E,E,E,EE%=`w= =@tp===t+=uSh!h0,=p{,tSh!h, jX=b+t SYt@tSh! XZ̓=p{,tSh,!h,蜹 5,5,Sƃ ,|,|hhh =|,u%=p{,Sh=!h," ={,tSXjSh, ƃ pE Et EPS+YXEPS+uuSuuSu~jW|Sj9= {,tuuuuh&SuSyuXZ=p{,tShf!h,P 5d{,W={,tS9XE%`|,RP| PS@y菬0 PSh!uuS%vuS!h0, h0,h;!tB`j+XZ CtsPh>!h0,՞h0,hc!h!Th,n_Y[1ۍ>1ʍuEfEEE'E0VhQ`5`,} @u h(!jjE<u 5@,h5!<u5@,hP!h0,肕 ~<tP5@,hc!h0,c_Pu󥀽_y-`9@!CSh!Qh,k^ j !RZ<h!!Xe[^_]UWVSEu h˔ Zu h!jfiù1󪍕 1;}T jQh !| u jQhݫ!| uGu;}O*E U:uy 3h!Tsh"V@ZYthv$V@ZYu E-j EPV)E U:uysh$!jeEPhU5`,x t h4!jee[^]UVS ] }tZ3h"V@ZYthv$V?ZYu E'j EPVK)E U:uy 3h!Tsh"V?ZYthv$V?ZYu E-j EPV(E U:uysh$!jdEPhU5`,w t hB!jde[^]UP}nE 0EEPhQ5`,wt hN!jldU}t*jhQ 5`,[w t hY!j7dU}tjhU 5`,&w t hd!jdUWVS$EEԋ] h E^u hq!jcU1E1;}}3Vh!+>ZYuE]Vh!>ZYuEFVhv$=ZYuE/jEPV说 U:u=v3h!jcEG|EEjh0uhuj EP5`,TET=vhP5@,h!9E1;ut^FE \ˉɉʉMЉىf1 ω} EЉEuu5@,h٭!ˊ띋EEe[^_]鰕 UWVSEEu EBU܉EPU XۋUu h!ja1ߋMEfEfS1j EP63 U:t6h !jaTTdDG9}ujh0uuSjEP5`,]e[^_]Δ USUBBPJ R Phƨ!蜉 uEϨ!]Sh!yXZ]UWVSE}EEU!stE8uE8Ct;uڀ}@tSVh\!WQч!tSh5!WQ軇 WVQ>v e[^_]UWVS@EU u}JvEXuW4!Vu +uP @ W"Xu1MP @ j@MQ4!h;%WVxPw,f@Ph˯!vу@f@t*!us!RPSh~!WVJ!us!PRh!WVY$f@Ph!WV> J1e[^_]UWVS]hpVjS`Ph!FCtTh!3Y {yj h!XZ,C@tPh!Y_,C t Ph)!XZCȅt PhK!ՆY_{w j MCȅtPPh^!謆 S C h#Vhx!芆C t Ph!tXZhpPjSmƃt Ph!J_Xj bY}i;} }0<;t'Vh!XZujh!YXGtVh!XZ>);U }Q~MuRlh!赅ZY1ɋlhlPh#萅hAlBXXh4!Xe[^_]UWVS] }uh!R^X1C9~D3Ph!6FZYj KX}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`umo @u h(!jJ\EtU@,<uRh! <uRh!h0,D #<u jSRPRh!h0,j}e[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUMEEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuXe[^_]UWVSUE]0{u@tK uugtƊ{_v3m tO\0Z0Z0Z\um tf\\M tB@9u[^_]U(Ph!h0,fj |Uh!ذUWVSÉ֡,P,uhh,XZ,h!h!hWրhB!W Y_uh!Ph!j: 6,3" u!h,RPh!蒄1X9ډ}Dh,p $h6!` ,tPjh,Fg;9}4ڃw2jPRUJ Utj@uVRPoV3h!WGjEPjh,RU UuE Eu1}u+E9Eu#1tj@uVRPoV3h!j+GGSEEe[^_]UWVSVUu=L,ˋ H, @,u'`, 4,h,h!jY[=P,u %tDh,jSu3u5k+PhZ$n u Ph!nXZ=@,~tj mXڋEe[^_] 1vs9}E8Ph !nGYXt Vh!wnXZE e[^_]mN@e[^_]US]EjjEPURuuh@u f}t Sh,!jE@, H,tUjYY2=P,u Sh!mXZuuuuuhF!m]UWVS]uEEE U$U`, 4,=T,H@, H,t}jjEPjuV@tdMt]QM p XtMMMjjEPWuVR@tM;Mt Ww _j,aY}e[^_]w }tuh,h! = t)tu*Sh! uSh'!Sh!Sh!XZe[^_]UVS]E jjEPuVuu@u} t Sh,!jCEUEU @, H,tj tXP P,u EPZP5k+ShO&k&IuRPhS#k uRPhK!ke[^]US ]EjjEPURuu@u}t Sh,!jB@, H,tUjC=P,u5k+ShZ$k =P, h uuʹ t PXuuhX!j ]UWVS(EE̋}uu@=`,t7EjjEPEPh`!E@Ek(EEE(URUjPW Bu@uv>8"u l>0V9t8t Wh!t_Hwj"FV PWhp& DžN ZDž[ZDžU11PVPRDPG@u$Pu 1xR=8utRt+jj,%jj?jj[,jjZjjM,jj,Wj<^@TC@t9TvWh!MY[PG Zuh,h!*jy>TWPVDP@u%Pu 1H %<8uVO Xqj,jT,tVyO :HLjjًDxH_=e[^_]UE u@ t]US1]  t=U}tuZv!Zw t Yw 9u@뻃[]US]y,,,j`48X=,t=,t 诵jS<Uu u J ZYujhd"rjvUVSuVQ:$@PVP;؍e[^]U,E]UVSh"T^tu5h,8tjtSvZYuFp6j jRSsFS9$P1FSh`$Ph,5h,F h)"uV';SV V_Te[^]USBtPD=,uS2Z]UVSÉu=,u VS^ZYe[^]UWVS׉΋]Uu E E!UuUx$t3"[^_]USt01!1=,uS)Z]U=,thj5, hj5,} UWVSÉ֊;uuY,MtI,h]5,S}=,,h]5,Vk}9=,؍e[^_]UWVS,E9,^$,]S5$-Y^=,u, ,Sx Z=X=&wAKw2iff\5[nRff\5D=,w$==!ff\5=Xff\5=KwJ=w$==` ff\5 =%ff\5 ===ff\5wff\5lff\5aff\5Vff\5Kff\5@ff\5 5ff\5 *ff\5 ff\5ff\5 ff\5Eۣ(,Eݣ ,Eܣ,eẼEfEEE, 5$-Sj5$-a@E,e[^_]USEPhht@j( 1ۅu E]u+h7" PZtP,Y5$~,=, ,t,Eh="OZtP跷,X "L~,=, ,P]UPUE@, 1~}BUw$ !1(udf@, TE"H" FK"N"Q"T"ݸW"ָZ"ϸ]"uf@,@,UShE%N[u^o&,PP蝁ZYHt ,`"t ,B脶!0,c",,f",`^&,M!,8 x, ,,, ,,,,,,~ |,Dž@,*$td\5Tg"t, ,3"*"`t, ,3"=,t>=,u5i"),z&,=,u ,,3"=,u ,3"#,t8u,,3"u&,=,tt8u,,3"E1"`,t8u,,\R$l".,t8u,3", ,Ph3"h3"h,,e$o"P5,5,h,,S&&! P5,5,h,,x$>1$P5,5,h,,x$9/"z B"*uRFWZPÃ$@!%VF%  V?F % ~? VvF% ~? ~  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=@,tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE ]U:=@,u~ 9sQGK9vGGO@~P^49w'WyY 9vG%OtW[Z1M9e[^_]U幈 {+E]bUm+E]LUE=@,t],]US]uh"h`,Y[wDS@Zt9؃@P0Yu@Sh "S5,j h`,SYZt S5,؅x>v>v1v$v ƀ`,u`,5J)`,Htڃ?ʀ`,`,`,]Ul+E]UU 1}DuЃ=%" ]UWVSE֋}] IuREPY^+RiEVYZutVx $W8h"Vhy$WPA؍e[^_]UVSƉh"q-Yud PcZtV19~z u2RAF tPh"S6 e[^]Ut ts!Rh,"2 Rh,M2ZYUWVSÉ׋0V$jS‹ )jWe[^_]UWVSSÉ׉΋Eh ,jS‹M)VWe[^_]U,9,~/MU,EPU~SE),ġ, ,,á,= ,UVSEMUEJE } ,w,;,~d, ,E1ۋM,+,9} ,v1ɍUE]́ , ,,E E1E,E),EPU~g1[^]1US{,8t^EUE:U,;,}?U,PAE,Z뼉EUE}U,PX,8u9,v]US, ,tPt,)Êt@+,),t1=, ,u 1= ,[]UVS, ,E1ۋE,+,9~.t*UE ]ЉEUE }EEE8uދE- ,,,EPEw[^]á,8USEUEËU,,9|2H9u ,xuE,E,S蒊X,8t!UEU}PpE,1]1á,8tUSR1]1UVSÉh ,Z0 , ,v 79w0H,09s CCA+Q1e[^]UVSP Yuu>t,SjEP_U)U tىEPE1e[^]À= ,t8U,,+,,]ø, , ,,,,,+,,,+UWVS]S ^؉E1;tw]ujEPRƃ 9]vCCPÇY=@,u,,3VZu(VWY_uVZ,,넍e[^_]UVSPE ,h , Z ,1ۋE8tVjEPC ؍e[^]UE,U ,t@]UWVSu} ?tB^9tWs ZYt'jjWC 3FCF^ Fe[^_]á,tUh ,P,@XZUWVS}=@,u,,uW,,ǀu,%=uf%=tXW_,^1<%uH ,A,,19h,[u-,<,#A5,,,t , uu,e[^_],t1+PW'EZYHH>$T!}e<(,,/,,t},8 h,,= ,vx ux ,= ,w,,K,pt,,8\,F,,.Ã{,,,= ,v6x u0,= ,x M߀x <,= ,w,f,,8 u,8 td,Vs,@,,=+y,- ,+r +v} t9U~ QMWh ,? MUuɉrCWh ,, ,^_,8 =,t },tP ,YC0EPZE,u , , ,uH׀? u G9w+E+E1E ,9v~ub}t6E9v-U؉MuuV; M܋UuEt1}t8EE18Et < u~ 1EF눅ω=,,tP Xj,)@P4,,)RWP,M+8tWwV/XuV4,YW4,W; XZ,M,}t6,Ph,z$1ҋE,^_,E,,9,v,u),,#tk,Z u5,6YtA,= ,v +8Huh"bZu7%,`؍e[^_]UWVSQMEE ,EEEX8OЀ w%k} e׉u}]ʋ}]8.uEPjEPvz}܉ EUeY[^_]ø ,á,t @@@ UWVS|aƍxPVy[_%=hh!VxV/ ShV: jh"V 1u{ShVv: tht t u@h"VZYt/h"VٽZYt%"utPWZY듿+댿܁+SXe[^_]1=+ +UVS|*ƅhB!PnV% fSft|RP^Zx,E%=ufSfthPNZYh"h"S h"h"S ڸ+!h"h"Sg $ڸ܁+S Xe[^]UX, s \,7t \, \,Y,t h"XY,t h"XY,t h"sXX,t h"_XY,t h"KXX, sh"th7%hs!#Xj5!ZYUWVS<,ƃ@࿉ÿ!"u%\,/WX=8,tW_t h"^t uh$$hb;!YjjrXZe[^_]UVS։ˣ\,vFViuSA e[^]UWVSQEc ơX,ǁt#tf&&ur%X,Su5X,AáX,ƒX, t;x- st j%j&Ztjh""l}XZtVg&VYe[^_]U莎]GzUS`á\,#1 te tR |/$%9Z7QX,X,PSP,؋]<+u C< u,tPO X;u,S,X5<,S5@,5D,lrD,5P,jCP5P,jPCP=,S]%X]];!t`,tP XS7*`,Y=,uJ`,uh4"h3"|^XZ.h4"P=,uS(,Pmajh:"r{]UVSt/,,u ujjj5,RP= I,t@5,,,,u @%@j@5,,e[^]UWVS&t enY@Ɖׅu‰,,,=-u0t;5,,}Fjjj3 ,-ia8e[^_]Ë\,1!UE+EPh@"yZYUVS= ,t2 ,t(@~t\,tCtEu >$,u e[^]鰡X05$,PU X1 , g e[^]UjjUP$,$, ,XZUVSuVZ\9r PKXe[^]UWVSX,,@,e\,rP,T,D,=-t藖=,tj]i=$, j{0,4,q_u) .t u5,2Yuj9=,t"+.tmu5,2Zt΃=,uG,=d,t"jhP"ud,@]t ho"uXt?u j:tXjWWu_X=-eu"xj1ɺy"Ye=-[e\,t!/t`7$CЃ ".jSZYdhH,XP,T,\,I_=D,uezu\<,ƒu_uK8,s +tt#!u+1D-1@@<,7 =8,D,  t);(, ;$,; ,SYHEa<@,jEPEPoD, SrEEE5=@,u Pw P-Z{EʅuwEEPhn" 8,`;(,O;$,C; ,7=D,*SnD,_uSfEEPh"t <,Ht+5<,h3"CP5D,j5D,fYt5D,fj1ɸ/+ F~~C wv$!]*t@t%!tIR=,uS=\,7t@.=,u:=\,7t'=\,7t1X,Q t0 t+SZH\,#^ HR R=\,t"SK_H[ ]EEEURPƋEZYtP_ Fc $!P,19T,},1;P,T,|cP,T,=,t54,50,4Y^jP,19T,},1;P,T,|cP,T,$j1;P,T,|P,T,=,u+;P,T,}54,50,94XZjj1;P,T,|P,T,jj1;P,T,|P,T,\=,u+;P,T,}54,50,3_Xjj5P,1;P,T,|P,T,jj5P,1;P,T,|bP,T,=,uq1P,19T,},|=,u54,50,2Y^jj5,*P,19T,},1jj5,*tZM35h1;P,T,|P,T,5T,5P,P,T,y P,d9Ѻ}P,dT,H,n5H,5P,96SP,T,19| +5RP14%=T,yP,T,5,5T,5P,m5eQC|EEPh\#"=,uE܅P3t,,,jiZX, X,1;P,T,| P,T, X, , X,1;P,T,|P,T,P,1"F5X,Ѓt'Ѓ 5X,ЃtЃX,1;P,T,|P,T,bP,15X,e),,,,h"!t=,vj !" =,Rue:5,)h!"P u jh"z=x,tjh"l^_j !$$Lbj5,MtjPwO[t jh";P,T,|P,T,5P,Yelet!t ;P,T,H"|3"EEPh"'蹓t jh";P,T,|P,T,5P,QZe;P,T,H"|3"EEPh/"1;P,T,|P,T,5P,g_uLjhB"d1;P,T,|P,T,5P,y^u jhN"$PYeɐu 5,RPh- 1;P,T,|P,T,5P,OZejh^"jj_Xey=,W4%Yu ^P Zt W,?W%4<, <,8,/j1ɺb;! =,j !$$wej1ɺp"X_9(,9$,9 , ue w nPP]j1ɺk"A^e9(,:9$,.9 ," t SQY=,tjh"hXZj1ɺw"%u_9(,9$,9 , t u.SP^(,j !$$% j1ɺ"NP,19T,},#, ,P,T,,;P, T,} P,=T,+P,,FP,19T,},#, ,P,T,P,,,=\,t ?j1ɺ$SXZW=,td,@6UE=@,t@]UWS]Sj\XY1ɅxЍe[_]UWVSu} }t M W[E}uEE܋EE;EEEujEPEƒ EtEu@9uv;EPU9@%=uՉ%=trEt*$u!EE;EsXPUP2YuBEtRU ZUt Rg YREPoXZ}tE)U)ME9 Et 9v{ uK}t)Ee[^_]UWVSÉU΅CEC}9Evv8u&uUP@uBgtLt>B$7tKuxgt3@xu@tyA9uEx@G떃dt fud dZY[^_]USJ ZB[]UWVSEUMj j E[^]EE9ߊWtL< tC?CP蝱SӉUYtP ZU9}"1 t @C19w)ЉC{y@xunu}~FEE0EEEe[^_]UM Ut,yE E"]|c]UM Up,yE E"]Oc]UM Ut,]UM Up,]UQMUl,Ht,u|EZt8uMUh,s1JuEUWVS5,t uCjPDESz }xuljUX9}jW YXu uߪYjjjuBu@uS u踪XZ*WSu臩Eu蜪Mș9Uu9t S X;u{Mu {+u{Gt |;t |;WS1_X|;E|;n|;d]l,} th,EPU\S S X]UWVSE9,蚺pƃ=,t1HÃ=,ttVX_H V5,[}u VKquP>DžllPhPSl dDžuW`Ylh!"WRYZu,hh"W,YZuDžhch"WYZuDžh>WZpZpPh\#Zp dt lSd db u`L SF 9uujmVcXj`ڡhY_y0SAVppPh\#Zp U=,tOuWZuh _t܉ppPh "ZZYYth%Xt\5,V$_\\E,dx,l,uh,5,,\Pdhdui,t=,tP^xP`;QZYu(EU,,x|,,,tPX` 5,U,X=,tC`\5]kS5!_Xu"=,~ppPh\#LXZYS X1e[^_]UEu E5,PZYEU5,0Ztjh5"Wjh!"UWVSSÉ։M}uSySYNxuSZu-uƸe[^_]UU,]U,jUU,]nU,jUVSu1SYtP6Z9u]e[^]e[^]UWVS}W{WWWt5uu$1҉u1҉tj裝e[^_]UWVSuEPY[11VEP`^ZƅtYVTEPEP 1REP6ZY…t$RUZ ؋Uu5,%XUu Y땅uWY/5,SP^Z9,u Wf[1WSZYe[^_]USÃ=,t>SX]Ã=,u*Uh_"ZZt, ,m",á,US1j%RZYtPxsuC؋]UWVS jjd舜ZYEdNyVXu ]P tN)EH9|=MMMju5WPESW URU׋M Ce[^_]Uh"\Zu UWVS]SY$@PÛ_X+8u"CtZ +8u:KuKCBBCPZ;t*tUQMWS MUuBBCe[^_]UWVSu9EP[E1EtJC8+t8+uMUURPZYMt}t]EG밃}tEurV9YXjS襚E_Zǃ}tI+PV+Ph"SW1nSP蒡Y[tuW}XZFFGuEe[^_]UWVSRh/"Ytuƀ8tnWXtaVlj$T$RUSh"VhY#%URP S0 hh!WgEW E hh!WgZYe[^_]UWVSh Yu1vƀ8tP[u|$Wq XZtuh7%VhO&WSVSPjPQ$y S Y1PZVq X؍e[^_]UWVS}1ۊtEP݀u9;}v8Gt/8Gt+<%t <#u",,tPZ P;Y^CGjCS蠘XZutQH݀uC;uv8Ft98Ft7<%t ,<#u& ,tQ PS{SÃCFe[^_]UWVS]S8^u1jjjSNBu@thVSӗ 19sUSjW* =,u+€u!SjW 9sPMYuP螼Z1e[^_]UWVS u`Y=,BPfEEZ8u!"PXh"Xt:u"RUƉ$YPqkL$QMҖW+P+PURh"MQV$W XUVZUtRh"PLwG Sh"P:w&V u u X9Wf_>uV u Y^u~ Sx XZ؍e[^_]UWVS}1ۃ=,u\WqX$SٕWh"SPVTPǃ VPHZYu S Y1W V XZ؍e[^_]UWVS=,P,Bjh"Y^'4|uC-uFh!"u迊_ZLH~jh"MY[VZuwL$QM۔uVMQPW# tufFftjEPWy Ht/V:e_u]KtZEE h"芔^;EPE0E 8h!"gZYVdX;u1ۉ؍e[^_]UWVS}E EE=,tPd[h"MY~E"e[^_]JLS:ZEu.Ɖ<$$UL2$QM胓WuSMQP1V t]e[^_]de[^_]USĀuSÍEPSDƒ 1xE%=@|Sg |]UVS|uX=,u1V[t&VP$P踒VPh +\|PVsCZYy V0GXG1ۃ=,u,H9~:WVmƉXZut#C;uE|jjuuSE|#=,ux&,WV ?jjWV,HPe[^_]UWVEU EURPƉXYBut1WV*ZYu$=,t WV/YX5,WV f;EE|8u/5,ԘVRPr E EE"e^_]:EUEUEPhf":XZe^_]U EP ?J>uuuUWVštjh"E:^_g(">9ƉRPYY ,uuIQjj +IQRP,HP =9u9t e^_]Te^_]UWVSu} ]WVʘYZu臚 t3@u謗Ɖ׃=,t WVXZ]u} e[^_]'貗UWVSQEE] ZBu@ujh":贙XZ<Ɖ׃uuE E"e[^_]9SuWV59| 5,RP e[^_]UP茎Yt,t ,t,t,UPSYt,t,t,t,UWVSÉϡ@,u"uQ Zփvu,P4_uSڥ[ۃ(,~K1|SRYuSWƥ_ZV0,DP蜎ZYu0,(,DVk_t,(,u V0,DPNZYt݉؍e[^_]UWVS ,UEjP Eju Ã}tTUtT4,}ƉEߋ50,50, EP E4,0,E,ZY1t Su Xe[^_]Uh",Yt8u ,!h"},Zt8u ,"jh}4,jh}0,,U1}](,$,,, ,,,,,,=,t ,UWVS8u} EE=,uWVHEԉUXZ=,tY(,4, pl+MЋ tl+0,‹]!Ct;uЉ|;5hl+=ll+}@@(,$,=,uluVuu3V Ã}VSh #(,4,PD]S(,50,1Ӊ(,$,,,Eԡ4,E̋(,=0,5$,uȋE)EE9u|EЋE؍UU̍ M9U9u#؉)ىMЋM;M}7U @1}M }M1M9M}Eȉ19u|Mčt (, $,e[^_]UU1wR5,}ZYUS]1w%SZ1uS5,HZY]UWVS‹5, (,)$,)9~ȉE9~U܉uEE (,]9]-9d4,3=,ustuiE=0,VUE79MEMM EEuD7EEDPYMuyv=@,RUEZ;(,t4,P(EP؞ËE+EEYXuduuuZƅ1=,u=}uZEEEEEU=,HE$:1=$,O;=,~EP蹗EY (,E,9})4,E0,E܉E}U؋U)ʉUMGMt딋U)…~U}}܈@Eދ}y1π}t=(,5$,1^u[»(,4,EU54,jEPE4, Ut9w)أ(,Ѝe[^_]UVSUMPP^$,N1ɋ`+ eơ`+X;5,~ "uu1ɺ ZYuCu1e[^]UWVSƉ19,~ ,Zt ,)C1[^_]UWVSƉU,(,,9~;$,} 0,D0tUM uu u11ҸX 4,ȉERj}W菘ƃ (, ,9}f; $,}^0,D0uQ4,U)‰(,PjWK0,(,M)$, M뒸1 , ,1=@,أ ,(,4,P裕Nj(,0,Y9u._u$t, ӅI> _u4,UM_uH@t>PZt,+(,4,PVPDà u , ,x 1=$,,,+,L+ ,~9|5H+)ș);,}s4,)1ɉڸ a|7lj;=,~6Nou u$ڸ Y_t΃=@,tv=,\PnZtA,tu$uu uM1҉UM =@,t|Wt^toW蟖PZ$,N1ɋ`+ jơ`+Y;5,|u u1ɺ ^_Cu uMډZY1ۅÉ؍e[^_]UWVSEEu },t*5 ,5,1ZYt ,} uX=,uO=,, 5,= ,,,X@,,뺃=@,Mt ,up,E,xWV1҉=^_%=u(%=tQ ,5,=,Y7%uv,C,M,9~1h,,Z5,=,th,芑WV,à Dã,,2M,,Í@,,ۋM ,,; ,}0,;$,}4,(,,)-=@,,e[^_]Ã=,~U,,,]1UWVSW},tt< t5 ,5,1z[^,,,9})54,0,=,uAjm5,'uZYt.(,E" t B@E}t(,,9$,(,|=0,tt =,,u =,u @(,*=,,t!} t DP(,D(,e[^_]UU4,0,@]UEU =,t+=,tu ~'H  0,  4,],,,UWVSQSMQyq uu RP8ZYu]ƒt1ۃt t -t8,H9UpUt 4,C뮋 4,tteY[^_]UWVSQMQyq 19| RP|ZYu,X4,D&E t(-u}tbP,UUt #@4,ED,M\9Ew HK,)K4,U11҅t 4,ىt ,eY[^_]=,t&,tUSJZ P+JZ HX[]U=,u ,,jh"U#XZáD,xH@dD,USD,@,X9}jh*"#D,XZ]ø`, @= ,u ,`,`,H,@,,,,,,,,,,,UWVS ME E}EE,,t C 9{E}E9Cu 9K؋s`,t `,H,H,px}x HMHC@92H,ue,puXEM,t(xp9}} Ћ}E‰}Eˀ}tH,H,HJ@ [^_]UWVSQMQEU=,*E#E@1;EE=,,tG U9WE}?E;G uE;Gu O_@,,wt:GW M]+N^ M]+M]M؉]܋]9]]]v v[_ujD,N^~ vtVM] M];uE}-uF"Xsh$$Vh4! REj#pjfjb:jqhEj'ejhu!;dy uLhXh/"f_u>h& ~8t>u Pc_EV[t̋URU<É<$2L$QMcWPURhY#%MQS藥 Wر YusVcZStS蹱 jSduguCdjf9je}t&uhC"dj  o,uXEe[^_]8UWVS}EEEEuu OzZYt jhT"hB!W0YXujhr"XZUqh$$ Wh4!2njdjq8jj \r}uV}uPxǃu8V2jj /rj48jdn,j7W@uAE UM;M MM|'E U뎃 twxǃt@{uq؍e[^_]UWVS] uEUX}u }t]jƉXu u11jY}.uRP&;uM| RPuuBu @ujjuuWVS(e[^_]Ƀaw ,ÍBw P,Ujh"NXZ1U.t|$t5,'z^uu,,,-jyt jh"av,,,H,,,,>h,P,,Y$txuxujh"XZ11ǀ,ǀ,=PuUE]UWVS EtÍuV{󥡼,Xe[^_]UWV ]|u.uVX}u}t,󥡼,,e^_]UWVSExtl,=,u8=,u/=,u&,,, , ,pxX 9u SWV P.Zte[^_]USQM˅t&¡,9tjh"XZJZȉڍeY[]UU19,uǀ,ǀ,=Pu]USE] =,tE E"tmt,ztE E"S=`l+xE E":S\PI,P ]n=`l+yE E "],EEPh "XZ],+x,@B,USEtzE 8.MU u4@E Qh7&R%+ }t jh* "Qh7&R }t jh@ "i,+_+y,EEPhT "~EUu7uxLà U~_E ȃ߃A<vM-tH}u;]t);]~27zZ9E]uEEEFt}t Es\$H}tE}t'EEEM} t tE Ee[^_]Uh@,Zt@ ,EEEEjEPjK  ,uu uK =,u+t $, $,Q$,~jNK ,yq8Ac8#3Ujh@, UEPY'EUWVS'0Y u˅É4$|$W(KVuh!WP3؍e[^_]Um D!m@!|$fD$ fD$ l$ |$l$D$USEi]'dt>mL$L$5{!@!|$fD$ fD$ l$ |$l$D$T$11ҋ]USL+,t6=,Sh,PH 9t ,L+,]U=,t,X=L+,rL+PL+M,E]UVSP-t ,H,EPScXZt'uXE,XuXVVYC#We[^]US]t CP1X]UWVS M ]1މ1ˉ)E]Mԉ]Kjj WV:A0jj WVBƉ׉ Mu˅y C-E؍XSuXZe[^_]zUWVS]1)EM I0uyA-OQu 蛄XZe[^_]UWVS 1%t@ER,VYHM؊@9EtA@9Mut>:G131} PEPjWu 1ɅuEUe$s )ȉȍe[^_]UEt$tu ,H,,H,‹R]UVS5,,1~PCPS|"EU DT e[^]US,H,~DTˉTIEU S[]UW ,y1=,_]UWVSM] ,; B|#5,9~; ‰|}H@[^_]UWVSE,1;E  ‹\9Ήr @޸1[^_]U,HPjZYUWVSU=, ,19~4\@utB2Z B[^_]US EEE,9,~o,tEP{S贐 ZYEEj5,.B£,,,]MXXutE‰L]UE,yЅ9|BH]USXH:t! t%.t?t \uXBJuÉ[]UWVSP|ZË=,=-r-)SVW I, e[^_]øs!US]SRPk ]UEPROEyXZUWSPYu"ux,H9~CSލe[_]URe[_]UVSӊPtbƀwhDtYpPjt6Bt'bu::mt tu(( 5,[XƉe[^]Uh "S@,X"=x,t "P4@,h@"%@,h"@X+h"@T+h\"?P+UWVS,u} ,,3">L<:^]<%<.uY;uM}+9EM|!@uWV膪SpB| E]똃}t e[^_]Ae[^_]U-ujhy/"ZY1=--jXUVS]t 0P0 X--- -e[^]Uhp+XUh\+XUVS]u GQ\+ut;ru;Zt1[^]UWVS<Ɖ׋EEE EEERV/EԉU[XEE-E#E@t ;uE}u}to~MEUEt*RPWVE܉Uủ}ЋE Et2EU(RPWV{E܉UẺUЋE EtEU}u}u} 1E 0x$=,t%E)1)=~uuuu6uuZYt u܋} -,ut $u t t=,uRUu'Pj2W*EċUREPuuSA(EEti-:t[5-jEPEPuS5-5-. t/jj.2‹ű}Љpxu܋}p x\+Y^_-ujEPEPuS5-5- }tuuuuًE̋Un`Mȃ}W=|,u!uuuuًE̋U9S u Y[E}t,ME̋UЉQS u XZ"EEȍe[^_]UWVSEEu UM}t=,u@pl+Etl+u}t(];hl+ll+}9U|!@uWp+t8];X X}ut9PX|ׅt=|,u1}u1=-ZY[^_]Ã=-u ,-U-tP~ Z-h-XUUt:u'-tPX~ Z-h-X M -,ULu -]|1]UWVS(u}- -E܉U-EС-E̸->t$EE}x>EU EU1~u;]tjjuuWEUC-Eء -E@u}t&;u؉E}!@u--;E] },BMu k,׋EU Zu #9.k ,ߋ]9]] ]}9|ы]9]M Mk}9}} }ԋu؋}e[^_]U EPVX}u}t jjRPuufj:Uh-=|,u]]UWVS}U ut :@-uLj5!b[dcY[t)-|x=|,u=-u. jhy/"-1 sjh/"XZ=|,ujfX=|,u=-t--B-=|,t%j-@[=|,uEt411҃}(=2)D =,u E؃#u%@u }u,MMPGPYYMtjjRPS}t2u2u-C;,|SY݃uKxSYtEUuu rojh/"ojMQjVWjjsƃt=|,u>~:"u5,uu蹥 =|,ujX 1ve[^_]UhJ3je: -XZ= ,tUhs3j<: -XZ= ,t|Ud7h3j: -XZ= ,tNU}t(h3j9hs3j9hJ3j9jjj9jj9jj9jj9 UWVS--tkjjn9'85j+jjO9jjF9#jP{)$hs3j*9j+5, tH=,5,W/9=,u95,t',@,RX,t=,tj!(e[^_]UWVSSE։jje(ub$@PM(CuPids {E C}u C%ub$@P (CuP)d؍e[^_]U塄+=+tPQ Pj.[^h>j.XZh@-(YtVjjx.^Xjjm.XZh1"Yx-u  +=t-t j[P ԋ5 -+tPVZYt1ۉx-0"g8@8t|8t8,t@ۋ8tH5 -Rx-PZYt-@S0IXhh!5 -c^Xuc5 -h!g`Y[0"SrW$S5 -y& FP5+PG^ZtbShV菎 Nh8&P$^Zu @׀8 uSJHY0"hA"P#ZYt @׀8 u S HX8t%8,t8 t@Ћ8tH5 -Rx-PY^t-t SGZ@x-P Ъ"uy9"e[^]U -jjo+XZUhSBj\+ -XZU! -jh- ,Q,y ;,| t,J ,Uh,PcXZUWVSPEƈEj}W5 -D$ f=L+tn -5+AjW5 -TjA= -t.V"Ph1"] Ktjh-5 -# 뜍e[^_]USQh11"葽jj1*jj(* Åt4EPYZ9um h71"Fjj)jj)]jj)jj),+j/SZڅtPjRS躢h0,hq"(h<1"jy4h0,hq" hH1"j^4USQjhXd#5 - f=+t#ܑ+;tSS$S5 - jh4!5 -jEP5 -}nu5ܑ+hS1"/\XZ]USPjP]She1"l t= -u)<+SFZy Shk1"[ZYh91"X]US]j5 -SS t Sh1"[XZh1"譻j UUS\+t$;tSR$S5 -jjUS,+j/SYZYPujuh"RS]UVSUu 1ۊt< uB< tЊt( t t@9tCt@8ủ[^]9uW|$wUWVSE؋O_̍+uVRPSQT M܉M Ѝ+VSQRP6 u܉u ԍ+SQRP&ÉEuh\#DZXZrCLuu us 1HsP4+UQh1"YU71"e[^_]g_UWVS]SP$S5 -  -jh 5 - jh -5 - ƅ jP5 - jP5 - = -!Ѓ uh -jj#[ h-f$pBj%XZjzY1= -u?jP5 -Aƒ = -H"= -u)uPY_uՊ< t{J< uf=+tFVh1"1XXZ)9=|+4WPu H 9th1" _ -VPu  9t h1"շ^f=+t$j;+$Ph1" h -jjY jh -5 - Sj!$XZu Ye[^_]UVS hVh1" P(B[th1"KÅyh1" YhVh1"9 t&i^j SChpBj U#5+Vjj :# PZ~<9u6jAj8Vh2"HjOe[^]UWVS]ujh 5 -D -h9Bj"Eh -jjW jh -5 -H t@t PFX -f=L+tjURP Pj<^_jEUY1E1Ky S@?Z PE= -$u f=+t\EI+ ufu9E 0 u&fu&f= +tj XGuE ft EPY} tf=+Pf=+tFVh1"TXZf=L+( -5+7XjEP5 - = -= -t j7X,= -#E+9uj`7_} tf=+uj Y} u*jƉS<uj f=+u>E tPE Z+u}f=+t WVh"2"WVh1" jh -5 -h -jjUe[^_]h92"|X UWVSEhVh1" 'jh 5 -Yjjjjh -jj U(jh -5 -d#à yh1"X11ft#jIƉXPY~G9uAj5 -C=j4jjAjj8V! VhM2"iRjKf=+tj)RPh_2"{jh -5 -i h -jj+Tjj jjXZe[^_]UWVSEuhVh1"/ 4jh 5 - jjijj`h -jjS(jh -5 - à yh1"|X11st#jƉXPZY~T9uNj5 -;j5 -;jm3jjjj$VVhM2"PjnJf=+tji)RPh_2" jh -5 - h -jjRjj^ jjRXZe[^_]US,]S5 -'h u -u M e -Sj5 -BRh -jj4R]US,]S5 -6'h u)Eu %ESj5 -Q ]UShShi2" S+[t+jhu#5 -  +t+Ց+tՑ+Ց+tՑ+f=+t|e+t$e+f=l+th h&"uYŒ+tŒ+̒+ -Ւ+tՒ+jZ+t$+f=+th h&"X]Ujh{t 5 -A9j3jhzt 5 -(9US]1ujPC XZ]jUS]CStu R^ZYt1]UVSEhp2"P^ZtP8[yh"(YPh{2"hPQL8ƅun,+u*p$ $ X<Z $ $Ph"SSj@u*h!tX X X1 $h-O à _ XPY9u tth0,h2"XZ댅yh"xuPh2"uPh2"h0,O Cƃ--8 u =-vH@-e[^]USEjPh -h2"I uxh -hhP -yh -h2"KZY?hSh1" t h -dX5+5 -S ]UVSjPh -h2" h-h -PY[vE2"e[^]*Hu --5-hhPÃy5-h2"JXZ+5-h 3"hViIh3"SVe[^]UE jPh` -h2" uXh` -ehh!PM uh` -h3"RJXZ)j5,+P f=L+u -EUVSjPh -h+3"b h-h -PY[vE23"e[^]-Hu-Rhh!PLà uVh3"IXZ@-f=L+tPhJ3"PhR3"hVHVho3"S2 e[^]Uh0,h4"jBUWVS}F - - -%E~1Ejh+h-8"u u.=-uh0,h4"j*Bt%`'FtqD95/ kU DЉE죸 -뉃a$D0"1oEtPt=l5WZ?Yvhw7"Z?:5l5jhq!V23 jhq!V3 h !V^Zƅh7"jPl5hi%SZYlh"SZYMh !SY[Åh7"뫡l5 -l5 -En= -t h7"sl5j/RU YZUt  -6Rh7$h - EPjhjjjj5l5 -U P5l5h7"R詻 -tfh8"tN - - -=-vldZR ,E)t8HuR}t hN8"JE h$RU9YZUt -" - - -hcjhcj|hcjphcjd 5 -hs8"j h-ADh-5u hx8"@u h8"jh,j:XZtKthi% h"h !V [tNu+l++)=-u l+ l++=L++= -t ̒+= -t5 -H Yu.}t h8"j= -u"5 - Zt5 -h8"je[^_]U -jh@-U4h\jEXZu5EZt -= -u!ujYX= -h@-HZu(j '= -$uZY -j&Y -yuh\#XZ -V= -IjP XY -tPY -URPzXZ= -uM@EPj5 -7E jh t 5 -- jjYX1}UWVSS]=x-uh8"tYu h8"jEh8"WZt8/t P X++8"Sh+EP7 ƃ 1= -t9 - - - - -= -u' -%;/u% -jSbGY_t -t t u!h)9"Sh8"GpXZ h9"9pXjU;+9u QRP?  +Euڃ= -u h -h~;#Pk @u  -%h -hq$uI @u  -= -y  -j:hZ9"u8  - -uSh]9"&= -t$= -u -= -u Shu9"juj:hz$u  -= -u3 -t -tR5 -^_ - -j:ht&uz t +j:ḩ&uZ t L+j:hB!u: t +j:h"u t +j:hn#u t +j:hF"u t  +j:hB"u t +j:h%u t +j:hd%uz t l+j:hS$uZ t l+j:h!u: t +j:hz$u t +j:h/f"u t -j:h"u t += -u  -+= -u  -+ -t Phq!Y[ -t PhVi!XZ -t Ph&{_X -t PhQ$e[^h -h&u @u  -h -hE1"u @u  -h -h!u @u  - -t-x-t-t/j,SZYu -t- -@t-؍e[^_]USPh9"h0,X@Sh9"h0,H@j6U= -th -htj ( jc U ,yh,'Zuj,P,= -҃ !Ujj  -h!jh` -nUh -jj> Uh` -jj> U E E -hdj> EYXjj0 EXZuh\#^<YXh` -诰ZtlE qujYXujXZ= -uVE ;EHh,%ZtU < tU EE9sE @E ,xˡ,P,UE Mtt @8u1]UWVSu - -FVtI)~@9" 8u\Qu ^@P u f^?봈@ -[^_]UEP^v -^?<tP@ - - - - -]UVSEPh9":XZ+;t[Ct = -uGL+PPh9":sC <Ƀ*PZVQPh9"}: 렍e[^]UVS,u]S5 -VS#VS,EԀ€Uԃ= -t̃Ef=+tMẼeewfEf=l+t %‰USj5 -;e[^]UVSuU ]= -tSRV y@19t  - @08u h:"E%e[^]e[^]UVSPL+EÉ -+t68u-Fu#EPPh\#9SV1%tك 8]tjEP5 - Íe[^]UVSܒ+t8u# -tPC [u -ܒ+Yܒ+h !S^Zu - -h"SZY…t]h"SY^tXh.$Sw^ZtPhi%SfZY1҅tBSh:"h0,:h0,;1Ҿ11Ҿ 1Ɋ+1 ! -Aue[^]Uf=+t -tP7 Xj 1Ujh -5 -jh -5 -UWVSjW5 - ފ< uf=+u"0U)څ~CCjW5 - ǡ -tP_9u+ƅy0h!V: -ZYu ƅnƅy+jP5 - e[^_]1f=++UWVSjj/jj&h=ijh=ij -fDž -fDž 1jjP ~Ft=jh -5 -q ~$ -!S 9]<u^8C Q{ tUVWZYUt@PuW> YVC Zu h:"襓Xc9s ts tC Ke[^_]É¡,H,y;,|,H ,Uh,R8XZUVSá -H!vB3V8*Y - -Swt^t2 -P -" Uf{ u@ -!<3h\#2XZ{Vh"2 -C [^taP; -s Vh:"c2>Vh"V2 -C ZYt'PPS) -$h\##2 = -"~ -h!Xe[^]UWVSUu EЍX]:MB\t!^Ht E@yB^vx}HyЉwˊX{ЉwP&;"n8u@B98u( x0vE E ψJEB8t1ZY[^_]UWVSS]hv$S-^_ug+; CtE$ƅUB@t,h<"4,XZjEPhf@5 -jh<"5 -Bj贻 j5 - jhxt 5 -5 -nUVS,]*mf=+t h<"+Xh,uV5 -M@Vj5 -~-j5 - jh<"5 -!!jh<"5 -f؊t =u,@S*"$S5 -;jh!5 -)!1<"؀1uj5 -[^=-tjchQ<"*YC<w3$0"h%h!h<" h<"h ="d*ZSSh="U* hQ<"H*X1e[^]Ujh!5 -_ JUVSh?"dX>"X~&1tlRPhZ$h0,,CttHu)h0,h?"h0,h?" h0,h?"YX?"tG"Fh0,j v[XZe[^]UWVSf>,fuURhht@P Pu fEfth?"W,?"[ ~&tIt>UQM Y9MU~ ?"QRhZ$h0,+ÃG"h0,j ZXZe[^_]U2PPPh?"h0,n+w$-t@th -Xj!Uh@"h="hqhA"6IUWVSSt Éֺ,?""h/A"h="hhA"Iu :u!USP5ZYUu=$-e[^_]VShK"L t󤋕K󥋓9Ћ}.ف1CjjXZu/Cjh_X8u 8uY8ts hH"脵[^Cjj ZY= Q8uDžWhmds t hrK"XeCjj DžWhmds> 9Vs hK"J Dže[^_]U轸Ph@L"h0,jUWVS`֍dx1j`S.tjjj胷uhBL&Sh9iPv @u hM"jSV>Xe[^_]UWVS։ˍ1ffDžf/[^_]USfx uX1I9~+|uD BPX19}|uD ASh&M"XZ]UWVSƉ`dx1jVS`tjjjJu hBL&j5Sh:iP8 1@u`@Ph-M"農XZV؍e[^_]UWSÍ1Dž0hEM"hfM"hM"hM" hM"hM"hN"h(N" hLN"Ph !GXZVh&M"XZ먍e[^_]Ë ,Q,y ;,|< t,J ,Uh,PZYUWVSu E1NeUVYU\ =-t u'1=-tk=-t t&EuhhV"h, ,@t< =-h3"hmV"h,O ,@t u$ =-$@u| u=-ti^@t|IW=-tLvM@tZ-s@tM,DXt^W@t1?t ؃@<@tHF @t!5-h\#-ff XZ,@t h je[^_]UWVSVu-R$,tfh!"RUfY[~tAq`"=-Uuh!PRPXZu!6h\#_-Y^.,-SZ,t SYXf%,>ke[^_]UWVS|5,ftz=-u8=-tt-=-u---5-5-uà 1S-PVd yah jxPVZYuE=g-]S -_xShrV" ;Y[I)u[t5-h\#-XZe[^_]UWVSĀuf,fu-R$h!"Rtx[_~tu,fp=-tTjjRà xTxPS ZY@u SX9E%=tFSw6hV"(: !jjR|à y6h\# Y^-:-y hR$j+S,Zft9tSX>e[^_]UͧPPh`W"h0, j-W|$wUWSˉ-U]m D!h}fU fUm]mURp pSQp0hZ"h0, $e[_]g_UWVS]E }܍p(}p4EPSY^tShZ"ʢXZe[^_]UWVSP]u CM% CSCt RPV RPh+ 1t)m18th+hZ"O_XcCt5PVPZYh+hZ"_X}uPh+WZYuˁ}tk=-u^SlUUtRVZY@uc8-tRh+ZY@u"{lth+hZ"苡_Xu%Sh+gZYt }pe[^_]UWVS=-t.h+Bh+Ep?à oh+!jjEp\\ @Euph\#[^1xP=(-t,- 0-t 1ۃ=$-Ã}  =-h+h ["h0, ,H, yh,Y,P,0 t+@t( ,y h,Z㡀,P,Ѓ߃Yt\M_jۍxt6Ph+uY^@u8h+h $\ E *Ph+t^Z@uȋE%=t[jh] GPhh+ƃ uT  -u"h+h\#d\ h+@GPhh+ƃtOGXW\`dt;`dE@hDžl+`dpt;`d‹` d)`Tjj\jjPjtXjwXP[ `Dž`DždځvRPT)XPV P9th+h\#ڝY[:)Ӊ1`d=-t`dhvTXrYZEph\#lXZDž`Dždu61Й`d=-t`dhhh`$-\ƒ ~&RXh`$-V迿 X9th+tEph\#輜YX=-t#V\YZth+h["萜XZ\Xu VY-tVW[Z1ۅÃ=-uh} tbG tY4-9GuOxPVZYth+h\#Y[$E9Gu-#G%PV YZuVZth+h\#̛[^=-tWh+ZYt؍e[^_]UVS]hVsw u sh@["'Ƅ} t'h+<Zth+hM["<[^.h+VEZYtVhX["١-t jsPLZYe[^]US]} th+d<Yt h+hM["sh+YZth+hd["贚XZ-tE ]]]US]} th+;Yt h+hM["$s$s sh+th+ho["9XZ-tE ]]Y]U-PPhy["h0,jj U PPhH\"h0,JjUWVS|Ӊ΃=l$.ua=p$.upR|Y_u%=@u'y|h\#[XZ>t#h|V =vQZVSnY_u%=@t=x$.u^VSn_ZuQ%=@u?V^u?SPShy$hS=΃=l$.=d$.|8/uVPwmZYti|h]"UhSW'Wt=|Phy$hWmVW!mt|h]"_XVSmpY^ l$.iS|衱_ZuS|h']"- \j/|Y^|tpj/S_Zxt@xxV?ZY+|x)؉t=9|u fDž.Nj|ƄPRl^_u~;xuf.׉ދt󤋅tƄxPRkZYu<|9u(;xu 9 u ;p=$.t=t$.h,ShN]"h0,,H,yh,X,P,0t- t( ,y h,Z_ᡀ,P,΃߃Yth0,h[]"蟣P=|$.t%=@uSS6^ul$.tS|腻ZYt*S=p$.uPSj|j:ҡh$.t|`$.PShi]"1e[^_]UE TET]ŮUE MQTU TE]骮UWVS EEU ZPs4s8MIPy4}y8}}9Nj}|1NjE9u|,A<9C<|"TU ETE [^_]> [^_]UWVS UE EXPs4s8JPy4}y8}}9Nj}|1NjE9u|*A<9C<| TU ETE [^_]í [^_]UWVS EEU ZPs(s,MIPy(}y,}}9Nj}|1NjE9u|,A09C0|"TU ETE [^_]E [^_]UWVS UE EXPs(s,JPy(}y,}}9Nj}|1NjE9u|*A09C0| TU ETE [^_]ʬ [^_]UWVS EEU ZPs@sDMIPy@}yD}}9Nj}|1NjE9u|,AH9CH|"TU ETE [^_]L [^_]UWVS UE EXPs@sDJPy@}yD}}9Nj}|1NjE9u|*AH9CH| TU ETE [^_]ѫ [^_]UWVSSEEU JPyXI\XPsX[\9|9| TU ETEY[^_]vZ[^_]UWVSSUE EHPyXI\ZPsX[\9|9|TU ETEY[^_]Z[^_]USU EAHtWSHtL t u u? uA] M[]9t=$.uyDutJt] M[]%%.1 []UWVSUv$. $. $.0DžTDž4Dž8Dž<Dž@DžDDžDžHDžLDžPDžxDž|DžXDž\Dž`DždDž Dž$Dž(Dž,GHf tfu7w  PGTPh!%G G$.u fHu+=$. T.u=$.uG GG,98s80wPF`Vdptp9X\t}ptX\V F9x|s x|F9HsHFXV\hlh9`dl}hl`dN uDN 9P}P  9L}LDžpt(,hl $=$.g=$.tvh9l&j ]SpjvipY[t̃=$.tvh9l&j ]Sjv.XZtpYh94}4SZ9<}<$.t6h!"vlg TP 9@}@hDPR Xu jjF pPhD FSP=$.t'DFTPT wDD$EEDEȋ8Ẽ0(,EU $EUă=$.t E` %.AX\SQRP謩RPh j]SSwEЃ=$.t@ȉEЋ@EԋK % 1RPEp<%RPEp8h_"jSXK\=$.t6jj h3"QRj}Wrr@WEp0h # %Ex0G_"=$.uO_"QRWPs=$.tC(S,=$.tC@SDC4S8h$. $.t9=$.tdlC=$.u=$.t@uqC%=uX v2e[^_]UWVS]C=$.tS(D=$.t=$.tS0SD$. $.;+(C;+~:P5%. ZYujyX]e[^_]-S+%. %.1tP  PtF@衸+E졸+}E}ETE}9}~h}EM9M}*=$.tK0KS(%.z}9 E9U~Uܸ UBE뢍e[^_]UWVS ]C=$.tS(D=$.t=$.tS0SD$. $.5+9~] [^_]E}EQ31tWF  FtG;}| 1=$.tK0KS(z9U~U UBGv른 [^_]UWVSQ}$.tG(X=$.t=$.tG0G\=$.7EtoF  Ft_}~;,1EEF,;+| E =$.tO0OW(Ev델 Z[^_]UVS RPuV u1 u5P.5+{P.~~1E tlMWVuu ‹MtEπ}t P.HP.+P.+Ț+1 P.(뽍e[^_]Ã=&.u =Ț+U~h~P5К+  Ț+Ě+=&.uNUjjj5К+4yhg"0jv RP5К+ x11U=&.uhh"j?XZ$`%.t5D.5P.hAh"jUWVS] }1WSu: ~ )ƅuƉe[^_]UWVS] }1WSu过 ~ )ƅuƉe[^_]UVSUM Ț+К+=&.u;QRP譈à ~G&.9P.tsP.tg`%.[QRPrà ~ &.>Ț+t5̚+3Vhh"0j5̚+hh"j ؍e[^]UVS] 5Ț+Su5К+ƃ 9uĚ+&.~1Ț+&.tH~Zjjj5К+)RP5К+ñ Ț+1&8uȚ+1 8t8EuR8 uhh"j輜Ț+Y[18t8z8u!kxt Ě+&.=Ě+u Chh"_u5̚+hh"j< My̚+USh i"0j,.Ht u hCi"jhyi"jXZe[^]Ã=%.A=Ț+4UWV,+w hi"&.t &.&. Pt &.(fEEEPhm5К+ó xyȚ+&.5%.~tjjj5К+蟳x5jWVRPx})WV5К+t&.=Ț+hi"j讚Y^h j"j蛚XZ1e^_]UWVSu} E@19Ț+&.jjj5К+ղӃx׃=&.u%.E%.9u}uljM]jWV5К+荲ҋM]y%h>j"0jɚȚ+ )ڋ]S1 =&.ue[^_]ÍL$qUWVQ1yȚ+m&.u9?hnj"9+jjj5К+̱y Khj"C)y11҃=̚+~ hj"jRP5К+英hj"0jəȚ+ Ț+P.19MQRPWVyU Uthf"jmȚ+XZHfEEEPhm5К+° y)u^Vhk"0j Ț+ Ț+1eY^_]aUWVS0,=,+u,P^+H%.L%.Y tDžDž=.=,+[hzI"WV5P.5P.K{RPVh5k"hW5P.5P.hLk"hV0WVhWk"hVm}}t^=$&.tU5J.5J.hLk"hV0Vh$&.hyk"hV(Vv$Vj =,+ubh$J.1WVRPXzRPVh5k"hVV5J.hk"hP0hzI"P.P.P.P.WVRPyRPVh5k"hRE5P.5P.hLk"htW#05P.5P.hLk"hVRWV5J.̚+HP.0hk"hP8}uV5D.h!S%V $Vj~ }*e[^_]Ã=К+yJ.&.&.UP. |.t@=&.u7=l.t 0.5D.hk"50./50.t=\%.tJh%.5К+AZYu4%.%=u#%. %.u5T%.\%.Y=,+w=.t+~ jP~XZ5К+g+Y~jURP= . |.t1=&.u(50.h!gl.50.蚍 К+&. &.uJ.&.&.=.t̚+. |.t=l.t0.Ll.=.tg5D.hl"sYZuQP.P. tjhRPvjh5P.5P.vRPhl"50.gj50.袌J.XZUVS Sh4.j{ y讷hl"0jq jjSj{ y肷h-l"0jE %.=Ě+ @%.=.u5D.hKl"菑^X5T%.h+VqZY=hܚ+VqZY(&.̚+uPVh{l"5hl"PVhl""hl",+whm"h4!Y5D.h6m"h\m"ܐhm"Ґhm"Ȑh Vh %V qYZtFu=hlo"j XZ^RShN.hN.V)؍N. 9e[^_]UWVS E.pFE1۸N.RUPZYU9tVuu ho"'xt1뻃=,+uho"{ho"jG[_1hN.h &..P$XYҡ.xtt'LURShN.P8 u~Hu܉>=,+uhp"jь^_[h&p"jY[uhN.hN.UEN. xtUh &.P.tE y,50>.}Vhp"0j?h &.g1jh &.[XZy EPh &.E/h &.yg =$&./u([<uh$&.$h%&.h$&.R t EPh &..h &.$g =T.tuh &. /ZYxċ.t50.J~Puuh &.6Ph$&.O8l.Y^J.h &.EZuyVh &.`.^_t8=.t=l.t0.al.Vh &.&.Y[EPuh &..PDVh &.-=.t=l.t0.l.y.P4MEU19|J.J.19}RP_^ZyRPPY[xCujh4.jq) =.tl|11e[^_]UhhJ.YZuhp"0j݈ hJ.诬ZJ.1Uu*aZ@t٬hq"0j蜈 US]SZ@u譬Shq"0jo][UWVS|uu V"_Z@uSqtE tNu3Q8xPVG"ZY@tE%=@t )81ۉ؍e[^_]UWVy .PHx꡸.P xjMƉX)J.Pw8URPh &..P@ uˋEUJ.J.RPLYXh &.yWZh &.E\Yh &.'VZjh &.WZYuE=$&./u(d8uh$&.ʪ$h%&.h$&.N h,WVh &. 3,@tުh-q"0j衆 'J.J.J.J.RPmZYH.P(jh4.jn[U 1e^_]UWVSy .PHx꡸.P xixjSKƉ[=.t-5(+rYthAq"0jх =.tdcy[|DžlJ.PwMpRPh &..P@ u!ptJ.J.RPKY[th &.lUZtJ.J.J.J.h &.#ZZu؃=.txPh$&.Y[t. .tkxPh$&.[ZuT.=.t/t/tJ.9EExJ.|/J.9EEJ.|WutJ.9EExJ.h &.qSYjh &.6U[Zt0h &.`J.J.J.J.RP =$&./u(~5uh$&.$h%&.h$&.K t. p.tgxPh$&.ZYuP=t.t4=p.ttJ.9EExJ.|+J.9EEJ.|StJ.9EExJ..t10.J~PWVh &./Ph$&.B1l.[X% 1lth &.6YYSPh &.|O xסt. p.u+=.50.h$&.o*l.XZ}tPh$&. YZu=t.t;=p.ttJ.9xJ.|J.9J.tJ.9xJ.]J.=.t h &. h &.Y+J.tE t@wpPh &.YZ h &.%Zh &.WXjj50>.dl y80>.dodRhp"0j+{h &.W jh &.YXy#lPh &..h &.bW Rdlh &.l dy Rh &. Rh &.YXlPh &.XZ=.x=l.k0.l.Re[^_]U Q. S.=P.u .@P.P.=~~ h~Ph9r"thPhjr"jySP.+5T%.Zx0P.P. Q.P.‰Q.Q.1 yǃU Q. S.=,+u;P.t2=~~ h~Phr"thPhr"j\xF5T%.pZx-P. Q.Q.Q.P.P.1 hyʃ Q. S.+~P.~UWVSX.t hr"jpP.=P.+uP.ZRQ.+Q.EU EU=+}Euuuui[׋MщƉ;EE}u}WVZY+u} Q.+19}dQ.Q.Q.;Q.s5P.PYZYQ.+ Q.RP=Y_xj Q.Ɖ5Q.+Q. Q.Q.+P.EU)P.P.P.P.x,+h(s"jYvXZ؍e[^_]Ã=+US=,+uhZs"j$v[X7y=+~pC9}kPhs"ju Bx]P.P.15+5 Q.(ZY~ Q.Q.‰Q.P.P.1u빃]ÃUWVuM Q.)ȣQ.^_]UWVS ]CDž$$ x$|$x $=.u15xPu yY^y狳Vhg"0juPuvy_Zu d#躙hs"0jwuDžDž5+5 Q.u ^ƒ  Q.9|RPu2 (WQQRPu=9ugy(ܘVhs"0jt9|$u9x$tht"XPu &xZYypVh)t"0j2t.E49}u;0th;t"js9}3t)1;x$|$}Pu ye[^_]US1ۃ=Q.u~5+5 Q.XZ~" Q.Q.أQ.ؙP.P.Cu4=.u Q.,xP.P.X.؋]ÍL$qUWVSQQEE u15Q.=Q.)9}Ή5Q.)ډ tƋP.]؉}܍uVuuRPRu}ӋEЉE؉]ӍEPSQM؉] M؋]ywEU)P.P.195Q.+Q.ؙ9|Zx t%u؉}9}E؉U܋EQ.+u}머eY[^_]aUWVSU Ӆ~HQ.+Q.U U  )څ$ 9~؋5Q.}5Q.)É}봉[^_]UWVSEx$|$hDžpDžl } xJxPu tZYuEl((hhs"0jpDžlltE@Džd19 Q.+ Q.ș9Ή}hlpPtPQ5Q.u  E0xQ.=T.\t7ƅc;\tdAƅc€ctQ. \Q.)&} x7pt%1ҋ];x$|$}Phu v 19|=T.t t1L} yEP] u41}d9$t!lhhbt"jIn le[^_]UWVSVP.P.19| Ef;P.P.}ht"jmIY[P.P.$+ Q.‰Q.;E~1}])É]15+5 Q.XZ95+uL5P.P. Q.}t&5Q.NjM=Q.+;E)E롣Q.~@5P.P. Q.E)։׉=Q..Jtbt[LP.P.:x/+ Q. Q.;E})lj}X.؍e[^_]ËQ.; Q.v.UWSQ.)1Q.5+1Xe[_]UWVSu] ~>Q.+Q.5+Xx 9~Ћ=Q.=Q.)1e[^_]UWVS1;EE }PQ.+Q.5+Zx5É9EE }]u 1=Q.=Q.)]u 1e[^_]UWVS]x$|$ $=.Pu p_ZyzXVhg"0jl[Q.+Q.~^9}P5Q.u U )Q.1;|,5+i^y}W t ht"UxPu &oZYypShg"0j2k+0}94u;Etht"j j }W1vSht"떍e[^_]UVS]E $usPUYyȎVhu"0jj$tHPZy$薎Vh?u"0jXj$ ǃ$ .Xe[^]UVSĀ]s|PVXYx_.uM $M9$$u@;|u8,$M90$u';Uu"xVhPu"jh x 1e[^]US|]EPS@ZYy1=.E%=@uBh %SIHZYuZS~Yy} taShu"0j#i-SZy50.a2Sh?u"0jh]UVS]EUdhDžlE UptDžx}=$+t = +|PS*^ZuZ=$+u#EUdhEl= +uuhx"j Xuhx"jQWY[HV$|ZH~ 8/u3E ؉CC=D.uD.@.X@.1e[^]á<.t@=.t 4.=.u4=.t+UE$u8.tjP5T.+ US=.t8D.1t6{u+uhx"jfVXZ3h"h0, [Ƌ]UWVS]=4.u =T.u&4.yx5T.%8.ZtHHQf $\a"=.tȋ@PURURpp p09xjjuuuu8.pphy"jrUph%y"hAy"p jSV Rph]y"p ǃ$ǃ$ǃ$ǃ$ǃ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=.L$H$X$T$0$,$$$ $Pm6$yǃ$mǃ$aǃ$h RP= y$8.pxVhqy"0jTƄ  ǃ$h 8.pCPnh 8.rPan5D.hl"<3à u<.@1ۉ؍e[^_]UWVS4ÉUMčMQEPmu}āj= 9ƉЍM}Qhy"Qhy"j@S_ue[^_]UWVS\]uCE=.uPh"V' ue[^_]eL}W($_JT$X$E7j8$2Ej<$Uu3"u3"PjRj4$Why"V襂$ w'@$  R%Phy"|$x$hy"VVuEPh*%VA$Pw Shy"u ShO!V  Vj !ZYVFKXe[^_]UWVST]}T$X$uV($ISWVhy"Pe[^_]UWVS]u fVfuPTZt%t0SRjP}W} VW$Cۉu ]e[^_]$e[^_]UWVSQU] Ӊ];Uss< uB1}uPBJyЉ w D$yw Dyw*DB9uwBD9Uv qЉv1Z[^_]UWVSMU ut B1ҋM\}uB9rmKyW wy0K uK0K t9s)V19w)H9w)ð011҉1 [^_]UWVSuE D$11;t$yC@Fȃ?;t$F~ ωҊ< uF9t$u1111҃}u~F4$~OЀ w Ow _wP ˉF\$9$r+KЀw!Fɉ;t$rY[[^_]UWVSQEU uM\}uN9ryMK}OW ;}rM0K uK0K t9s)V19w)H9w)ð011҉1 Z[^_]á.&u*URE.hy"jlMYXEø1UWVSSu] E}MMl5=\.u)S\.:-uX.  ,1Ҁ=X.u" \.Q\.u \.X.=X.t7tMM}E] ue[^_]`E] ue[^_]gUWP >ZYtU:u W3hz"(x:u9 ,9}l5@ ,W3h(z"h0,|?e[^_]1UE E EE],UWVS jEPSkƉ׃EU ;MEs 11M9t./x.  +=,+u~"O`..=.u `.d.$+c.C5l5VZ}1.e.V +=P%.$.`.l5.. EP9~5UxPu{ EZYUuhUz"jLFjmEMȋ l5 .HUP%.#\..|.r5l5DP%.Ӂ"ST%.t+DT%.h+5T%.\+&T%.P+T%.D+T%.8+$+l5P%.$.+.5l5CY4..z ,E,+uUu 0,}u, 0.Hw6}u 9Uuj kLƀ+5..t HuP.Ejh~"jPDeEh"P#$_ZEhD"S $^_E@E.`.}tE8XEMth!"W#Y^E,t&hh!WtE^ZuWh""jCEEE5ƅ}tES| [hD"V<#ZYu`.V{ XEjhG"V\ u=`.t EtS{ XFP V{ ^XEERjSV E2EE}t EtSW{ [h!"W|"ZYt uXX=.~W?Ej5.S oEOExtE.O}.E@EMEhD"S!_ZBE@@EjPA[^}uEh"P!ZYuEXEh!"Si!ZY,ud1҉UDžUuhsh!"S6!_ZtVWY=.rShK"ztjP^_y,hh!Sq_XuSEtj.hD"W ZYt2jhG"WY ujjW2Y_=0EjS+}1T%.t 8h؅!GT%.Yt 8T%.{ D.! 11jh+h,"SuTz$c"p+Ã뾃l5P.5l5h~~"..wl5T%.e. SP%.~"D.@2.΀.l5l5t*tF[tpt=.ttjbZtF}QtuPU!uX1C<]tIoEz-u)BE<]ttE9E|E9EZ뼋U9Uu1}!9A8Qt e[^_]UWVSS։M:NjUÀ8/uXJ) ~SuhL"jB7C։9r HNHNs19rЋM}t;ur NH^X1e[^_]UWVS 5D.hf"V6[_Vsh"D6hɂ":6h"06h WI6h!WtZYuh"WQ[[= u h"5Y덊uh5"5ZX<.uuhE"5X1u8L@%uߋL@LtFCC9r<9u(>t#LRDh"jB3tNL@tBuDhԃ"h0,c RDh"h0,c<th RDM, 1e[^_]UWVS}tExu h"%<\u FFu"8ujc Xu*h "jW2[^uh"jD2 ]CjWP ǃ t4hVP_uVh>"j1 Sj Y릍VE֊t<\uF8t+FDmSuj uh"j1^RZu% mS=j h "jr1)NCtXuh"jKa Xuh"j0Y[G3CVjUZC CECE C= .u ..X.1e[^]US .1t6Cu+uh"j%0XZ3h"h0,` [Ƌ]UWVSPu .1$.Ku Kȃ=.Ku $upFP~_u!h"jx/CY^t/CcCt /C;W*TZC Hǀ?/uC C$% .׋R9t Ouh3"j/ZY1ESg dž$XEe[^_]UVSudž$ .u=.tA=.u8zCtEC |/u&PFP3jG u$=.u-1C[u1=..KVPYVAZxdž$e[^]UWVS]=+tjs{.u{.u Ct:u h@"j/V RZYÅtCFEEPtOzЉ vB,u}u@EE'}u.tVhX"j/& EE@jV Xu h|"(t;u GKGt=tyVhƇ"&O}teE8t]Wyuh"jN%W^ aGƒWt(G 9OG}Vuh"j%W] 8G=.u=..x=.1h!"j$XZe[^_]UWVS M.tmƉ׹=1EӅt9{t[93u@U1ۃ}t5j U YUuhX"j^$XZ0x@ PE؍e[^_]Ã=.u1Ujh X .YZt1hw"j $XZ1UWVS}.N1$?4$E1}*,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujS YtGGP<Zt0 $$$CSEC ECECEC1~S[ Yh"j"XZdUh 3 P= 1$$CHKUwEK 3^[ SX[ [^Ee[^_]UWVSM.4$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3Z X]e[^_]Z e[^_]UWVSQ=.t71ۋ4t%v0ElZ EPcZ XZuC uˍe[^_]UWVS1ۃ=.jhGU .^_uh"jU!Y[W"=(.5,.ã0+Zu5,.DFVh"0j"5,.蚈X1ۉ؍e[^_]Ã=.u1UjhHU .YZt1h"j XZ1Ã=.u1Ujh= U .YZt1hQ"j} XZ1UE$$ $]UWVS]E=. $$$,$!Ήu샻0$u9t!ȉEEEEEE1ɉUƅUt!@ xu }98M@E !1 ЉE} P $$$ƅ}uM}tGjO _@ $$$AQ F AN 1Rt$.... u'.U !ƒ=.u`9u\1tL.=. t:UjHO Zt+MMHUPx N HF $$$3Sh"jph"jd%P @ $$$E쉃,$ǃ0$1e[^_]Ã=.u1Ujh=R .YZt1h"jXZ1Ã=.tDUVS1.0tjjs sss3ӵ[$݃uʍe[^]UWVS$EE} EEEƋEEEU E܉UE$U(EԉU؋ .=1Et#؋M9Hu9p u M9Hu9xt@$uj(M X҉UtMuUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!RU XE ("Ee[^_]e[^_]UWVSEEE EM}.tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3T ST XZ1e[^_]1UWVS]}E=`.t,;/t'PSrp^ZuSh\"j |j$?L Yu#Shs"j tXue[^_]h"*SR50+z 9؍t>h"0j SRN2 yjI Xjjj50+1G WxPS50+Ez 9u+T$X$GW.W81d>hԊ" >h"0j WQ X9h"jZY&T$X$w9_}_We[^_]UWVSP.uh5"ja_Xqhu u E߅t7u"Y^ƅtcj H ^t;uƉYt#uGZt _E81QVP XWP _h}"j[^0_SuZYtSnP uG_Zuhb"‰e[^_]UWVSu} .t=h7V t&3VHZYuusVK2 [֍e[^_]UWVSSljӉȋU t 1MLtt JuQ 9Q1 QA%QA Jك0J t9s'x19r)AE9r)ЉEU01 ىZ[^_]UVS1ɺ4Au񍈜9s AY[^]UWVS| uB¡,Ɖ 19tSP*u Ƅ.'?u Ƅ. fD~u Ƅ\ˆBƄ9/u Vh"h SASyEVh"h SASy=Vh"h SASyVhŋ"h SASqe[^_]USSˋ t)RQP/E3M UEeveRu P/ ]URPhЋ"jUjh葨ø1҃=.u1UME.1Ҁ<u Bu5} u*J=.t.8]UVS]} ~z;tujhF"P, u&4+u 4+Eh"jXZ 4+jjPƺ 9؍e[^]UWVS5Å3h1"VQ_Zt+sVh;"jKh~"h1"hi"j5 2{h~"WZYu,+vWVh"j.m1e[^_]UWVS]u hVZYyn- 1Cǃ4$WvAVh.. i Rh.. F jjFdP%($jjFlP8$jjFtPq<$$jj F|PEUUEщx$|$ @uAjj P$T$X$H$L$`$d$Hǃ$ǃ$ǃ$ǃ$ 2t~,1ǃ$ǃ4$($Qw^1ҀKƒ $x$|$ށ$ǃ$$$ǃ$($y($|/t5uǃ$@($ǃ4$Hǃ$΀($x$|$%$ǃ$$$11Ҁ|/uDЍe[^_]UWVS u$Pwo$e"=.t_h"h"h "h*" d~ PhG"HuCVc~ Rhe"1jdRP*dž$dž$$ u#EƄ/jj o11 Y[1u9E2jd PEP"*jj o11wE1Ex$|$ƅz ӍyHσ0P uSo1ɍn9r)ڍJn9r)É°0󪋅%$dž$n9uh"+. .t .. T$X$($1jjW_Z8$1jj_ZY<$1jjgtY_jj {O_Zud1jjM/ZYuDhS[_yHjh6ZYx鋖$  Ѓh"j e[^_]11UWVS}} ?jhF"V% Åulhō"VY^¡. . u.h͍"j} XZjjPʻƺ 9tPVh"jH ؍e[^_]UWVS]u hV/_Zy - 1{ǃ4$EYt"h YPW&z/@E K<vI +UVh..E Rh.. f jjFdP輺%($jj F|PEUUEщx$|$@uAjj PmT$X$H$L$`$d$ƆH<$P)PZyjjFtP<$ Ɔ(8$P PuXZYyjjFlP8$ ǃ$ǃ$ǃ$ǃ$ǃ@$ǃD$<6tL<5t_<2Pπ3@$%jjI^_to"W"@$ % 1jjQZYujj |11^_ƅ6jj |11vZYyw"wu ƅ2 u ƅKƅ1jd PP[ .jj |" u\ƅL5.%$$1ƅ{H0H tm9u H7x$|$%$ǃ$ƅ{H0H u(|19r)A9r)ljư09uh"DžustafDžr=.t fDž fDž00($1jjd^_t[#8$1jjlZYt:%<$1jjtR^_t"W. .t .. T$X$jj ZYt" j8$Lj<$Nƃu3"j W P u3"j V)PF1jj|t"hP&^_yjj lZYx .u$  ЃY5.Pؕ¡. ..^_x)ЙRPZYyxe[^_]UWVS$É֍@- 1uh h f"DP@ @t . C .@.RpXe[^_]USP]S5&Z=vESh"j; U؋]UWVSu>-u~t2hh!V2_Xu$&&0X> PVhΏ"jY,1EPS贠ZYt/G}vEVWh"jEU`t1,t SXe[^_]á.t UU RuPč5.>UVS]u F1.tRPSx\ tD3j SZY1҅tЍe[^]US]}t X.|. .t!=l.th0,j _l.XZ5D.h!h0,=0Su h0,h0,j F_ ]USjhu!Y[xEhB!P.YZt&hh!S.YZt135.ZSX=.thu!h"j ]UVS] u}t X.|. .t!=l.th,j ^l.YX5D.h!h0,=/Vuh0,~S; PhD#h0,/h0,j &^XZe[^]UPh"h0,.j% .U~Ph\"h0,.j_%UWVSƋ=8.tPh"h0,. =0.u ˋA%=tjR0YZt"8t͍EPsXZ=4.tVh"Y^XjsbIjsZG3"} t$VWPREPhȐ"h0,-h0,&,H,[yh,Y,P,؃ t+@t( ,y h,Z㡀,P,Ѓ1Ylje[^_]UWVSAօu"VPQ[_tDžF%=t1jh @txPZY{x~9|u,;u(^9u;F u%=t%!.rq_jjjc  ׉NX^\19ȉ}{9Dž Dž| PH ;x+{[Bjjj & NX^\19ȉ}{9Dž Dž| Pw ;+{Yqjjj UNX^\19ȉ}{9Dž Dž| P ;+{7LZjjj NX^\19ȉ9Dž Dž| W ;PPW@ +^K`_jjj ~\vX19}o1m u9 |QP 9u#).[@I&@.h\#ʽZYt X؍e[^_]UE @E E@E]RUVSutYSC t } uC0.@0.R/ s/ S/ 0.H0. u,.te[^]UVSu0.@0.`.؃8t VPjZY.u 0.u,.t e[^]Ge[^]UWVS`..1tJ9tGjP ZY9u؉e[^_]UWVS0.@0.ƍP螨Y11ɋ`.tx?tBA'u9t h" 0.u,.th{ jVS19}Vph"N p<T+HQP yP T+H Z J GS萨Xe[^_]UMtA'1`.]UWVSu^Nj7t#vu Y[Åu jWXZ ׻؍e[^_]USh!莿ZtaujY1"1.tP{ Ã.X؋]UWVSP}U UWRW"ơ0.@0.$zW讦CC UR蛦C0.H0.u,.t e[^_]e[^_]UVSuV[t#sVZYu} tC t1ى؍e[^]Uju ZYt@UWVSS] 1}uFYj=GPZYjWnZYu$Wh"5P+ ;ubEWh"Ep T+HQP yP(T+H Y뮋J @PW^XZ듉e[^_]UWVS5 . ,DAt]jEPV..E "t%MAEI"uV)PRhզ" .!"tQ..C"u)BUP贤.NjU. .Xu,ƸN ~|tH9= V~-t >޸(%)&#Ƹ ƸN .e[^_]U5.PhJ"`UWVSR5...PmÉ5.Y=+t j"uMt;ui&jEPSÉ 8uE8t+8t{"^" tBUUu؉e[^_]UWVS}։ϋ [M]Pw$"" ] ]u "U#UBu u" uuuWV uuWV ENj]ÉeEU+EUM? t1M? t1;u] 19u] 19u]|f1;u}}U1#U1E1 U1E1 1*]!؋]!]1؋]1 ] ؋] ڍe[^_]UWVS }Ӌ7V+_=.%us Љ UU_EU=.&t ɧ"JE..S1 }VڋExYtEUe[^_]UWVS(Ɖӡ..EЉU:tSUЉt@ vSUиƉX^MƉׅuGMIt!EM̍YWVщ‰=Y[ƉWVh j]S%jSu  e[^_]US7=.)u []UWVS,}É׉MԋEEEH7..W ]ԉE뭃$" "tCك9UЋE4Éָק"=.#|Eԣ.}tw PÉ֋Eԃ'wI.}1҃}'tRPh jURjUR7Eԣ...W]ȃU]..WuЉEiY1 1..WuЉE6Љ҉Xz}t "A.}twS.4Ɖ׸1҃'tÉRPh j}WjW5.L  "둋M΋EEʍe[^_]UWVS}EUϋEsá..EUVUL.Kw\,"8,"}GVQ.YYuRPUMY_Kw#,"9M~߉EUouȅtče[^_]UWVS}USƉ׋ .AZwSj ƉXZ=.uJE..MQ1  SUEY 1ۅÉ!1e[^_]UWVS}U?WNƉX=.uKE..MQ  fWUE Y 1ۉڍe[^_]UWVSQMq}Wg5.XjLPZYt5xIu,xNu&1҉Uj PeZYUtB@)։5.@뽉. .1=.t "PEԉUW耛EԋU؍eY[^_]UWVSRE} 3"_4+0+.5.NW;t+ .sx)e@׉ċ7 .tx @U6@ Uυy P+4+R5X5.SƉRPhS#9 e[^_]Ë.Ѕt#/tt@. @.US]u1Z;/uPh %gZY@tEPSXZY@tҋM9u;Eu3U3E ]UWVS}VDVP9 tS .Y]e[^_]ʘSĘ Z8"u뺅u 0" Ph." e[^_]UVSu= .uG=+t0+hE"PZYtSv .Xue[^]1e[^]UVSu2t = ..tP Y0.@0. .. .jM0.H0.Zu,.tI = .t.j5.hB"j5 .hE"jhE"[^1V1 @$赖.VP 4+0+. >/t[5 .>t'.H.FxFCBXVԀ~/u#.Kh!VZYu$4+9r 0ƅuh.K;/u>th %VZYt .x/4̘X/ 还XV>t.H.FxފFC94+u .x/C X/=.uk.0.@0..tP X ..54++ .j5.hB"j5 .hE"0.H0.u,.tB؍e[^]UWVSSuE E}0.@0.VZy$ 0.uu,.tkEE^j*á0.H0.Yu,.t}t)=+u =+tt5 .Vh"XZ!Íe[^_]UWVS5n+ƅohI"bYt ^t>hm #W[ZYEtha!WGZYEuEEEEFHπ\ug}taxP0tB<wI$D"AH1.62 . * & " ƒ0wG\9uӡT+HyPT+H X JS>1e[^_]UWVS]u }+t+9tx u h+KX(.X.u¦Ph!hl+ $.t$.Ph!hl+ t&WVhl+q x0h$hl+ZYxSu Ph\#hl+zP+HyPP+H X J El+e[^_]te[^_]U8.u:U4.jP}UU ,.0.@0.tuRj u0.t ,.U,.EEEEjEPjm =.t=+tj;jjfj U=.u .E Puj$UEPu uUE.jUS]Su 0uUuu 0uUEPu juUuu jguUS] ESu0H ]U*u u0+ UE Puj Uu uj UM"ft9uPU t@Qhj&j h<.0<.áL.UWVSP8YuOƋjjPMǃ t 3;ZC jjP'ǃ t su{Xe[^_]USj袣Y.8tN++oT.thB sZXZH.XjjSP5.##1]W|$wUWVS ƉӃ=t.uj'Tk=+u5tU.VUt E܃PuRXZ=l.u VX?\VWXu P.tje[^_]UWVSSE} _4+0+.5.NW;t+ .sx).@׉ċ7 .tx @U@ UυyP+4+RY`.PSxXZ P.P.e[^_]UVS]h.1jsEYX=+=l.tUl.up.Hp.yl.빃up.Hp.Yl.MwE5P.=P.; ut-t)E Ps5P.XZ=l.Qn h.5P.e[^]UWVSu=P.=+u1EP跂E؉E܋^Zt$hPS!L =l.h[E؋Eh.]؅:F.=6+P .P?Ph!v P+xWPyPP+H =X J=sP+xWP_yPP+H Y J 5P+Zjsv iE Pv<=P.=+uNl.t>up.Hp.1l.Hu"p.Hp.l. h.=P.EP踁Xe[^_]UWVS]uVE؉E܋S .jPshJ[tt=l.uk{t_G.EpWPZYt@1=l.uA=+u81; u{C.u s *P.ZYt‹띋[1P.VXe[^_]UWVS]} 31Es(X=6+{5. .PPhz"Stj RU5P+UR h"Xu h"XP+HyPHP+H Y J 5P+Z0.@0.ujSDeuSPE:ytUtVuduu 0.u,.tdjsWs Uu P. RoP.X 0.u,.ttJ=6+tA{t;5. .P荛Pfh"\P+Ee[^_]e[^_]US@8.EEEEp:X=6+tlExtc5. .PZYEP$z"[EXtj S5P+ [h"Y5P+/[EP?lZtiE8.4.VEąuKt&:EPf$"ZY5P+XԋEtP.j58.k0.@0.Eȣ8.j EpXZE 0.t2u EpY[0.@0.E8. 0.t,.t6뾡,.t&Eąt"EP$ê"X5P+Z]UWVS}] CCC =+EPZ|0.@0.EYy h˪" jWbjWPvu50.,.t\ujujWuE؉s 0.H0.Zu,.tEPN|Xe[^_]UWVSE 4DžHH.`.0.,DžhH.EPI{YL.E@.txEXt7u!C.htPS~D 1 s荔Ztҋ[ŋxEp X|EEXtC.sH_uEDž<tj|PSC [뵅tt+P+HyPjXP+H  JvX6 뾋Ep P+tRVP t vHyP XP+H J 5P+_y|sjh"V u `ԁ}ę hh8<1(Huw)<)<88t#`EA htfE=.u Ext,AEftfwE= t=} txˋE@ft50.@0.juy\[^DE@@4t14t>Dž@Ey h˪"=+sf}hExt x U.P.H.Ãt t7 0.tS $hܪ",.t ݍEP*dYt.4.uH.j.uP.P8.HE8.h!|XZ@D5H.RuP\4H8.P.=H.H.ujjSVk @DSRuPn@DRuPn 440.,.J@=H.t*ur$uV_X440.,.t~뼋Eft%f}9 84t lPEp Y[}.f.8t18t'WhX먃tu Cƒv .~ .jSP6h!jUWVS]} Csfftf$ftgSH.$jV$P PVgJyӅtshR"XZ Xthj" _t hs"YVh\#mXZt h|"XVh\#LY^tq0.@0.sfP$P_0.H0. u,.th"~,Prh"h PVh"i{ t-T+HyP(T+H *Z J*T+HyPT+H X J e[^_]UVSu "t"8u%uCVP裒ZYt؍e[^]UVSu"t8uVPqZYuCݍe[^]US̟+1ҋ.tHft fux@ |u[]UWVS}0.@0..ދt,Pfu9x fu9=̟+| P X҉΃.u 0.u,.t e[^_]`e[^_]UWVSSuH.X'1E8Et<:u}t }:u uWt0Fu <%uUVh"pZYUt~:uGC룡̟+t y ̟+ xu1҉MRM ̟+Xe[^_]UWVS0.@0..t!f{usS XZ݉ك.u 0.u,.t e[^_]8t4ffCwfCfƋMH.9tMEth"QXY_tM ju_Zt>HftftfuEEu E u=̟+yƀx u1ETtE u =̟+yuZYDž5Dž\t̟+f~tF\DžXDž`juEP]` W`.Zu?/ug`9\|Y@Ph"EmZYtuYDžt5.h"mYZuz`9\hxPW{HYZy.k8B]84OX"E%==.tlEWLȉ`+4+$>_WB^ju3ƃt fx`tWuh"QW`bXZ0.@0.dTujuY_f~udfF`FDžX BtEt$jXYPuhp&5P+f`z0.@0.dTujuEXZf~udfF~ 0.u,.tIF FfF CfF fCFCe[^_]UWVS$E1EE1EEhѫ"uEZtQEbw$ "E1EE뽾EE뤻띅uutjY1҃}u3}u-}u'}u!EEEE.81.tWFft'ftfu=}fu1} }u#}tуufuUSVuXZUЋ6륃|u5T+载^T+@h۫"[EjVJZYt]@ft<.fu}u>.P.0ufHu*}"fu}}t˃=̟+x tH.PuЍEPVt f}u/6tf}tjVY^t jPXZfu]]u}NEe[^_]UVSu 0.@0.juTË@ZYft&fHu sXfCFC fFC FC 0.u,.t e[^]9e[^]U 0.@0.fEEE+fEu EEPuN0.H0. u,.tUjuZYtfxupgX1UWVS E11h*"rZt&ptvtVuEҾˋE ctM t Ph."t h@"E .9u^"ct3"QPhc"}uSa_"uFjSXZ1ۅtHwh"謼Y_ur.P.u* 8uSPZYh"j wM th"λXh"輻X{.8tT+HyP胺T+H {J P}u#jSXZdGfEGE PjEPS1EfftfHfj/SkZYu]EEԡH.}tEjSEP3EPXMyu"u3"Ph"[_udjSZYuuQh#XDuq0 Ph!޺ 0uh"u~t}7F>uD}tt\JCt0Pxv"/u utFtFua .EZxvtuGXtG;Mu5._txP5.31[^yW9tt3;ts+JxvtuxE]C͡.;EtP9Uu8/tMA %7%PnvYE9.t@/>tF1tJxw@tu@p,.tSqkYF/|SZtx .u p.uȍP jRlt; tltRuҺ5., 뇋EB@JHu@/VPXZfe[^_]UWVS}P v Gu+EHEt7_rxv"tpu uߍ_Ɖ+E[^_]UWVS]{FFu$.si$.Xu11@.+4+EuE=++<@!<*}tE<WE)HPh"迯1}E%}}tnUJ~@.H.Fx@.H @.N։U?H @.NU뻋EH1҃}~׋U)@Eu uPW1} G@.+ 4++Eu)@..} u1< @}ŠŸ" <w2 .x@.H @.U>H @.U .x@.H @.Uu>H @.UЈFƒ v! .xM@.H @.FuJ .x@.H @.ĈU>H @.U뫈U=H @.U1uut?@u=.uM @1 1E @΀} M$"5@.P@._X u  E PuhY[E؀x1 .@.y5=P@.=@.+=4+uuuuWu=u#@.+4+)ʉ@.@.uuZEu=uuuWu\euEX~1tuС@.+4+Pu }uduڋM}u EMEtr|wt<.<.׃uy}Qt@뿃uHuEe[^_]UWVS]E %EEE tE씡+.u .E@.+4+E;~uE t u SXZE 1Es}B~< ^$Д":=L{s{u{y{@u{=uzD.E} t .@.y:P@.1e   .@.y:P@. .@.y:P@. m=D.t*@.+4+;U~xuH@.E xuE E % .@.y:P@.}u C< w .@.y9P@.s[ .@.y9P@. .E#E PVu R<.pZ<.<.VXU .x@.H @.U>9H @.U߈E {~=u}Eu V[X u. .x@.H @.U8H @.U߈EE RutZY@.+4+jPHP uމe[^_]UWVSEu ]=Ơ+tD.P <.4+@.0+.,.(.P.Sp XZu&@.=.u7@.. .@.y7P@.@.+4+P4$. .XtCh .W+$.$. ._XÀtS5 .q+5 .eYWjp4x$.$.XZh$. .tNFe[^_]Ujju54+@E 4UWVS$EPEߋ5@.+54+hREС.H.ZYx@.6P@.=4+V W]S|4@.+4+P35.WݘEԉUS44+@.)Љ@... u6@.uuh j5@.c@.׉Gu}"tj)PV[ @.)O@.)=.EЍe[^_]UWVS] =,+5<.,+1}DPuXZ@.=.uk5@..=,+5<.u54+}t }tGwE8tVh"hl+Rj("Eu<"PSE)HPh1"ӤjVS连+@.5@.).e[^_]UWVSu=,+<.,+EvvE%HPu~XZ@.=.uf4@..=,+<. 4+}M }} }t=9s@UVWQM MUt <CÍY9s16UVWQMM MUS9st{u8u@@9wsS맍Y9rVSQM SMt9s{u8u@@9wsS뼉A9WVSQM u;Mt;uCCӈ)ȉ+@.@.).I9tKCCG+@.@..x C@.2P@. @..e[^_]UVSu]S0F <.4+@.0+.(.jvX.H. x@.72P@.@.+4+PA/ju PES0Ee[^]UWVS} EHPh1".T+pVP[^yP}T+H Y J1;]}43ZCVh"ґT+pVP^YyP!T+H [?J4T+pVPYyP܏T+H XC;]| J1e[^_]UhK"ˠUhK"辠UUM П+t 9PuH]Ë .1-П+B t xt 1z1. .UWVS}u ]0.@0.П+z tj-П+J B ZB$B .P.P.P XtK =.5. 0.u,.t e[^_]Fe[^_]UWVSQ5П+^ 0.@0.{t-WRUJZtUD< t< u H+Hg C.C.C .F $9tS޲ X 0.u,.t e[^_]駞e[^_]UVSPП+B .tAu x6 .xzh+Uhl+K[^=.П+X.hSП+pc yu..Bd8tП+xuO8#ujjjd xtPjjc xhm"Ym.П+@П+B..BÊ5П+V@t tBV+ . .1ɅtPCË5.V.+.H.u=&+tE5.M5P+ыXZE.P.~e[^] .x.P.U=~u! .x.P.]]UП+.P .P.Pԟ+Pj8~)П+@@ @$@П+XUVSu] 0.@0.h VqjjVbtjП+@~PqZП+s{uh(CX..ԟ+ 0.u,.t e[^]Oe[^]UWVSĀu0.@0.jVaY[y Vh"薛ÍxPS3{_ZuE%=upjjjS u]jtWSl` u"jh"Wg uSjaVh"jjjS薎 tSIaVh"So^9uS-ahԭ"u Pp0.H0.ZYu,.tAe[^_]UVSu]0.@0.} t5.VFZ..ԟ+ 0.u,.t e[^]ߙe[^]USП+0.@0.CxPoXCtP Y{ t^П+S覭 П+P .P.P.@ԟ+0.H0.Zu,.t ]C]áП+UП+;Et!=.tG}.t h"舙Á=П+.uU=П+.u]U}u$П+@~PnП+@XUE9 +uE +]UWVSU.)i5rO9$+t=.}1$+!߁9CtF9u }t}tVǁ[$+t?iӀu.tiրu$+$+XZ[^_]UVSu95.=.0 +tPmYjhu!S] +[Z@u$1SvYuCuASNa +Z@t5 +l +h0 Pm5 +h.yh"萇+X4`;.t jj蒄[Xjjzjjzjjz_¡.9t Pj辇ZY@u/0a hd5.5 +6gY[@04 hPhU"{_¡.9t&PjX[Z@uɖ0 hPh1"5.5 +fZY@u蚖0̮ h5 +k +jjyjjyjjy5.e[^]UWVS]u+.i5rOCSh}"0.@0.19~Qi@tǃu=uFjRZY@utP Ph"袕9+.i5rOCSh"}r+J΃utBƃ 0.u,.t e[^_]鬔e[^_]UQE0.B0.9tER薨 EZǀƀ1 0.u,.tDUWVSTÉ։Mt&uPh!S KE:EtM }~EtEtPBEMB;EtMt'Et!ǃt=tt t tM IuE0u#E@VYEEHEuE9u]=.)i5rO $++9t# ti1;J-R@Ph߮"jEPh!jEPЃ URZEUt%‹E0h"jRU衃URΒǃE@T=uh"ROYXu*tQh"jRUfhE%jRCTu =t̉UQ j URP,E@Ut$R>Ǹ@)$D=Ph", U:Plj$UR܁XZKySP Y P G~SEP襁XZEtP}KySˀP _ P KyS詀P|YFP|:}M}tGPhd#S iEM0EKySKP Z P EEE~SX?e[^_]UVSMt$t 119}/ivtC䋉1tJiD} u&ƒuu=tă[^]UWVS utJ>%~W+[tW&+XY,"6Ft~uL<-tF<+t<,t><%u:$+ "$+i."..E1MxdtS~JH~?u(UFPQMRYZMUt UQW1*YZUu뗅,"V*ZtV#*..XJxӀt~i90tF΅x+9.~#i.t"<"1ۃ} uVP؍e[^_]UVSh3"j4X=.tYhJ"rT+HP}T+H YSb.Z8P.xj.0Y^u hZ"`:P+.i5rO@Ph|"~ 9DiPhd#m~FXZՋJ ;1e[^]UWVSS111Uh"L3YUt$jtptguܿպξǍ7H~h" .tyt h"sUjPXZUt 1t+.i5rO@Phί"t$Ph!}[^1tHi019i0h8":}T+BHBGYYy0R{X9H T+ MAT+ M9EMeE AEre[^_]USE.t Ph,">jPZYtۉ؋]á.u!. .Jxu 1øUWVS=.t15..NxtS_...J0.B0.uhc.\iPMË..i߉^19~i9uFP轞 .Z.i.1ɾNtBBt. 0.u$,.tFt 0.@0.fǃ=+Ѓǃǃ.?} ~iE P,X 0.u,.t襉؍e[^_]UWVSu]=.u.8..SSsXZu .}=+tpt u -8Wjz^X}u-W5 +YZY@u{0譡 hPhU"]SjlSjl*}u$SjsSjstAt8t$=+tSjlSjlSjxluI.=[ujOjh$*N th$h"踈}uke[^_]US]U M=+u1tЃuEM E[] UWVS}t EEPu EPǃ u(8.t0.@0..E1i.E9i‰U܋UUEE9Et}9uOH%ʃu9t1}@ƃރ}tuދHtʃutEEi}t$E@9t}t 1҉t]u tK=.t =+Ƀ;u u EttPEuP+ 0.u(,.t߅}upe[^_]UWVSjjjà ~ jjj=+tQCtN5 +`V0*^9t7&*P5 + VZY@uօ0 hjPhU"踅1.95.|btPu=.u>S`X5E t t&tt M ڋEF떍e[^_]US1hԯ"*Zt$ltptZu⻀ۻԻ͡.u t8t Ph\#U cjL Y[=+u =+u@t4j.0‰١T+.P.YZxuS5T+?XZ1]UWVS,1Eh")_t)ntput hد"6.Eȅt2jjS|x uSh"jS[Y^t Sh".EЅt'}uE.8E. .=.Ix0}t ?uǀ1jPXZtpu}t@u7jVZYE؅t j7S} =+VXu EЃu܃n.8t}E E؉E؃e1E. .ME1Mx2t"t uE2uE̱ɄtẺE܋E܅U܊9t}tPjRUY_E؋Űt3u/1҅tHi4h1"j}W"E܀uPZ}u}Mt}jWS{ o}RIXtHEEPjj @u l耉EE܅r`E؍e[^_]UVS]Iơ0.@0.ujSj 耻t-V5 +PZY@uĀ0 hDPhU"覀u%+.i5rO;$+t \jS>Y^ƃ=…uutt tjVZuSX 0.u,.te[^]UVS=.thJ"jP-XZu hZ"Ph\#pY^9~iPhd#oFXZ١T+HyPInT+H Y J r5 +nO^Z@u>0p hPhU" 0.@0.SSá0.H0.ZYu,.tj~؍e[^]Uh3"T$X.US] h3"5$X]. .uPUS..9|:t%uh"hn.X A1Ë]UWVS]fE =..E1E}sF~<}%<T~<w=$"$M"9<=<' Pހ<\sC1s[؉] t3" t="0 wFF" tJ"Ӄ8t "B1t)&E}{ uwsr)-~&t"g}taE+UeuB+<}uU:E@{u)EP@/E\U"S" $["1GGMt tBBujt }t"MGE.=.[^_]UWVS]=.;$"j"^sh" shm"[XZshr"hw"Xhw"[Xust4vZX>t hz"c_6jsejs [{FE".h3#'sY[E-~&[h~"sh"s{ th"s XZE"h!h"Xsh"sw Eɴ$~h!ws oh1"ejslh"Qs0h":Cp/h1"%s t9vh" v ; uh"h"_vE"sYE"CEa"1d"%1S"1g"1^" ;3$S9tRh1"j}W)jW[VRZw,C y E!"4Ph1"j]SiS $[ E°"Ew#e[^_]e[^_]UVS]u t0u h$YSZt{t h$X[̍e[^]UVSEp5.=+u=+ۀj.u QX=. D....e[^]UWVS}]5.t/1}t3=+tޅttVShYX}u(+t?Hi@@} t u P XZ؍e[^_]UWVSP]u }tu,EjWVSE#w0 PhȰ"wPWVSe[^_]UWVS}t P. =P.dPXX.u \. p.`Dž\\9P.~jh<"`P[à u\P.dP_OP^;4@8ux/t1I@xPSZYyEE\.\u94.E} .uٰ"e1t:t@u=.h"SH^_190+XX4+5.߉SeP+xWPYyPdP+H X J EЋUԋ\..\je[^_]UWVS}uVY1ۡ.t=`=+u3t/j5P+jhl+c+1PkFZ=H+u?1{=+urXu=+t`=+tWh"dXC+t'=+u1҃=.‰.jPzY[1V評Z(u̕VTXe[^_]UVSU:0.@0.jR9Y^x jPXZ 0.u,.tsx=+t01=6+t 6+1ۀ=&+t&+11j薕j\j舕 =+tt6+t&+e[^]^e[^]US]0.@0.jS8ZYxjP0.H0.ZYt Sh"gs,.trjX]Uu}~E p P`^1Uu~ Zu h>"sUu uL ZYu h>"rUVSuVr@$VPt؍e[^]UVSEX90+}]ށ}0.@0.FPb8+P4+50+8+0.H0.Zu,.tq0.@0.54+4+)0+ 0.u,.tqe[^]UEuj hK"j5ZD4+)0+4+UE8+4+P0+P.P .P.]US]0.@0.8+9t8+P XC4+C0+C . 0.u,.t ]p]UU0.@0.B.R~0.H0.Zu,.t|pUWVSW 0+\ k0.@0.=8+54+G9ui.ta8+CPW¡8+8+J 4++0+.0+.^^t5;8u1H+pp X@MSNjM4+0+X 0.u,.t e[^_]oe[^_]UE0.B0.4+)0+ 0.u,.t]bo]US0+,+x&~S54+P]K.4+ 0+.4+؋]US0++.x0+)أ.4+[]UU4+)0+0+4++U У.]UWVS,ME 11˅t MPnZMwDGƋ܃}tE0v hV"nFPE0u _E1t0wLG VgnYMVuoMM̋3XZ̋EЍe[^_]UWVS81EE hs"EZt/}pt}rt}duܡ.EЋ.E뿋5.>u hy"ntjM_t S^5a[jh3!ekEZYuE8&EP4+0+._EEEjMQj2 HU߀\Mu3}\}u,jQj2 H} tU߄tA:UtwtʈUQMu9ZYt֋MQh8&9ZYU}] .xC XU߈+4+E16E=.u2.#;Wu9ZYt*Wh8&9ZYtKE4+9s}~}tjuh3!ef j54+6Sf jh<"Pt} . .~u&EI .xC_&XU߈MMh3!6&ZYMu0I .xC @+4+PE[)u.j54+6~e 4+0+.EO2EPEԍe[^_]UWVS1hXd#E^t0.@0.jZPZ0.H0.Y[u,.tgj.1rErƀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD=wGuD=xGD=EPEPEPh"ZVhı"ZXZ ,DHtI11 MqЉvShʱ"$MDЩtB:uυt Sh"iPq0.@0.SXtҁRWW"} 0.u,.thuli0螁 PSh "RiҁRXY5T+WZT+@th#"#YXEEe[^_]UWVS$f1Eh5"nEZt*}St}at}HuMփMлɋ}ľ"F9t >uWhܲ"h.8}ԅuxt h^ th}uEhl!u&#[_}EEGO/~998;Eظ ErRk] eڃ0ӉM؉]뽅t uhX"L^ 1RShj4";EUs uhE" }E}uE"11EPC P sCP3hg"WEEEt u}eEt u}euu hl!WY%C 1RPWVr!ƉRPh}"nW } Ph$TWXZ}u ;I11ۉM؉]܍}WF P) ZY@M؋]uf0~ Ph"EE}tREtM]tM]WF PV[_y]f0~ Ph"Df~ uajd./tM] EtM]uu h"mVY!F 1RPSQL RPhS#LV 5T+dTZT+@th"UXEEЍe[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]E0 w9j EPS`M t#9t9uƉׁvSh>"Sh)"de[^_]UE0 w @8u1]Ét2USe+t1:e+uf+@uf+[]Èf+U+P#P+P9XZ=`.tM=֠+uDSPcTSP+`.lSXYH"tc%jPhV"^ UWVS}] FhZ"S_$1ۃ<`+u,d+Rf+"RPhr",TG"CuġT+HyPwRT+H ^ J 1ۋ`+t# ^tj>Yt + =+u=+u+=+u ++.=+ut 8-u+1B.X.P..jP.X.XZ=.t6빋u hӳ"^H ..Pt......1ۉ։B9tt 5. .e[^]UWVSQ}~h"#uE pZ.9} h"]0.B0.)أ..ljNx=.tE7`q XEy1ۍ .1u. 0.u,.t]1e[^_]U}ujjjjITF0.@0.j.Z8tPgX 0.u,.t\1UU0 w!j jR9 Hu..UWVSuEt;uLu+E@1ۿ?A8-uލXxtՃx-uxtE8tduNE8:uUEjEPh"Và !Rh"hl+Ljh"[1۱?Hx:u뚉떍Kx:uk8{u=u=E:u$MUEjEPh"OVà M^Rh#"|9uUjQh"Và 1MUjh3"h"Uà MU+E@1ʸ11ɈUU Ph1"j MQKhMQh:"U ÊUUEjMQu U( t E,NjZe[^_]UME  hA"ZP u.=.u...h.h.RppUVSM.t8u;.t+8-u&xt Z.x-uxt @u.1gtp8tuRhd"8Yy:u܀y:u-xu.H .0u Rhw"Y5.15.Ѝe[^]ËH+z8U .x@ @H+J8H+z8]ÃxuUSt Pm XK]HÃ8uU@8u]UVSƋXCF~h@0XAf@ fZfXfZfXZfXZXRfPȍe[^]Uj@H+JHR P UPUSUJtXxv-u~u C $t hK"H+B0+B8PCXe[^_]UWVSԟ+E3=uE8t hȗ"154+0+.} t u Eu K9E@EŊt 9u uԟ+H+PP GӁt uu -j+}Wu, .H}t .R\uG.x\F tp\.à u! .x F Op ԟ+9 .xF /p uԟ+߸=ȸ=T F>ԟ+H+PP .xF @4+)PfH+Xԟ++Ee[^_]UWVS@} H+B ]urVUY wVhY"Vhq" 4@"h"j"SESTZ؅tWh"}xM4@"h"jPkESUWVS]S50+M EZY94+ulPYT_H=`.9s<wDu 9wMW5\.d ZYt%\.=`.M܋=\.5\. "͵"Se[^_]ø3"H+ztLUS`.tt"u*3"#4. .5ԟ+P`.ZY]UE`.jZECU茶\uH肶 u"ԟ+H+@8xtjjX jjh  ?UVSH+Xt@XCx tj`H+@ ZH+@8ԟ+P0 .x.P.0ʳƃ)c t,~tŁF $`" ԟ+H+PP @\ |td;\=t < u?&uH+@3轱H+@Y|uH+@肱H+@&t;u,H+@ H+@ ,H+@H+@tH+@a6=t0 u9ԟ+@ԟ+H+B0ztjjUXH+@衰jh"Và ؍e[^]UWVSQáH+@tul =H+,uyGEt7"t,O8uQPP YZu"^_8Et2jw7XZt ^SP4$PS Rt H+@؍e[^_]UVSH+p$ t jjH+udX(x,u{ upV8Zuh"P: uBPVpH+BCYt‹(wjpV P0+P8RF Xe[^]UiH+B]US]R9tjS]UWVS/t u%mj >8XpZʡH+@؍e[^_]UWVSVH+@}t11NY"t19}}H+@};uEuPw C'uj yX@[Åt^uj WxXY\j :VPXFZƉ9 }uKd[Ew9}tt8H+@6"}t jj H+@؍e[^_]UWVSdEӉMH+@EE8.EuE+4+]EPZt>uY_Et EP` ^EH+@E8.jP0.@0.EE}~uE[E54+NjME8. 0.t }u,.tK5ԟ+=4+0+.H+x tjYH+@ Ã`u8 .G+4+~PY4$jPN ] \t=H+p0h-"豮à uԟ+H+PP \ta`t\$tW.HMIMMDt"t/.x\G%x\ԟ+H+PP " .xGWxH@tjQZH+up1t x@ԟ+EjXԟ+E}tdt jjHH+xjYYp}t:H+@0+;E}4+.}tMߋuME).0.@0.u] E0.H0.Zu,.tIH+MHE8.E@EE5.Vfxu@tE.xC @]+]Kx< .x@@.xC @e[^_]UWVS]U DžlDžptH+ ԟ+H0fDžz"t fDž~ fDž~DžhfDž|fDžx@8EfE=4+0+.lDž`F|"u ǃ=.NjFP< $""fx"u fx .Gdԟ+H+xtjjZXdFf@f(Ãx[T."jO tn@=(@#$Ė"Džd'0dPЃvD\ԟ+H+     \PЃw \讦@;w`u hn"\u'dƩ\du ӃLh"ϻ?u6Džd Džd11ۉ\v@Ѓ \w \)Bw \Bw \ A;dud(=w h"#=. ǁw? .?ˀC< vG .GG .xwj . ?ȀP vW .WG .?ˀCJ< w .JB .y}w= . ?ȀP vW .WG wn .?ʀB< vG .GG . ?ɀQ vP .P@ .  .?ʀB< vG .GG .?ʀJ vH .H@ . ?ȀP vQ .QA .?ȀH vJ .JB .?ˀCQ< w .QA .zh" ?À u .tM t)='% \u*=uhK">ԟ+H+xtjjMX븊Ÿ" <w .G .fxt @ .G豥=u ._\N u%ԟ+H+@8xt j[jVHtu[y>ud|ud&du y1yt|&dd@H+j+C(H+@(dHԟ+PZ-H+@(u @ (@ dddxH+dH$ H+@ eH+`H,hP d H+xH+@ [ N(\u5. .FDB .B"dGjhd5.H\G{t ".\+=4+X .X@Džd{Džd#Tdǃ}Ttq"us,DzuftC7}TupKTcd.e.jjhd.T T7TDžd Džd "t5 .x C\{X\"uuQЃ w= .x C\>X\_dt:@Ѓ v0t .\XH/{h" .x{=\x=\duh%t8:t#u3DždQh"ZYÅt뿗"X\\9uC4͙-d u}t h"#讙dDždFfxufxt dCwd@d ؋4+X rƋ@f@f@@"@'uAV|"u1.\Ƌ@@Ÿ"f@R.\$还M .B Ƌ@@"@f@e[^_]UWVSRH+1ۅtXC1H+0x tjH+@ XF8Pv vS‹FP U8tSjH+p蝝6jh"PH+HUJ@ B ӝ[e[^_]U'Hu)]UWlTX8.ph6+d(.`}1H+\DžtEP=YE8.(.EH+Xjl褜 :jh"P H+B t$Tt=+ lttDžxDž|RUX}E6+jjxPx 4+tn\H+d6+hZp8.`(.4.u jp5Džt3"u^jz5Džt;"\H+d6+hsXp8.`(.tu ltt}UWVS H+@E} H+u@$x@@$T"jjCj5jCu;jF EjrUBjj^UB뻡H+xu j?F Y F @jkj BáH+x $CjjCjtH+@M uH+x,u p+Zu hS"|j H+PS @0C>H+^x ubx,u\h%pZYuIu@ H+up0OpXUS@PvjjlHuE >j+@@+@ @H+J0HCBHYvBH+@ttjjjCV%H+@^Xj H+B0+B8C j H+p0_C5H+ ~ uh%vZYt h%CEFH+xjƋE0FEXH+xuH+x  jj p0‰EEUH+@Yu UBE밡H+xt jj@0FjdF H+@>Zt-Pv jj u H+@ FEM@}j jCCZYtNjjX=+tt3jHH+@X&}tH+@uWhY^Xjjl H+u@$x%@}t"t;tj gXZËEC؍e[^_]UWVSS} uE EE1]H+x H+u*p0ƉXYtաH+ptZu1뿋H up$E0FEh뢋}O9u} uyjH+ ԟ+H4^SZYuhi"Svj/v t h" H+ԟ++A8F FH+@4S@u} u jjnEj @EFE F H+@0FXe[^_]UWVSPH+@1u=+tt h"[GܡH+@YZuYj 聼@EjjËUBp^XUjQC YUt֡H+@tj)pZƉe[^_]UUH+@@PtjjXH+@ t/Ht3H+@jH+Ytrrh"G.H+1U11ҋE]'UU Et 9Pt]UMt.tPt9JuB]US]j SCU PUPX]UWVSuEPY![y h˪"-~WQ-Z=wPWu ]jjj膵 uKu jjjjjjjj$jj SvubjuS Ee[^_]1=p.UUE M~t E@]9 E U] UWVSu] 9t:S SV  9t,8V WD PSh",V X؍e[^_]UWVS]{t97Gu p.} tWy P X PRpZYW? XCe[^_]USt.0.@0.jSt.S? 0.H0. u,.t ]Y+]UVSt.t/}u jS8ZYstFxP X6͍e[^]USL+ @L+ L+ ~!CPjj6 x P Xڹؙ } l.]UVSul. ~;d.|y5l.j V à x 9t(St Z 0.,.'WLXu~Euy=+up9tZPSW y@'0W V@ PShƸ"'.'j0(PVh"WUjjWd I19u>e[^_]UWVSÉP_u S>Yt uhj jS XZut-'0_? PSh"'jS ZYut'04? PSh$"%pt @e[^_]UWVSSljWÃ}tWh 5T+ E3"tEb;!`"T+td#GtQuhZ$RW҃!t#)t7Qh""R u1ۃ u u1h4c%5T+tYX 됅ttShC"RY h4!5T+FXZe[^_]US]5l.j S ucl.CPj S tCPj S{ u0j j Sg ujj SU u hI"g%]UVS]t4l.9C|sXƋCZ9tVPSsd s e[^]UWVSuU 1E E1E Et}jȱ@t.=t.[]^9d.[vaSYES[$4X}up.u EPVK vu9h.}h.9^ uSYu S+Ztj jjS y'$0Y< PSh" $S UZ9US/ XISwZYO0.@0.=l. 4l.h.9}@PjS ƒ uyE#Ht UtvE5l.jSI ƒ yEf#8ujjS, ƒ y( G#8t=#0o; PSh"xjjRU URSW0.H0. c,.V^"L}t T+X+}t P+X+e[^_]UWVS ]EEp5 ,EEh"u S tl5EС ,E)É]}"h4c%u ZYu}^hq""E뉍x+t-tPh"EE؍] EE؍]W!^¾`"N9r-RUPW_ UuF ЋM!h4c%j] 9d.}u}ƒEE܋ptWVػ_>0V YvVhǹ"!Wh>"}uSE9h.|jM1ҋEEX5T+kXT+@u1h*"XE M܍EW~mF^9h.bs%@Hsru,1UPjS! @Uu> 0p8 PSh"> !9t'WjS @u008 PSh "}j 1}PMZie[^_]UVS]u M1P1< "t#KyS:PMX Pܘ"<u~tvh1"Su S4ܘ"ZYt vQuLSh!HShL"@F y$KyS P-Y(P-Ph1"S Sv1XZe[^]UVS]0u&=.u .u0.t]=.uTY=.uZ.tO.8tCt>..@.=+tu0.u ,.0[^]US]"t%S^ZuSh1"j h. %.]UVS]} t"KySk P ^ P VPh\#S  t?uSh4! ZY"KyS P X P F@ue[^]US0.@0..t8tP0 X.u. 0.u,.t ]@]Ë.u.t9u=.r 1UWVS}u =.u.t 8=.…tlugtQ t'tE^uE=+ۃ4=+u0=.u'=+=+ۃ u.uTEPjW @}ty tB18=+t Gvt=+<u 9uvPWYZ@tju.u jWXZEEEEO>v  DjEPj e[^_]UWVS ] {}uh7&s^Zt K}esh #VbZYEh"m j5T+ FEshN #V!ZYth, VZYu81~pEE{M}u$}udh" [EEh7&7ZYÅLM}t }@ }1}ub11ۍCtA.u6u h" XSPhq$ G ~ h4!] X1C@ut h4!F X11.tB.8u6u h#" _V>Phq$ C ~ h4![1F@ut h4!Y1ۋ.t7.8t+h.".P&SPhE" C@uEw}a}t 1EJ=.}Qs}}.t.Ph"Y^QM.ZMt Q踲X)h%QM0 ZYƅtMQ荙Xu?rwh7"5P+ h.".Zu h!" .P XVPhE" AFuui0.@0.t SvX.t.P* X.t jV^X 0.,.E7[[;-u{u1ۃ}E5h!"VZYE<1ۋ.tH0.@0..P* .Xt jS^_ 0.u,.tC@u.}EEe[^_]UWVSuu .?.tJ8tC0.@0.1P-.PB0.H0.ZYu,.t*Ouu e[^_]te[^_]UVS]u .u VSYX.<vjSXZuƃ.e[^]áP.=.u t8u1UWVS...u@@u .e[^_].=.u.t.}W55P.SӡjP~S>( 5t }sW55P.Xa@Ht .tUS]9.t$jjjjjj.]USXE=.u'=.t.t EEP...P..tEPz[u Eȣ8.EP_Yt0.@0.EPFZuR;Eȣ8.=.uԋ.tʀ;tm.jS1[X몍Eȣ8.j{Y]؃EEEEEPjLYXjSPXZEEEEK>v  DjEPj ڶSP3 XZ5.FU.E.HUWVSh"PwZYj'V_Zu <)19ˉe[^_]á0.@0.+t4UP% ++X 0.u ,.t 0.u,.tGUWVS} ]1~SWu ~)ÅE u F ~ԋE) 8tÃe[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu.CfKS u>0.@0.s͝C CC0.H0.^uV,.tMBFfu9s0.@0.6CPR蝝C S)S0.H0.ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9P+u]e[^]e[^]U5T+uXZU5P+u~XZUPuu EPwE u hQ"uPJuK# UEPu u UE Pu5T+ UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'V]_Ztt~tnh|"VZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h"VtZY<tBEt9KyS'P'X P'E E1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\_ P\KyS`P'Y P'1}D>;,KyESJ 'ZE J 't"KySP'X P'9P+u]e[^_]ue[^_]U5P+uXZUh+Khl+AXZU8ruPh"Ph" UWVSSEXE p84+U0+.j=SZYj=VZY)߉)U9~߉t/xBC .I .<=u)Pڅxu ]e[^_]eUM1Au,.+.Rqq hƻ"jh..UVSu]t t;E u1Ʌt911"Ft;U t"u1@t)[^]UWVSS11 .FtYuƋ uPGEY1 .t5Nȃu$Ft sVЉZt F6ǃuEe[^_]UVS];uE+"e[^]hλ"S=ZYS# Z9u;Sh\#j'SY^ƅu+Sh6$XZ/<'uh"sXuS)Ph"} e[^]UWVS]} sSt$CtS҉XuEsEt Whr#(Y_}t5uhr#XZ$T+Jy Rg T+z9 _F>=u y:Cu}th4#"FPZYT+HyPT+H X J e[^_]UWVS=.u. h֕.Y11ۋ .tJG} tE t8tEt..9P5.讕.%.XZ.(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$T"SVDzY[SV跲_ZYSV課[^SV虲ZYƉ׉11 lj։11 ylj։91lj։9slj։h9(Ulj։J9PVm^_xPSmZY04]E9uc9u_E98PVl^_uWxPSlZYuD04MU9u9uE98f9]PVgl^_t1PxPSPlZYu鋅|9u;xu͋3U 3E r>~u5!uډx!(u;)u{u ?e[^_]UWVSu] hI4$3j_Zu#NuxtP*zUWtYu UR,DPtÅt SvZ@tM}th7&6iZYuMtEE8%u$PfX6hz"PY_\j EPuljыE 9Euy<8u t-u u3"9uЉM8Mt!뾸#uPh" EGSWf YZ@u':"|]K!RPh*%^ Etu jW( XZMuUVS@y....w5;6tj=S蘽YZt j"SXZδ Ph1"j@]SbjSh"j h+h3!(j h3#h:"ƒ H"tc%j PhV"j,h"h("j h3#h6"$e[^]U=4.t..VH+ .4.<. .=t.t T++P+l+d+tP d+XUjP.XV(+.`+Yxt@j0.@0.j~XZ1.uƀ.@@u 0.u,.t$UEt]UVS]u tVs XZe[^]UVS]u  "$@"Vs [u CEe[^]s VDF4$VsJVs Vs[Vs GsMVDF[ ]VsVs C[XZD[*uFEEhC8"VXKY_EEEE8.u)px*uEEhC8"VK_ZEEu Sh$"H}f?f}ʋ}G}"(u"Ywt"(u"7w>"wt "u"%=t)wt=u&Q"=uY" M"U"" r"w rs9/" r"v޸"sqwr !"縱"r"Hw s" r"(ws"r"ws"r"ws"r"uSE"";t3C P3hL"jd,VV 1F1:1ɾ"$t VF8t ($hU"j ,(PFmPhU"j E(P A u,P6EP6YX1Ƀ Yt,P6EP6XZe[^_]U/sPhZ"h0,mjU0.#=4.t"PRPh"h0,9jUWVSQÉ;#uCj EPS- 8t Sh\#jƭE8tWSh"j腭e[^_]USÊt%<#u#S蚬Zt@8.]UE E EE]؇UWVSÉU}utj VS @t E 9v 8"u"3O;t)t:Et,fDB@fO1e[^_]USÃ=x/t =d/t?|/9t6t2"tB!"=tB!QRh"1 |/x/d/]UVSƻ"t[PVɆZYuICƒ//C/CD.C 1f‰x/te[^]" Vh"j輫e[^]UVSÉ֋t8uVh"jURM1ZYZtVh"Nh/XZ1EEe[^]UWVS11Dž=/~ Vh"XZ1 RPhSv =t=/Vh"k f}Ut=/Vh"[^1ۋh,hv"GtEa6Wh"h,vWh"h,F (to-!StZYu,jW11ҋY_/rhP"SsYZth^"SsYZu,jW11ҋ_Zr/$hk"S{sZYu0hW11ҋY_2f/h^!S:sYZu0hW11ҋG_Zf /ho"SrZYu0hW11ҋY_f /ahy"SrYZu,hW11ҋ_Zusf/$h"S{rZYu(jW11ҋY_u9/h"SBrYZu7jW11ҋR_ZtSVh "X/a<w{t SVh";=D.rSVh"vjSVh"HT/h/X/h/hA"S ZYÉ;uVh"`[^Dž"RY ߋt uvPSR> u["`/R衵ZÉ;thA"SXZYÉ;Džh"Co,DPt2hP11҉TZYtVh"HYX Dž"!v#SVh"h0"Dž`/ /Ct<H$"2{ //C h/h/17CfCt//C h/tYvh/t217CWK/h/1&h/,Ze[^_]UWVSS1۾"<"tCtiEjSEP} th_"LY1@E h? jSPp1E4FZ9uuXe[^_]U=+t]P]USÃ=/=/u1҉t%Ph/}XZr eu=/t =/tr -!Ph*"P8 ~;$u ~EPVQMXZ9E!M|\us11t\Uh~&SMUB 9}Sh\R$MXZ]e[^_]vsUWVSu} EU MahG8lG,p1pd1ld1pPQhJE!j@tPbC1w,pC1w8p1w,PQhJE!j@UR+0URtPhhSE!sQhhaE!VC uӔ8t/j|k} tu Sh"5 Sh4L&5_X뿃} tu /Ph"}5 벍/Ph4L&g5[^띋$t $PYPܧZ}tEajPS yh `"5X;ƒu)t"=tRD$u h! 1e[^_]UE/E /]á/á/UE Puh0,h0,j j蝕UWVS]y8ށu=/t5/h!YX=` /t%=/u5/h"ț` /XZuu ӏ ZYyWFPhD#蚛 t7=/t.j 褚X=/t7P5/h%"cjڔe[^_]UE Puj$ UE Puj UE Puh UE PujjuUWVSxu/Ph7%:_ZyhU"[khWVW t Ƅ1҉|PSZY|ySw%=` 9u;u/Shh / ǃ uSht"Y[xPWj[ZyWhd"ً%= Wh"뻃= u+t'ShWg t úSh"놈|Su\Yt?|t50hWd u|h /h\#0XZ|랉e[^_]UEPZtPRPh" u uh"hh /躗 /Ud /tjXj gUSEj0h`"j T h /jjue]US jO(jjKejjBe]UWVSÉ֋x CPww wwփt= /~j 'X /e[^_]UWVS/// // /Dž DžDže[u/h"h"![^Dž SUYuhYÅuN3hVb ǃ uVh\#/XZ PlXEtVh"I Eu {u{wu"Wh"h0,ޙ DžQCC jhPjV輂 Ãt%$Phzd@So @tS=T YW趍ZD ,9wDYt)PH /t4KRWQp u <tXȉj\j Wi CC C CC/C//Y_{ t%VwGYZuVh+"XZ?ji VGi G9i G +i GGCG8{DžEtDžH /Eu/} u:E 5j %^tshG"s _Xtvhq$ڔ6M 9~= / 1;}1U% tE 9}?CNj Po Yt5 /9F6냽 tr/qXd#:u3"h"Ph"h0,֖/<G";u4!Ps ssh"h0,蝖W jsVsUE #9  Ph"XZ ԉg^ EtPs sshP"ȃƒt.t&Ps sshi"h0,螕Dž StPVSt$/C/ snsfS` F /H /~ ut /;;/ /?uǃ tuU E t19uUDž e[^_]UWVS]fU ffCffBCffBfCffBs s Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss9Y^} GWss#Y^GWs$s Y^G W$CDȉGDs,s(Y^G(W,C@ȉG@s4s0YYG0W4CHȉGHst ^F)ٸ;MF)fFދGfN=/tww@FXZFEFE@Pw5D/5@/ Z[@@fAG5D/5@/f@5D/5@/u uwu uh"S$}u}tuuh"k =/uj jX؍e[^_]UWVS}u w wUXZCfEE9uc/t=/t =/tj jjjw wu/jh"Wo w wNXZWD/9G u ̢+;@/thf%¸!f@t."Ph"/w wE)Puh "j=/uu=/tRyNj ih$"р_X=/t2h:"Y=/tfE)fCe[^_]b hF"XZHt/x뮍e[^_]UWSá4/p8薿SY t& 4/q0RP¡4/H01z 1҉Ѝe[_]Ƀ=/tf‰Ã=/tÃ=/tUWRPHY_}UWVS0u} }- p/t/9]K]);E4/@8]]M9/P]!ыU!M]M];E]}=/tuH!PWVhX"h4/MĉEȉMuuWV EM܉mẺUЉEԉU؁\TtC#ECEUЉEԉU؋CEU؉E܉UEUEU;u܉ECEU;EE=/uuWVh"h 4/\Tumq#uqmqWVuuh"gTEċUEU;EE}>=/t0uuWVh"pg4/uuh"Ug$e[^_]ÍL$qUWVSQ0QEU;EEsE9`/d/Esuuh"F|//4/sx1uЉ}ԉ t9E}rEU9E} 1ҍMQRPuuU u}uĉ}ȉŰEƉE؉Uu܁\Tt-CЉ!U!CЉEUuuuu K` t1Ɖ׋CEU܋ 8/tas0RP8/4/px1WVuu{ ʣ//4/@x1RPuu 8/R=/tЍeY[^_]aÍL$qUWVSQ8QEUx/|/Ӄ x/|/;Uu;EuE9h/l/Esuuh"Lzp/t/E؉U܋E9EEE`/@Ẹ`/4/1ҍMQRPuud u}u}UċEƉEЉUuԁ\Tt-CЉ!U!CЉEUԋCx1RPuu K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=\/u L/P/ T/X/EUܣp/t/Suu5H/5/蝩=/p/+EE5H/=/1;}VV|f%ZYf=u Gvdv`YYF`VdvlvhYYFhVl1tttpMYYM؉DpTtA u1MYYM؉Auv4/(=x/t<EẺ}ĉEȋU9USuu5H/5/ЩrVVf%ZYf=u+=/u"}uFV y9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡H///=//ЍeY[^_]aUWVSS4/Eu1WVu u  tu uh9"vu} 5h/=l///EU x/|/p/t/`/=H/8#KH T/=/ۃ、1ƣX/E1\/P/ډL/t@\/ 5P/ L/QhrH/ZYu h^"ue[^_]áH/tUPwkXH/H/UWVS u=/tFVFV EU4/H0AEUSQRPL  w EtE4Pb_< /RPuu W /CCM 11 MuE UCSCC E UC SEC$EC( /1E v 9vt DpTtD(D,T0Gу} w/9/ug11tDXGuP5/fZY=/u h"t//d/P//e[^_]UWVu} /RPWV  /t9xu9p tWVh"se^_]Ã=/tYUS//\9/w 3iY5/i5/i//XZ]á8/@ UWVS$Éx@t@SЉ_uDž' s ss 4/p0sszNjH4/P0@t 1;}=ƋA뻋EU RPy Ɖ9r=/td/tD1;}&G q1YYQFG W5/̥XZ;}W ʉ@{e 4/9Ht΋G=/t  T<uds sh"hRZRS褦t*G=/tDG  /F4/9ptmW5/^XC /GtI T„uA{@)EU 9|F<븅ɋtT>CS"CCuSЉYu uXZ_gE E J/CS RPRPhV裦Vh"p h"aXs sZY=/t@Si+EU ^CS@S K+EU @CS h"/gX ge[^_]UWVS$uE 8tE @0@4/tFVFV } G$W(ff%f= 4/funE H$x((9f=x/t;9ʺIu!=/t F Fu/~hu)$=/t@󥋅 󥋅s0NډWVRP. 1/ t b54/#8tk@DNL##NT t4/@8M A t`d E x@/P @RPRPhSbSh"_m h" ZHE p p^X=/4/tH0ωș!CSp0 CS h"/[BM AQ] CCE x@tPPu 4Y G 4/C8} G =/t f{0k )ډƉ׋=/t$ݸݼ tHM AQDt-M AAWVڋE YZIE x@9/E P @RPRPhPwPh"nk h"/ZHurE p pZY=/t@S<)3CS@S )CS h"ʹ/Xi4/Htș‹Љቅ+CT됍e[^_]UWVUr8azu;Bu;B0B4|B0R4B<NA^_]UWVSu^8;uUCv"NRY^=/tgPh!3R^_=/tCSCS aRPhG" R =/tC(C01RP@jZYE ER"e[^_]Qe[^_]UWVSP]u }s sgEZYOu6f%!f=@t."RVh*%gs s_=/t h\"mXhg"c_H=/u؃H/L/{@tjjjjsHsDs s蔪 SuIY^=/t /@ / }s s蘜XZe[^_]/e[^_]UWVu} WVuuuhm"fj OWVG$<t <uPv Ph|"ee^_]ÍL$qUWVSQ81yAEġ,/EЉ u1u؉}E0WVśZY8tuu讛E[^8tEUE;`/Ed/rϋE9d/uE9`/Q4/1҉M]SRQuuE EȉEE=/Nj719uE؋M6 s 9vjSUXYuSh"e[^VwRUA ȋU9s@tUwYYŰE/Puu蘚EXZ 4/EƉׁ\TtA#EASA RPh/5/4/}=/t =/t =/t54/u5/ EЁxU tU tuh"Xd_X=/th/p/^EЍxU uEЋX\á4/1RPuuM ƉEH 4/ELHh R5/5(/5/=/t/PPY[5/rg /E%Z=t =t)=@EE@E4/p8 Eh/J/uuà =/V1EЉUԋUЋEԉSpCt_ EfCXEPEUC S$C0S4C(S,4/HT t1{CS eCSV荡CC(Zu EEfCdEP^E CC C4/HT t1CS  ChXH/L/=/tE }̈GEEE؋U܍eY[^_]aUWVSX,/E4/1RPu u EEƉׁ\TtC#ECQC RPh/Y5/4/}=/t =/t =/t54/u5/ ExU t"U tuh"`_XEU1E EU EURPY^=/t@@pDE=/tCCt+E=/tCXCd EEPSXZ=/t /@ / u uJ^_}tjjjjuuuu H/L/}ExU uEX\á4/1RPu u Ɖ E@ 4/EL@h R5/5(/5/0=/t/PPlY[5/b /h//XZe[^_]ÍL$qUWVSQ8qyA E̡4/@PEWf%fEء/EЅtCSCS P4/R0Uă}҉UeEUf}t1/MىU!M؋U!U܉EU9EE}ΊM t 9|P}tFTFD1҉ t 4/q0RPS}̉4/@0 E1uEEu}9EE|M1)M}Ɖ9EE|B)uUEƋ}9EE|(uuh"\uċ}EEE}tE؋E؋DT1҉  4/q0RPaà uuWVz Ɖס/EЋKMEPRVuu UMUM}MtTEEЉU)EEE Ec 4/q0uuǏà M]Ẻ4/@0eY[^_]aÍL$qUWVSQH5/tCSCS EU4/@0E؅CSEȉU̺4/HPu} t1 9|aEEЅu E\4/@0 EŰEU=/tNˉTVDE؉1EE9Ɖ+u}E؉U;u؉E+u}܋EEԋEE؉U܋EE;u؉E|uuh"zY4/@0EU]=/tCSEȋUCCSCS E!ChEEUE؉UEEEEHEЃ=/tEċ EċDTtZECEԅf4/@0 EŰEU=/tMЉU_MЉDXG4/@0EԋEЃ=/t8 DX!1uRPEԃ uuuu E؉Uܡ/EЋEԋHMEPuuWVS NjEUEU}MtT 1҉ uiE.EЅQ4/@0 EŰEU=/tnuԋNTNuԋVE@ `EЉE$}ԃg 4/q0RPEԃ Eu}M}h="WChEE]EЍeY[^_]aUPhz"h0,@=/H/L/+`/d/ 4/H/L/ 54/NF)ڋ~,f,P/T/Ӌ~4DӋF8 $(+p/t/P/T/ t/RPh"y= RPh"h= =/y@\@`@d@h@ljf!_X=/u^4/@4 J4ȉR0׋ыg0ʉG0W4=/ACS;C\t@@C\4/J0D1Dž1 C\54/#8tk@DNL##NT t4/@8B D`Td uO/FVVV^tqCh1ҋO0_49u9SQRPh#B=/t h#譋Yh8#nZ/^_=/tP4@0QCS @05ChSx@jjp4p0pHpD葄 wh#9Ahg"mHvZY=/t /@ / e[^_]UWVS,/E1ۋ 4/9Y,EUu\TtA!A1EUAEUEU11Au}|E|Uh/UUy2EUtDžxtxUMM;uEjCHLY4DEU;uElDžplph/UUy2EUdDžhdhUMMbU1Ee P/T/H/L/E4/}9x,OuuEuui 4/E_X\Tu]e+Q#UQ1E]]]euI RPh/@q5/4/}=/t =/t =/t54/u5/ =/tE@x 4/1҉EU=@/t94/p,kEd1`<SVuPh#h0,)@/=/=/ExU t1U u E#uh/#<[^ExU uۋ}G\M]E EtIu EUJu}1uEU9}u9uuu}Et/ËE} u C<}%?}u;Et uuu(|Yuuh^#<j51|M󪋅|CEUEUlpu}9r WVXZ Ms;pu;luËu} h/l/ȉڃEUh/l/4/u}11 9E}e9E]ӹr"\Dž`M]+\`t5/ȉ uv//tD[y9]u9Mto<%?u9tSQhH#:jM]W|+XYҋM]u Wuh#9MEs+}]1VEa/e[^_]UWVSEP@EUE@ E}juu t/t`}9xuPu9puHEuuh#Ep p /qyEpxu}qy /9 /u /u덋=/98tEUMK؍e[^_]UWVSTU1EE'} $//11E4/H,;M=@/t7kEd1M7SMQuPh#h0,H%@/E4/U99swWVXZthu}=/tCCp=/tE=/tCCt=/tEWVmZY8tEPSZYuEWEe[^_]UEU @,+B,]Ƀ=/tf‰Ã=/tÃ=/tUWRPY_}UWVS( ]s8=/t DžO=/tt1;`/d/sNj}1RPl@FY_DžC4 C0J>Fh %PYZ-CS u9ttFPhr#5XZ#Pbb_FfPVT h#*bY<Fh+ZfFNPVW8fPVݹC0S4s sbjfH Dž;C0C4|s sп@XZ=/Ѓƅhh!Pd  / /ufC4 C0FxF:99F)ffFC0S41RP@ifH1󪋅fFY_>tyFh!PmYZueAA =/~h#s s+Fh#`H/CS P@ u h#RPVFD9s~ #>tFPh#2XZ#P^__tcuC0S4=/t h#2|YH@ FfPh #^Zu@@ uC0S4=/t h#{XH@ F>ufWV蘶 d+fFPVRofWVUtC0S41RPffH^_Dž)VS0K4w\~.uV;}>uh# ~ .u(h#s s赤h#]S0K419`/d/s h#=/uDž/HuT~tNh+#1RPs s`=/%Fh#\[HS9Ht~u렍P;S0S4<!=/=/ #R1RPs s転h$#W\Hx1RPݱ_Xf%f=@AefGh1RPdZY<<p<t <Q;C0C4h#1RPs sh$#[/#1RP讹XZG G;C0C4CS RPRPhPEd‹x1RP1RQhPd0Ph>#Phf#.=/t hp#wYh$#ZZH;C0C4} CS GW=/t_V@9tMh{#1RPs s裠@Fh#3ZHt / DžfHqPPh#/,u Dž  e[^_]UWVS`jjWb^_P$"h#,h}"xYY[u /ahjjjj螡 h#|+h#d,h{"(Y_ZuE/h#Y^jDgj`h#,h{"XY[t#jjhjjjj ih#XZ5jjD_X%@f} Ph#*=/tjjaf[^h\ j5/5/g1ƅDž //9W=@/tD+5/=/k)VWSPh$#h0,h@/C$w5hG#ss 莞 X/A1C$h#WW5X/VC SRPRPhWM`=/C$t5X/RPWha#h[#)*5X/RPWha#h[#%*=/t h:"sY X/C$D1C$=/t2ss AXZ=/C$u,GW v'hF"jV^Ht/ GWҍ@1=/@uufC$1C(ƒ v 9}L,G HLP fC$1S(у v 19}t,|0`d@ vHC SCS=/t`H=/td&PPзY[=|/u 5/T5/|/;s݋{$@1@=/unfC$1S(19tL,@C SCS=/tLJ#fC$12{(19tD,T0`dA㋅`=/tdPPuXZ>O_ u;r$tGW 1‰1ډ t#@tSQ[YXG GuLGWGW =/th#ww RPh!wwww MfKPh#ww wwh#]Ru/w wZf@fKGWGW RPh!ww J//49s*;ww ZGG_Z8uҋ=/9s0CS tK  KtRPPSXY[jj.XZe[^_]Ã=/tUWVSX//D/;=@/tC=/))KkdN#VWSPh#h0,@/ss YZYS  S7S St t%5/tC=/t8=/t/u*CS 9RP&Yf@1C SCS t(RPXY_8u95D/|Css~FXZ95D/|)js s+]Ah##h"O 3ssj1ƅs{DžL ^_=/tBBp=/tBBtVRSZYu h#E"_PsstQDžM ss~VPtiWf@Y[5D/5@/RWfHXZ8e[^_]UWVSHEP@EU,/E4/RVuun EԉEЋmԉƉׁ\TtC#ECQC RPh/T5/4/}=/t =/t =/t54/u5/0~ ExU t"U tuh&# [^EEx EEEjuu诠 EEEEċUEUh/EЊuuuuy&EuuEUMUMMtG5$/E9BuE9BtN^JZ$/VYEEUO}tr}tl4/E{89x u[E@EL@jRPEpp K` tPuSeh 54/5/ 5(/5/VY=/Q/PPyXZ>!ӋEЈ}ExU uEp`ơ4/RPuu, MEM]ΉÃ]؉%Ey&EE؃EEEUE؉U܊MظP/T/Ex@t+jj4/@4 ؙRPEpHpDp p6a 4/]p89s !}uF$ ]LC 5/! /h/R/Eԍe[^_]Ã=/tUWVSXU1E E4/X,;]'=@/t1kEd1-VSuPhI#h0, @/4/u1EEE/MU99WV-WV.Ru}=/tCCp E=/tCCtE=/tCXCd EP$"YftbWV蝊YZt=/WVhq#!WV^YZt!=/WVh# SEPיXZ/Ѕ9xu39pu.JZHX/RMjh"EPzQjh")=/tC CC Cu jh#jh#EP6[WVPh#@ExxPDžTPTx|xDDžx{,;x=@/t7kxd1VWxPh#h0,J@/xpDžt𙋅x‰dxƋdׁ\TtC#xC1QC RPh/G5/=/t =/t #=/t54/5//q =/u-xU tU txh#^_=/th/H/Y=/t = /u/ / / 4/AhdptЉPpƋPׁ\TtA#xA1dAId t1RP5/5/C 4/ptЉdpƋdׁ\TtA#xA1qhARPh/E5/txh#AXZ1X4/ph5/50/ =/t50/5/lY_0/\8 uǀ\T5(/54/LXZ=/th#POF^_u)50/54/,ZYu95/u 4/AhdptЉPpƋPׁ\TtA#xA1dAId t1RP5/5/Bj54/H^_Ήp׋tЉdpቅptdtpt8D<4;D4} D45/u y|@xD+pupdC,H;xu4xdf"șdD1dffDžh$~ 1s8dDž DžDžQ(9w1҉Q,9w1҉ W09w1҉$u DžlWx9sll(1󫍕HU u H1׋l󪍕U u P1׋LuxLu DžU x1Dždd9WVCZY< <<t|<<tU U u PdPd⋍P9s WVPh@# dIxuPU u PU u PDždD9pt4h/ ptPTDž<1{8;<T,Dž0,0PT P\T`y>\\$Dž($(\`\uBU u T <d 2@  /^ /=/tP}XPD  uTPTxU u PTHU u HlRP  h#\P+<ZYtwXVZ HU uH򋅀xU tT GTlRPh/N</ /=/u)xU P\19@U u P0U u W\ 2!8uF룉p<1ɋptUxU t B\0u*xȉdPh#(YXdAu1@;8=U t  G`0U u T 2!8uF띉p<1ɋptUxU t B\0u*xȉdPh#KXZdAu녍U u PLRP? txh #Pz9^_taU u PxU t G\LRPth/9/xpj PV =/tm h. #Dh#P_8ZYtkƃƃh 54/5/{5(/5/==/t/PP^ZY5/X /X /e[^_]UVS1;] s8Sht&^X1E0Phy #FZYuj XÍe[^]á4/!uUVS1ۡ4/srT =/t4Т+h #\XZ"~ #t #PY/Yt=/uɡ4/t44/Dh P5/-5(/5/x<=/t/PP\XZ5/  /^ /Kt 4/=/t h #K[h #.Yti=/uۡ4/ h P5/v5(/5/;=/t/PP[XZ5/S /X /jXXjOXYXuj^Zuj]Xe[^]UEH/E @/]áH/áD/UE Puh0,6Jh0,j jUWVS]8ށu=@/t5H/h!QYX=/t%=@/u5H/h"-/XZuu 8 ZYyWPhD# t7=@/t.j X=@/t_P5H/h%"j?e[^_]UE Puj$ UE Puj UE Puh UE PujjUWVSxuD/Ph7%V_ZyhU"[khWVg t Ƅ1҉|PSNVZY|ySw%=` 9u;uD/Shh@/ǃ uSht"Y[xPWU[ZyWhd"ً%= Wh"뻃= u+t'ShW t úSh"놈|Sڪ Yt?|t50hW u|h@/h\#0XZ|랉e[^_]UEPZtPRPh" u uh"hh//U塤/tjXj hUSj0h"jo /jjڳ]USojvjj谳jj觳O]Åt3USӃ=/tPh!YXSh #XZ]Áu=T=Tu =Tt=8 t=TuH/=tu /`/|///1f=T=Tu = 8uH=/t*/|////{UE/ /t,\Tu ǀ\8 Tu ǀ\ 8=/t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXC~U jhPP~ U CdBdPPHH8<8<@D@DHH0404shRS e[^_]USEU =/u&xL[]U E[]X9ZX 9Z X9ZX9ZX,9Z,X09Z0X49Z4X89Z8XH9ZHu{XL9ZLusXP9ZPukXT9ZTucX`9Z`u[Xd9ZduSXh9ZhuKXt9ZtuCXx9Zxu;9u-9u9u\19\[]UWVSE/ "]]h uu5/5/&Ã5/\ #/RPuu讖 EUh RP5/5/[&tWEU}u5/\Uu}uq #{=/t^=/th2 #=/t hQ #jb /=uhp # =uh #"_uh #[=/t h #Y=/t/PP\PXZh 5/54/z =/t54/5/'P_X4/\8 u/ǀ\T\T/VH4/ChE^= ~ #E 1T5/MʋEEƉϋKdC4/RPWVԔ / // =/VC,HEƋ}ׁ\TtC!C1uCRPh/'=/+=/t/PPNY[4/ph5/50/y =/t50/5/NXZ0/\8 u ǀ\T5/50/54/e tc=/u #EKh, #u==0/4/shX9s΋9tRP+4/PhB #-h(/54/+/ /[^ /t[h 54/5/x5(/5/_-=/t/PPMZY5/ //X/E؍e[^_]UWVS]u ///xPSIZYy0PSh #d=/t(jSؘ /Y_yUs0PSh #3%= tShp+!%h# u&=/t /=/t"h #YjSG /_ZySh #r// /u Sh #NXZ/@/D/ // //////h h0/ h hǣ4/h h/h h0/   ʅ ʅʈt h #tVSqY_t-/ujV _ZyVh"vr/=/u/R RjPV8@t(////t7/ / /PLPj5/SF8@u Sh #Y^TuSh #XZhw$tVUY_t%h- #VD_ZtVSh6 #L }T uSha #렋duSh #눋5/V4uSh #.uSh #uSh #[^X1 Dž11҉B~t /}Tu!H׋RPWV2 Dž\Ӄ~ ƅtBtѥXD1D1É1P1RPWV蝍 OډSWRPz h- #EY19vjPʁ}Tt!1ڋڊ t1/1u3FhL #hj #h #h #h #h #h #9v5/h#XZKu Dž4/\Tu Z[t Dž4/!/=/t!th4#GXu h\#3_Y4/ h P5/p5(/5/(&=/t/PPdF[^5/ /YDž=/t4/Ph#HXZ/t Dž4/tTt8=/u "=/u #Ph#Q^_Džc /u h#.[ 4/8<p/t/A,`/d/A0k NYt뉅׋YtӋatQtӋat=/=/=/=/t h# Yh#Z4/ǀXǀPǀh P5/n5(/5/#=/t/PPD_X5/e /^=/24/=/t h$#C[hJ#Y.4/PPF#4/ǂLǂXǂPǂ\h(/Ru h 54/5/m5(/5/"$=/t/PP CXZ5/` /X4/ tyPhm#Bhg" Hu^4/  h P5/l5(/5/C"=/t/PPB_X5/ /^4/vwh#h#Y[Hu^4/ǀh P5/sl5(/5/!=/t/PPAXZ5/P /X4/@[^5/ //Yx/54/\ 1ɋ tc{S\9tt@Bt93"u4!RPh#F\ @KCu=/uh#ZHuqh#,_=/th 54/5/g5(/5/=/t/PP-=[^5/ //Y4/=/u ,q40;u ;RPh#J4/04 =/uh#ZHuqh#+X=/th 54/5/f5(/5/=/t/PP><_X5/ //^4/(=/tx<Ph#uY[=/ăx4/(=/uh# ZHuqh#*_=/th 54/5/e5(/5/0=/t/PPl;[^5/ //Y 4/8<qH։9u9RPh#4/BHЉ8< =/uh#$ ZHuqh#*_=/th 54/5/ e5(/5/W=/t/PP:[^5/ //Y 4/@DqL։9u9RPh#4/BLЉ@D =/uh#K ZHuqh#8)X=/th 54/5/3d5(/5/~=/t/PP9^_5/ //[/=/2PH҉8<PL҉@D/=/=/N4/,=/t hA#Yha#> Z~ /4/ǀ,04ǀ(<PH҉8<PL҉@Dh P5/b5(/5/(=/t/PPd8_X5/ //^=/P4/L5=/t h}#[h#< Y| /4/ǃLǃPǃT\ǃX`B,F $1҅~K`F@ #CLh S5/a5(/5/=/t/PP 7XZ5/c //X =/tv=/umh 54/5/a5(/5/b=/t/PP6_X4/ph5/5/`h/5/54/Sh‰LY^u Sh#1׉DžDžDž 54/;+^09~ËLSF8HLNd t1RPW5/ t@ t Dž +h#h#^Zu/j =/tHSWW4 4/SA8HLId t1RPW5/ =/t SWW4 4/@0 p/t/11Qh£h/XYҋu Qh #1^,jS</Y_uSh/#=~/ / `/d/=/ȉڃ9sA// // /jPã/j5//…ˆt/PhV#"Sh,/_Zu$Shy#[^/jX4/ /=/u*t!h- #P`tZYu x/ />hSP5\/5/ƃ H/L/P/\/=LBALt[=x/h#h#Y_jjjjjS8=\/fGW7fG`/CJtejPh# =/uh8#'Zu9h#!X=/tC=\/fGW6fG`/_fCff=v]h#Y=/uh#Zu8h# X=/tfC=\/fGW36fG`/_fCffuih+#Y=/uh#QZuDh#= _=/tjjjjjS6=\/fGW5fG`/f{f9}zD3<:uƃu}EEUEURP5/u u8{ /9u/E ;}|t/EUtH9tDRPؙUEЉEeUEUSQRP o RPh#øRPh""貸 F{j ÷Xe[^_]UWVSEEE Eu}EE}/ؙΉEUMuuuuuy 9Eu/9!nh#X19]~NؙEURP5/uuy /9tؙRPh"" /EE e[^_]鿶e[^_]UWVSQƉӋJt,B=/3"9t#s sRh #C Css ssV/E14/9)r09~ƋL=/t VSSF' 4/VEA8HLId t1RPS5/=/t VSS& 4/x0Ede[^_]UEU z t]]UWVS]4/Hdu } t1`/9{ u9st7S5/d/uWVs5/Cs{ ECe[^_]UWVP@/4/=@/t+Jdu}  t19x u9pt@t@=@/uh2#uu uPE#EHJ@@/@/@/B@/He^_]UWVLU1u} uĉ}ȋEER赩Xe^_]US]E tywt1t1tmRh]#H{@uPs s? Ph\#.XZ=/thI#YhU#Zu ]UWVE5,/4/x=/t54/p5,/' e^_]@/ÍL$qUWVSQQ9`/ d/s RPhy#[5/ 4/1ۍ}WSQRPb U Ƹآ+9vAeY[^_]aUWVS\]u EUEUEUEUU3UE3E uUE u uE 7%,uu+ZY=p/u <vuE s!]e[^_]{p/U1EEƃE9Eu E9EEUEUEUEUEUEUEUEL ]uuqKURPXtuS輩)lj$SWMwG/ 9rMEUEUE Et6EUEUE&M E!RPKURPXGp/EM tF?N)Eu ]e[^_]$MUWVS]\TYL} FE 8uh`脴} ^E u h#h`SPL =/t h#Y=/1҃LJ =/uE PP"XZE \=/uPP!_X1fEfffE@9uރ=/tE PP!Y^E \Ǎ=/tE PPZ!XZ C0\C 04C$8<C(@DHLǃ ǃ Lu*ǃPǃǃe[^_]UEU \T 0H   Lu5PPQ\R\PI UWVS}u=/ //y /h/P[^=/=/=/t h#Yh#=Z=/u׋4/ /=/ux șRQd / /h S5/H5(/5/0=/t/PPl_X5/ ///^h@/5/5\/Lh/5/5/1D/1t-@/t%FS5/{sSϡP/9t )Ph6#8</8/=/4/=/t hM#[hh#Yu/=/4/ƀǀPǀTǀXh P5/aG5(/5/=/t/PPXZ5/> ///RX=/u h# X=/twh# /h 54/5/F5(/5/=/t/PPT_X5/ ///^=/twh#R /h 54/5/MF5(/5/=/t/PPY[5/* ///>Z=/t"d/ `/kdPQSh#諪/5/5h X/Ee[^_] h e[^_]UWVSQ(ME11҃}54/~8;} p/t/)ӉMЉ]ԡh/E1҉+EEȉ;UЉEE]9]}EЉEEM]H;Mt*EȉEËE]̃rAMEE䋎E؉U܁\TtF#EFEU܋,/QF EURPh/5/4/=/t =/t =/t54/S5/ {U tU tuh&#XZ=4/EUؿEЋMMh/{U tEC`؋Uu؍  0EU9Uuu5P/=T/4/MLU9P8u+KIjH`URSP U)S$) )Q h 54/5/C5(/5/Q=/t/PP^_5/ /h//EY[EwV11ҍeY[^_]UWVSu /!Ut 9rt8R}t-jXu h#v1rBЍe[^_]USM /#AUY9u ЋR9uX[]US]M 4/1!t4^Fu(9u 9t331 ‰[]UWVSu} ]9WV+ZYWVrZY/l/t9ZtjSPl/ l/M]XM ]$HX h/t}9xtju5/fh/ h/UMHU M$PH e[^_]ÅtUWVS E uV8"<}EEH89~gًEtV "E4"ߋE#E9u(EUEU~U߉eUUGE9x8}C돃 [^_]US] EUR`t(t7uS /u<<+  !8]Rhx"h#UU ME@`t+tDuTɃu:< %ЃPhh"h#zUSE MUR`t't2uCɃ)u-7  RhX"h#]USE MUR`t't2uAɃ)u+5 RhH"h#菹]UWVSu E$ EÁFl&EFhEEE}~ E@E}$EFp;Ew FpEEEp8MU;U}tуu >FB߉+}EpE$E+EEyEEPE9M}Etu EJI)΍T7E9~ЋU ڋEtE +EtE ڋ+EE$E4~FuI[^_]UWVSu]tVy XuVhpb!jrx `DžPhd@u ާ usRhedAu Gƃ uݗ8tuhb!8_X$B<CB(CB,C B0CB4CJ8KCB@C BBC$BDC({h̎$| ƹ ߋShb!Vv CPhb!Vh C Phb!VV CPhb!VG CPhb!V8 $tP. ^}=uhzd@u  @RhedAu  @uuhb!jv 41}󫍅Put ZY@4ȋ999t8Ћ}LJLJ(Eǀǀ [Eƀ*Pvj PEP1e[^_]UWVS,}jhPjWtGjPjVWV[ u$U ʋMQ؍e[^_]UWVSu] DžPVq Y_TDž%= j/V_ZxrPRV)Ph0#h0RқjPpU  10; }SRPOZY0u$PV. Y^yG =@uu`uÉDž PS XZuk%=@u4h8#h0WǚW ÉF= jX ^_1!hh X à 1PSrZYwtS+Y Yylc9u 9tԍ0P ^Z+8T8PRPS yu Dž  Dž Dž hF#j$V蒙jjVW ÃPhFSt y8S9X Y뚃}tV5MZt8PhF|@S( yhF S_X12tP?^}tJMQ41tP Yt ZxSW X؍e[^_]Ƀ=/tf‰Ã=/tÍL$qUWVSQ0EċqAQ EUAEԊ/4/x0}؉E܍EPuuuu)H UMUȉM̉E9}EEsp1Mȋ])jj`SQJ щEt/]Ћ}<u hR#O[`!ˆEԋy1FX /!9tEԋFXRPhh#t/UЋ}< =/t h#Yh#Zu /!FPVT]ĉSFPFTeY[^_]aÃ=/tUWRPY_}UWVS EԉUMQƉ׋]  4/H0ș9Ή}EE5EPWVu_O4/;B0u Exth#X4/@0RPWVSL UBEuWVPuU tUB EPE܉UM9E9u9t5MC E܋UƉ׋M9M }a ;]t }tcM܋EPEEPT@PƉ׋M܉1;]t ce[^_]UWVS0] CXƹ1}jVEp }܅tPEpdXZCS(EԉU؋WẺUЋE9E؋C8SEPuuu$K4/;B0u Exth0#X4/@0RPuuC UBEPT@PChSls}EA}GXEUGWEU G8W<5/#uTGPWTEUTUB E @ 1;U tbe[^_]UWVS4]uEz$ # E# #4/x /E؍CrE‹R RPYXJ4/wE$D"1Ut4VhH#T}t4Vhk#:1%Rut4h#j5Mt4c*XZf%f=t+4/ڔڐVPh#̧EPjjQH4/;B0u Ext*{rt4E4/D_XP=/%JXF^9t*4/ؔؐVh#=E`&B9uΠ/8BufJEf9ur=/t h\"Y#hg"Zu/t4/ؔؐ!EY_4/DŽؐDŽؔ4/{rT uDVh#}XZ=/t h&"^h"YlS54/kXZ4/t4(EEPjjucG4/Z09u Extuh#j@EE=/tP@P @u؍4pu3SQRPA EPƣt/EX};}}g4/@01҅uU)й`1j@@P谕_X1U9} MĉыU @BUEEHhh; EPUE[^EE;E}*uLph; EPUE]ZYEEM;Mc4/@01҅uU)й`1E1EEE;u  t/h0#HX=/t h#[h#Yu/M1uEԙEUȉE؉U܅uEEBEP4/H0șRQuE4/;B0u ExtuhH#蚣XZZ]ECMQhIlPPHT4/@0EEUMAhQlC E@ 9tcFE`UEE`lje[^_]UWVSMu z$ # # #4/L/E}/u/Eʔʐ&%ÍEPjjSC4/;B0u ExtVh#耢j谅MUHp1;u})hU EPMUMZZFEU9UEU4tpv vv6vWhc#=/t h#Yh#Zu /4v vv6vuSuvEoE`1e[^_]Ë4/!U偺^Ft.h#aX=/t1{h#Yujtt u h#-Z14/t u h#X1=/u tøÅtUWRP"Y_}UWVSuuuu: É֋EU)jj`RP; Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVSP]UpEM1}%JXF^ECS}tffsCCCC : 1҃}t1 :C(S,C8C ؙt,h#hp"h? h3#pU Mu)u؍e[^_]UWVS}]O,uh#h\"hO ؙt7h#h\"hQ h3#UMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}y/t5/WVSh#|SWVu5/1e[^_]UWVS] u}y/t5/WVSh#M|SWVu5/>1e[^_]US=/t h2#u?j5|/r[Zt!hg#@h#ZYuj`u5|/dX1ۡ|/9XL~$y/t@Pp0h#{ Cҋ]á|/t(Ux,tPZ5|/{|/XË|/1t z,tUu uuuRUWVu} WVZY=/t@X@d=/t1s(4/f`u1򋈄1 ҉Ѝe^_]UWVS/tH x/ x/4/!`t'Rh#ϐh#蓽 "jsatuhlpx1Rh#xh#< th#s4/ ǀdƀah P5/5(/5/]=/t/PP^_5/ /[1111 4/!PRWVjh|/h#詏h#mZYh#褏4/ ǀdh P5/J5(/5/=/t/PP^_5/' /[1ۡ4/dJw*atP Ph#Rh@#͎h#葻 h(#Ď4/ǀdƀah P5/m5(/5/=/t/PPZY5/J /X؍e[^_]Ujh`,#Pp UWVS] DžLDžPDžTDžXDž\Dž`DžDDžH`,#d󥍵dh,#uSd < @t|uu h\0#WO%sPsT1$lPsLsHWpu/}tsLsHh0#WVpY^;CXt.tsLsHh0#WpvnZ~~*U T0# UtX0#uu Ph0#Wpu  ujSPjjuu Wj TjpPl1RPsLsHW8 "t Džll9CPvዕlSTp4F(V,+F V$dh~>Vh\#htQChdv$v tQh0#Wd,jVjhdv$v Wf PlQPl/SlX1e[^_]UWVS(ƉUMjQRPuh1#VY[QfUt&tuuh1#VS}lZv11҉ tu@ tBuuL]tY} }u>Hjjh01#VjSjjjjjVa 1uuhN1#V~uuhu1#VjSjjjuuV E܃ GE؋E E EԊGE<G 1O1ӉM]G1O 1ӋE ȋU uuuhk1#V~+SQM̉]uuEPPh1#V& M̋]ЊGƒt:<t6jujSQEUEURPVƒ tZEB@]2EUE UM ]}uSQuщ‰ @t9}_S]jX!(jjh;1#Vke[^_]UWVSu} hjeZYuVh1#[Y^EEU(,E$E U$04%jhSPVJuhVSKh1#S{T8RPo5_Z@uh1#B$@%=u?$Phd@H @uh1#SY^$uh1#M, ((Phd@H @uh2#뭋, (h(2#S딋ȃu ǃ$, (uFM苳$1RPWV"  ‹MtT (,(,EU싋$1҉MRQuu3 Ɖ׸9ЋM|RVh>2#StRVQuuhZ2#SWVSO @EjjEP11ɉ @t`jjjStLEt+jS!YZtT@ P$@ tR9MsGQ jRPS@u*tP ZSfX1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@pF @u%h2#SXZuSh2#S E] ]USS]jS*ZYu Eh2#jS  ZYuEh3#SY[EFjSjStuh:3#SXZ1 @ ]UWVSVu}E X CPCTPw ZYCXCs SZYCu V[Zu EhT3#WVY[uEhj3#VhXZE1e[^_]UEPdUE PJUEM }҃ @@@ }~ @ H ]UEP EBTU B ]UEH E ATB ]UE H E ATB ]UWVS] {C E1}PxPE$a$Vx ZYt 3"3# 3#3"QM73RUVh3#h0,[UM;usRQM43RUh3"uh3#h0,[F MU;ut43uhy"h0,[Fރe[^_]USQM$1SQ,( eY[]UWVS u} W l5M19É}uRPh3#V;IEPu9 ZYy 5l5hln!!UEG9ø|5l5h3#V e[^_]UWVSxu >1;FN|#~$u~,u;FF |F1҅8tOu[tu_Y-{CV$9tVN19};K;VN 19};K ;SHEPu1_Zǃ~,uVЉ||t(6jmEPj$W8RJEPv,tijWR4p uYjuWUu<@uuZYjuPUu.@v0sh3#uv[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h3#S 1e[^_]ÍL$qUWVSQ qyAQEUy uh3#S~XZ:$E܉EEuuWV<  tuWVh4#SCDEPuuuu lj֋EU tuuuhJ4#;MM}eY[^_]aUWVSu Fh4c%5l5 _X1ti1SщU`#MYZMt/UBuSh~4#u| h4c%ji XZ뫋 d#F h#F։e[^_]US1l#`#uh4#8T`u܋]UWVSP]EE}u h3"SIA 1E#d#h#! t+G";u3"u PS{u `#Sl`u؍e[^_]UWVS]EEEE}EE} tE U U uh4#SZY[YSZtN@P;E sPu h4#S42E HEPSkY^E#ƅUtu h4#S c׋EЉEJ0!#B4 MJ0 EB4SZ@tuS2ZY#x0U#P4 }x0 UP4S_@tu h4#S e[^_]USP] ;u=j EP5l5v{ U:u1҅u5l5hln!u] Ћ]UEUitstau+u P uPZYU@Rh5#P US] ƒt+S5l5%4ZYt5l5h;5#u ]US] ;u&5l5Y1҅uhV5#uXZЋ]USEU MitWat&bt?L,RP@st?ttHs:~hh5#P'Y[n1gRP $RP_[Z@&Zƒt,S5l5!3ZYQhz5#P ]UWVSu }jj h3"WVj]SA yEWVuh5#jP}t ShD#VPZYj nOXe[^_]UWVSQ]M tu ET"!E !Qh5#S'M $jVXZM uWh5#S 9jVQjjuuS E 1uWh5#SVZe[^_]UWVSQ MAQEUA E܋AEjS)ZYth5#2jS^_ujjjjSJEUE Eu h 6#SY[EE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSxZxt h;6#PP @9E}}EU u hY6#'EUjjjS@ $uTY_u hs6#jPjuujjS? uVXh6#S p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEԉU؃F0V4F8PS51_Z@)QFHVL}$E$;EvE܉FPFTy 19VPvUWS0ZY@UB߃}uujS~@jp juuuuS u h6#a @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]UVSĀ]E 9 ,tE @+Ee[^]i,(h7#3$h7#K$1RP,( RPh7# h 8#觫jSV uh"8#莫XrX CRPh98#^Ks,s(hW8#s4s0hk8#$C8Ph1"hxV,Vh~8#KsPh8# K 1e[^]UU E$E8E U]bUWVSPEPV @'Et M 9 ,uPhV EPVzhX+ju;T e[^_]UWVƉj(jOZYt:0xu} px @@UP@@ @$e^_]Åt!USÃx$t p SZSSX]UWVS}uE}t;EPEUEP @E؉U܋EUEU9E ]|'E@hR9#W,Y[~M ]M]M];EE}?ENuuuu uuuuha9#W(#E@U3U M3M u[U3UM3M uKt-ut#uuuuu h9#WvEpE ]C E$C$tKut7H9#w !#H9#w!#QRh9#WfE@VuuE Uƃ )E F E$F$EP]K[ M];UuK;E uFE@FUVtpEpEU}WEU+EUGW QM]ӉM؉]܋]9]u>]9]u6E@F}~tpEpEU+EU}GW u{]sM ])SQ t@FV AQ ]S)CS CANs^qAtH룉뛉h9#WXZEEe[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuu.  t/E؋UWVRP~ щΉE؉UMWVuu  t/EUWVRP; щΉEUMEE E؉EE EEi{USEЉUԸ;EиE4}tE9E؋EE$E؋UX9uEE؋U܉EU}NWVuu$ EUċE Et0EЋUWVRPj ։+EUԉEUċCS +EUĉEȉŨ}tE9EȋEE9uȋE||E Eu?9}EEPWVuu ÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuà [1ۉ؍eY[^_]aUWVSQM]ԋyYq ]uQAEUw}x}y h:#TE Eu h:#:~t hB:#*GW E؉U܋FV ] ]uM؋]ӉM]O_ EUuuRP UMˍ eEUME9Eu E9EE9EEE}!uuuuhc:#u$EUGW +EUVN^ )ӉN^ FGFtxuuuu  t;M]M]uuSQ UMˍ eEUMGW EUE9EEEE}rUGW EUt~tIWjM]+M]SQ uh9#u1GxpF)VFV 9EEEuh}:#4~th:#'FV M]+M]M];E]}h:#uXZEET+EUFV M]+O_ ^ uFGFtxEUGW E؋U܉EUEUeY[^_]UU Et 9Pt@]UE]UEt Pt]UWVSEtd1yAQ $T$D$T$ D$9E ED$ |I11҃yu#S1e[^_]UWVS]u hh!uVW$ u95 ,tE +Ee[^_]SEUjSA t h/>#jS(jS jS jS u u hF>#Zu hy>#)R u9r$u9r u0EU+AQ RPY^@d jSHXZ4jjjjSx hz/#S:cljfǂUjuu썂UPjURjjjjjSZ0PSl^Xh/#SY[dPh>#S .jjuu& jjZY@2jjjS:ƒ h/#h>#SmXZ1e[^_]UWVS4u ] 1E"h?#uV! tPSu @u95 ,th+jMZYjhLm Sue[^_]UWV`,#}^_]UWVSH]u EEEEEEEEhY?#uV Eԃ @t=}buEPSXZՃ}qtuԍEPEPEPS@uE95 ,th+jjE1;EE}1SMu_t xuPt9pu 9uU@uuuuuSƉ׃u E܋UẺUЋE؉ESZEHEPSEjh`,#PKuuh4#S e$1RPuuL EUSXt E;AtIh?#SXZAQ EĉU19}T;}uO;uuJU Ut&;EE}:Muuuui  ‹Mu}hc?#Sh[^uuWVQMSẺUЃ}Mu }E9EuE9Etű}1yMăEp(x,SY@tLup(x,S@t&uűMq1uh?#SEEԍe[^_]UWVSP]u }(,EUEh@#WV% E @t4}qt(}su0jsEPjjS@uEE95 ,thأ+jEuujjjSOE؉U܃}u}tu؋}܃u}E Euuuh@#$1RP,( Ɖ׃uЉ};E؉E}WVuuh,@#S|jSJEZYtPE؉U܋E Et hh@#E@ EjSjSu h|@#H A EA$MȉEjS jS MtuMh@#S^_MȋE9Eu'E9Eu}u h@#SY[EEȋP APATЉEE؉EM;Us;Mjh`,#RUG UMtB(ƋB,9u}uEȋP @EȉŰEU+EU9E|uuh@#SvEЋU+EU9E| h A#A}9}EE} EUE؉U܋EU;EU}9}}}„tE9EЋEE|EUE؉U 1;EE}P tGt>}u h8A#SXZ u؋}܉0x+EỦQ}u hTA#SA_X1;EE| EЋUԉEUuujS@jp juuȋEU+EURPS  uhvA#S @ r $󤋃p PF V$FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@EthA#-}~1EǀuSEY^@hA#SXZE}Љ΋Ee[^_]UWVS]EEEEE11hA#uu  btENtoat%itClh~&Y1EPS&EPSdEPSZY@ky҉Љ։X1;EE}=SzMM܋UUZt&xuPtM9Hu M9uU@օtE 9 ,uEU t th+jZYWVRPuSme[^_]UWVS֋UU $)#E(B# t h/B#)XEv/#hE9B#\EHB#PEWB#DEeB#8A t h/B#n)XhsB#c)C SX1O11;u ;FuEB#h}B#(_tjmWj$8SM1tttSh1"ShB#hW Wh"(ZYzh/#y(Xufu]EB#E EB#e[^_]G(e[^_];(B#t3"PPh$ ( e[^_]UVSÉjj h3"U MeRPjuV荷 yEu uShB#'}t VhD#'ZYj &Xe[^]UWVStƉP]Zt 9St[RhB#V= ({ RhB#9'$1s3щ¸B#$1s sщ¸7#Wh\#hVo(Wh1"htSUSVuhh^o&V SVhB#&GPh1"hSShC#&$jmSj$G8PShC#c&hD#Y&G0W4 u hB#RXRPhPP61e[^_]Ë ,Q,y ;,| t,J ,Uh,P4+XZUWVSxhi$ hC#%h#2# hC#%hC#装Vsà Gs3 hC#i%s s hC#S% / %CPh C#&%K Cs31 { Wh\#hPt Wh1"htRZtRPuhh^o&P Ph&C#$tRhQC#$GPh1"htR tRh~C#S$hC#I$jj h3"$K $cRPjRس (y&$K $cRPhm !# Rh\##ZY jmPj$W8RBPhC##hC##G0W4 u hB#蛃XGRPhPKP)h!^#K Cs31: + [1e[^_]UWVS}] uEEEEh+D#VS tSl`~Qa wI$)#uu=MȃMƒM뼍EPW EPW7ZY@uM9 ,th+j_X_jW<[^u h4D#uY]t I;]E}1W)uMZt xuPt9Hu 90uU@܋Utyhi$ hC#!h#2# hC#!hC#߁Wƃ v6 hC#!v v hC#! k aFtPh^D#f!XZ h!X!Y 6 ,N Fv6U vXZZ؍e[^_]UWVSD] 1}`,#}EzD#uhD#uu p tGTtlu&h~&3Y1tukVS_Z@ut6PEPS @u#tjh`,#V9 t E 9 ,th(+jZYVhπ EPSae[^_]UWVu }^_]UWVS]u EEEEEhD#uV} tfitLat%bt0lh~&VY1txEPSthEPStXEPS_Z@uG1;EE}1SHM}Zt xuPt9xu 9uU@܅t95 ,thH+jZYuujjuSVe[^_]US HfJfHfJHJH J 1Ɋ\ \ Au[]USYSYSY SY SY SY SY SYSYSYS1h E#RP3]UWVSEUPUfPfUP Uf@fEExsu>1ۍujVk *#W7 uu wu\  u]CuEExlu<1ۍujVk *#Wu7 uu wu  uCuɍMU Ee[^_]UWVSuU t>u1}]U EPEPEPEPEPEPEPEPEPEPEPhQE#V& 4 U u$Eyt#S? @h!"VjZYuI#VК Yuh>I#h H# 胐 XZuhH#롋$1RPQ{ uh_I#SĬ tf  hH# / YXthH#V YZtjhP%| u$hI#SiVf f  4Ph,#V F41$1$8PhH#V& TP8B^Z*1RW($ $(,Dž01ҋ$()׉ hI# ˎ ZYFhH#P趎 ^_+P_ Yujh`,#R) ubVj X8Ph}&Ww% dR8YZdt8hI#S蕪 aDPhi$W# LPh|F$W i,9DH0}hI#S1XZDž,p;L PVi $@P, u hI#jjjBu @u hJ#1$9vP,Q ;$u P Z8h XtPhE#W t,D0Ph.!Wg ,D0PhH#WF ,D0Ph!H#W% e,D0Ph.H#W D,D0Ph}&W #,D0Ph=H#W ,D0PhFH#W ,D0PhQH#W ,D0Ph^H#W ,D0PhlH#Ww ~,|u/(~ǁA,$*,D0Ph{H#W ,D0PhH#W 2f ,fǀUjjj:Bu@uh:J#SM$,j ;$uO ^u$H$,t {e _Y4t 1󫍽@Wh}&V6 tuhH#SvR@ZYu(WhH#V tˍEP@ZYt@hI#S& nEPhi$V tEPh|F$V mEPh]!V SWhT#Vp tj$EP@I sV赲ZYu+C xu"t s s^FYXj yZupXe[^_]UWVSuE @80ƅ77Ph d#V t 7ua7V Y&Vu Zt h&d#_j0 PhK&> Ttg81ƅ9K&@󥍅8PhTd#jPSez0PhTd#jPuVKz VShZd#j SDi[t ht#j T˅S zuR$(Ws%ZY(u1$zu%B sV2ZYu+C xu"t s s>YXj Zu*iXe[^_]UWVqJ9vr^_]UWVS]u(ZuP+8E_@u hL#h#c#u/^uhL#hd#j sP3}s WsqhdX$uv t.P Eh#u~v E tZu؉ EYLEPh"u }Chs@Pum @qhe#u v XZt Vk Yhe#uu XZt QM XMEPh"u. E Mu {hE EEEM؍CU`EPu u @MuhL#he#fEftft5fu6t2C t Whe#jD }tC(Uhe#C0ut3he#j t C0sHtS4KL9vщ}t:s@shu us@s`u @u;481t/sl`}t$CU[s@s`u @uEsd6CptSuZY@u s\hf#s8sXu @u s\h\#te[^_]UWVSPuq Zu1hu r _tPV(P Yt8W{ EWu Wt Mu SJ [1PQS|t uVO XtSrq Z؍e[^_]UPEPh#u ƒ 1tEUWVSu\Phe#V t\Mfnj4Zu\VXtd$1jRVWVhiSJ@tt}f1RPhe#u 1e[^_]US]uu S? @t ]]1]UWVSu ur [^u |P Y;Ev_?V˅ }ƉM)1Ze[^_]UWVSu u1r [^u PZ Y;Er?Vd }ƉM)1Ze[^_]UEPhv!u ƒ EuUWVS8uEPh f#V uhQ$hL#hhf#hWf#Vbq _ZtP„ }ĉ[J]ShiVt5}ĉjS݂ PhWf#u q ƃ S6G YuaEUu؅yكۉM]! EjEP聂 XZt!VhWf#u ^q VF ؃e[^_]UWVS1Rhiu4 @t|j7RPhaf#hS>ހ>tVhf#Vt j7RPhaf#hS;tShf#oS\ e[^_]UWVS]hWf#So Y^tVP Zthf#hL#jVhf#V Uܹ׉RhiS3@u hf#j e[^_]UWh%1󫍅hPhiRe3 t|}UWVS\Ph g#u uhQ$hN#h0hg#AdShiu2 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVoZtÍEPh?#VE uhQ$hN#hhg#yuS1^Xu hXg#j$ CPS ZYu hN#hjg#Phe#u rn uhN#hg#j S(1e[^]UVSSu] EPSV @uhN#he#j hg#Vcm ZYuhg#hN#hhg##Ete#PRSm ؍e[^]UVSSu] EPSV @uhN#he#j" Eu he#j he#Vl ZYuhg#hN#hhg#Phe#SVm ؍e[^]UWVS}ho#W~l [^ubP pY@vhg#VZu hg#ji VPho#W@u hg#j xtdPhiW50 thg#뮉`SbX`e[^_]UWVS}h-m#Wk [^utP~ pVZYuhh#FVPh-m#W6@u hh#jn Eu]EPhiW/ @u h0h#jk SX1e[^_]UVSÉЉʉƃ ιx"u3"QuRPSh=h#e[^]UWVSu1j ,Vhxi P@uhIh# UЉUPXۋUu hbh#j U]Vhxi W @uhh#ڋE9E~E19u~tj YWh\#FXZj Sj-UVSPuVqZt"ÍEPu V @u Shh#j% @PUVSuV[thdX$Vi ZYuhg#hN#hhg# P| ^fx PS-ZYu hXg#j PX1e[^]Uhh#J1US]dPh%SE uhQ$hO#hhg#y d|lPhiS,- @u hh#ǂX1]US]dPh6"%S uhQ$h O#hhg# d|lPhiS, @u hh#RX1]UEEpPhiut, t hg#jX 1Uhg#uh ZYuhg#hN#hhg#] Phe#u h Ƀ0 v+BwBÍBwBU]UWU1ERhiu+ @u h0h#j 1}UWVS$ƉUЉhCl#PFg [ZtPz Y1D]Shvi VY+j Sx PhCl#ug à V= Ze[^_]UWVS,uEPhi#V uhQ$hN#hfhg# ]ԉًU 5@utE̋UЋM}}ȅy#Ɖރ߉ủ}Ѓ!Mu! Mu ։uj Sw XZtVhCl#u f VR< ؃e[^_]W|$wUWSÉЄtGjj h3"QPj]S%w S^ z3"tx"PShi#< h!¸G"xXe[_]g_US ]EPhi#S u].juS) uEhN#h\#%XZE1]UWVS2a uhtN#h(i#j< jLh+?_Zi#u3"jmh+#ZY¸"i#u3"WPShCi#h0,=h+t VW?Xjmh+ݩZY¸"i#u3"SSSSSPShi#h0,$V: jfUEU P]UEU P]UEU P]UEU P]UET+T+1]UE\+\+1]UEd+d+1]UEl+l+1]UE@t+t+1]US]Sh+ƨYZt f=CЃ v؃߃Av Dh+Z>u' +1]UE;1҃t`/]áp+uUP;Ut@u]UWVS4EEE䀖5 / /EPj YZ@u hck#EU׉uȉ}̋MMāɚ;~EU6eĉ}ċ5 /EEtNމ׉uЉ}ԉ΁ɚ;~3EUʚ;#EEEEEEPMZ@t E EԉE{ht#j u8GustwC t@P_Džt@tCt΃}tċMU;Uu-;Mu(9u}SYtjEP۟ XZ= /u(];MU}S_tu4SjIEPjm ZY@UE;Eu;Uu E9E~ 9Uȋ]}hF!j UWVSÉHP _tP^D DžD1Q!LY@u hN#h#c#&RPHSƃ uhN#h}k#j譹 R1RPhk#hWeWVh l# jVW耴WhiLn@u Whl#zt Ph)l#XZjVW6Wh~iL$@tt Ph4l#LY_j dpHHZ@uhN#huW薖Phr#$ h)r#h2r#4j $F뫃 u]e[^_]e[^_]UWVSSӉϋuu M  0M Xt8tVWPQ u37' Y1t$EV' ZEV'  Xe[^_]UWVSu]Et,DžpVRpRtWjP2u tpW*b Y_uU %NPڋE ZtEC sF C1e[^_]UWVSW]EtGs$URPƉ׉‰ 9иr E8t 8"uF9;sC| C 9s} "WV'1 Y^u 'K(PUE -Z@tE}G _C G1e[^_]UWSËtPv% X1e[_]UWVSÉUMUEE;E t]ztOUj8_ZtbNjUx4uup4x u}x xuupK(C(E81 S$uS$S(P XC$ue[^_]UWVSDž@}uXoE@u E@ u+PE 0=N ZYuCPE 0'N ^_.LPhv!E 0 u Dž0 L0t 1󫃽0 00`0uQj[Hh4c%HPH,ZYu Dž,i&EXtj/V [_ÅtC`1DžT0XDž\@PTP,Vyǃu@xuPqRTt/0u#xPVg(ZYHufDžtt,Ttto1T[Dž,tN(j DPSpi,D (t8t1ҁ,v "1҉(V^(v0 Dž,1ۍ A$(P0Z$ tW0,f8ljB$@tP\ Y(0[ 0y uEHVUE Z@tEx$,V1 Y_u,Vh[#hr#j輢 @PS4[ S u h[#hjg#*VEpE0I Vt uh[#hg#jb E}G }xG }G1e[^_]UWVSu]}t WZv W Yu %NPڋE gZtEC sF C1e[^_]UWVSU1EXEECu5}Ej1ɋUE E@upup Z\uu}Wu Pu4Eu }uEEXExtHu E؋ExuY}t 1}t,ES}e[^_]UWVSQu}u\SEX$:Cu S{0u3PE 07G YZun?-uGPRUzYZUu{(WRzYZuA{ Cu Cu5PE 0F YZtPE 0F YZu^Cv Phr#j譟 $t[#PW_ -w7( XZ w7I( 1t7 _t8ȋK 11PE Zt7EF EFC4FCF1 e[^_]UVSu]}tݾ.j^ NPڋE ZYtEC sC1e[^]Ujj$ZYt$[#U PUPUP UPUPUjjZYt[#U PUPUP UPUWVSu] FtVuVVPY1;}t&jgZt2TPFNG1 VuVVPVXFue[^_]UVSuj(jZYt;[#ECCCCuu S> @u SX1C؍e[^]USj,jZYtA[#U PECC$C$C(uuuM @u SX1ۉ؋]UWVSPu]E1+Ei;}|1bt:M9w踼GM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EV, EtG븍e[^_]UExu@Rt]1]UEP 1tRZ@US]C$u C$[Ps S= @uCuu P{Z@u1]US]C u C [$(KSs Ps @uڃC4uu P Z@u1]UVS]u jCZt$pSuCCC]e[^]e[^]UWVShr#uA hr#uA tÅu'j`h[#hr#OX VT ST Y[@8Fthr#\F1󫍝NvJvrt󤀽uIE9 t hs#jܙ |t uh-s#jS jtP PhJiuƒ 1BuhIs#[ZXe[^_]Uh0,hYs#)hXZUWVS, =/ ƅƅF1RhKiuF @ PXujP Y_VjWhQRP qpujPg XZpVjRhVpQP hi&Ws$Ѓ,hi&RrZYЃ,w#tRVRSPhs#e[^_]UjhIiu} @u hs#j 1US]D+9t tu< /C@t5< /} X ujjS[< / u D+D+]UWVS ]E1}t;0uK,f|Jxu}}E} tˆUPu AZYUtCt!,DHt KDHuhs#}9}rths#hs#X1EtR ,ҍBu ,W{G09u ,f8W Ћ}G/CEP#U+UE9~ )1}E؍e[^_]UWVS]u ~;0t =,11)S,f|Pxu> fLOt0@t@9|u"tt SVh t#SPhi!1 %h#"Y19};Ph ! GXZe[^_]UWVS ] uع1}t}u+EU EUܸMMمx9s1LuÍKكt :M؍AMP:Zt fP׋Me[^_]UWVSQUU} uj[Uuh'c#RZu hd#j贔 jPV轏 u} ]e[^_]餧UWl$1E|Ru ul}UWVS4] ufYu hp\#hd#j)Z@uhp\#h#c#j P]&_@u hp\#ht#ݍF1jRc Dž&t6Dž!t#*pn[^ÅtuP zu yljDžBPhi( @uhp\#h*t#SZYs:[=/u@ SjjhSRP Sh>!ܺ ++Xe[^_]UWVSu FPYZu8+u1hBL&j0 \`%1juS t \vSh iR @u蓱81t艱8/thAt#rRXpe[^_]UEU =/uRP*ZYE EQt#׹UVS] t4sVukZYtC P;UuPVZYft1e[^]Uh0,h`t#_XZUWVSSƉӉM1V(_t@jht#P` u*W,DPtSh:iV9 @}u ht#j~ e[^_]UVS]u1ɉf@uh\#ht#jt EPht#SI u)EfEVh9iSƒ 1Bu ht#j% e[^]UVS ]u1ɉ@uh\#h#c#j EPht#S t,juVf E؀8t-EPht#S uf)EfEVh9iSƒ 1Bu ht#jv e[^]UUE7@t0UMfu t E Eut#PRht#} ËPtB t#Pt8s!Pu+u#øt#Pts!Pu u#ø u#ËtO-u#tE u#t8s!u+t#øt#ts!u u#øu#UWVSljӋuFEE9vU19ta ^w@vzMSh#WS 1M;us?v:1MFPh !)ЉUPSU MuQWw u9utD7...}e[^_]01e[^_]UVS ]uVhiS @u hu#j艍 EPh-u#S諾 uhQ$hx^#hh7u#E߉EVhiSP uEh|u#MXE1e[^]UWVS$]uӹ!1j EPh+%SuhT^#hu#j贌 EVhiS= @u hu#j辌 1e[^_]UVS ]EPhu#S~ uhQ$h@^#hh7u#uVhiSt @uhu#E؉EVhiSU @u h|u#j: 1e[^]UWVSxhShz#u@uh4^#hu#jʋ DžDžDžDžDžDžShu#1ZYuADžDžDžDžDžDžjShu#S ‰؅uDž8 ,DytRx:uL҃0jWVh4c%P;t49u8tShu#j耊 jRVjPuIHDžDžDž|Phi8uYƒ 1Bu hv#j: e[^_]UVS0]juVhz#S衾@u h(^#hv#V} Zu Vh#v#j Uf@fEލEPhiS @u h7v#j辉 1e[^]Uh0,hGv#FXXZUWVS] 1}EPh8i(S~ @t&E1r r%1ʹ|󫍕[!RhiSt @[< v Phv#j躈 h w#/[P\P| <fDžLVhiS @t%fNth'w#=/t h1w#ʰ_fDžLVhiSi @t%fNth:w#=/t hDw#芰YfDžL VhiS) @t0Nf=) PhOw#VXZ=/t hWw#?XfDžLIVhiS @t0Nf=) Ph]w# _X=/t hfw#^1|󫍅|Phi8S @t}u(j $PhiSb@Uhmw#蔯EEEEĉEEEԉEEEEE|Phi8S@uh#>YruuKE E Eu:}~IE,DJtx:t~+jPhu# uVhuw#ڮXZDž|}Fy hu#贮Y Pv XZ9j,設Xhyw#zY4t8hw#`XZ h&"RXj k_PhiS @PhiS @jh ^#P u ftePhw#߭[^Vf"fPr Phw#読 ft Phw#菭ZYj 觬Xe[^_]U8EEEEEEEEEEEPhi8u @u hv#j躄 1UWU1Rhiu @u h7v#j聄 1}UVS]EPhz#S uhQ$h^#hNh7u#xuVhiS: @u hw#j 1e[^]UWVSVƉ׉Ph\#RVi)ƍ 9})je[^_]j-XUWVSƍt1fDžfDžRhiVX y hx#j h'^ Džl)֍H(@!P _9l}l' Džl hx#h.%hx#hx#hIx#hAv#hy#llhx#(ppx(@!P!pP Y` /t ` /Ea /tI@tc@tC@tP@ tS@@tB@yA@pX@dp@`pp19~pL9}B\pfP@u uw%k pfx p@tp d#z= tt= w-g [=wOft'k 11?1p%1=$v-- 1p-1Ƌp P h` /Sd`\VPPllhx#p@"Xp@!ǃ0X*w'Mwt4tou2tW0 Y=/OGPSPhy#h y#G=/Gdw#tw#Ph\# XZS"9dv ΃u#x3"VRPhh!էC4c%ʀ=/cGPGPGPh"y#h+y#蟧G1d_19d&j>蓦^=/GPhy#RKStRTRPh5y#2RPh?y#! F뗀=/GPhFy#Y[Gd<G=PuZhQy#h\#˦XZ=/bGPhVy#警G.Ph[y#蚦_ f`Wֹw#d8t-\PQhZ$QK b;!\`f\TddTw#tHw#Ptw#Pts!Put#PQhZ$ȥK b;!\T`\d<K=PuFu:hny#h\#g^X=/GPGPhsy#D t#=/dy#hny#h\#Y[=/GPhy#XZ1t D ҃L dd`w#du3"VRP`Q4^#hy#臤Cu_hy#h\#g^X=/GPhVy#IGPh[y#6wW ÉTӹw#\t-dPQhZ$N b;!dϋ\fd`T T`w#tHw#tw#ts!ut#PQhZ$qK b;!d`\kTPhby#-ZY=/O)w1w#'w$]#ux#w#{~x#tqw#ugx#`x#Y x#Rx#K"x#D,x#=4x#6v T![^]USQjj]Sjjh +Fth!uo /Zu hR j0r jjSPjh +Fu‹E /]US6Ph}#h0,h0,h~#@Sh~#h0, j蕓UE E ]3LUVSE M}uP0X%  %9t}## % 9t}#}#1҉1[^]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t}#/ $ 9L$t}# }#11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]}# $09tu}# E}#11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t}# $9L$t}# }#11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]}# $9tu}# E}#11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]}# $9tu}# E}#11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]}# $9tu}# E}#11Y[^_]UWVS UM EuT9|$y|$L$ ʉ1щ9L$t}#9T$}#uwy|$y|$L$ ˋL$ ˉ$4$19t}#9L$t#$9T$t# }#11 [^_]Uh jjh@+ub1҅tPUWVS jEPM E}^X1;u}2}SPGZYt#SPGZY t FEEe[^_]UVSQË0tRVĥ#EP*kV!ERhZe[^]UWVSQ1:nuzouPhXEh4c%P^ ZYt98nuxouSPZYu}SPZYuE1V艟Ee[^_]U1PPPh҂#h0,<jߍUWVSlju],PQ  ZY u QhB#zDžt } t-U hH!u 辩Y^Džu!hu4h7%,PE^ZuH!su MjPK ZYtDžoh6#+_ jhP#P3~ uOjZP,P~ t) 9|] 믋RSW} Åu=!/hW# j Vhg#kEt!Et"Et!Et6$#u0P,P [^@tjj@_fZY,t#jhP#W| uh#SbY^0H!tWh#Wh?#hS&,@h4c%,PXYG9 PVeXZ tK <-u"j=RTZYt)@ " m b ,tD=!/t}t =!/t/h#HY14hq$2GXZ9j E_}t$P{ [@u hr"c(Y># t t8h!?(ZtPʚXP轚X(=!/tj}t0$2M j+M j(.z @u h#'_+,W3hy$h,RP,Re 蜆8tV,Rh"z' ;ur8uWVWh#X'j ]tPڙ[P͙Y}u, Ex](8L jj M[ WS$J ~)t}u2h,,P4XZj P$J ~j,P  @uh `"l&F,ƒu t(bt!=tR蜝PVh!, }u4=!/t+0SVf Y_@uVh̃#%XZ 1ۉ؍e[^_]UWVSj Ph׃#:311tc#tN#t =!/t2#P2#tG"QRhZ$Ќ !փ 덍Nx"u3"x2#tG"VRQh#艌ƃtGF2#tG"Rh#_h t 0h\# h1"4XZ=!/KtSp2#tG"QRPh #=!/hG"h\#sds`sTsPh#ϋslshs\sXh;#蹋0=!/~chSjjhH!ju.t%j S$O^_tShZ#M h-~&R Y",#u 4!,#Ph\#XZe[^_]US] 1t-tPu$=ZYu!/1=!/]UWVS];nu{ou !/S%X1uhԡ!"X1[,u@B uPFXuhR "VV^_&3{j,VNZYt p7؍e[^_]U&PhH!h0,j腃UWVSRu ]1}Ep5 ,h#Vu^w tXe wc$#MՃMσMɍEPSh#5l5Ru h5H!ja PQRX똃M뒋 ,E)ȃt!ru2uVrE}8EUBpe[^_]UWVSxSV|PWu ujtW|ShP q ,@uSVh8M!jY` ~@t(RPh#hS rS jUVS]u VSJ YZu] EH!e[^] ;/t"Sh I!蒶XZu E$I!e[^]{e[^]U$PhH!h0,֊jyUWVS EEu EE}]EEEp5 ,h5M!VuEu t4ouBjWh#5l5Pu h5H!j_ PVPY붋 ,4E)Ѓt8S6EXZEE FEe[^_]UVSSPPVu ujVShw$o ,@uLB~toH!t",~0^Z@H!uH!PShH!j^ j UVS]u VSa YZu] EH!e[^];/t"Sh I!詴XZu E$I!e[^]钴e[^]U"Ph#h0,jUWVS]E#1Džd11DžhDžlhF#u u\s 'u+fM'9t=G K|뷃g$#UK| 땃K|돃K|뉃K|5l5CpXDžhe5l5CtXDžlG5l5CxX.5l5Xjuh#5l5Mu h5H!jc\ PMX5l5 YDžd ,P;UtGtuSx t SxM tu4guV^Ehhhlll ЃtTxPVSYZ@u Vh $j[ htECpltECttE%CxdupVV p@$XZK|ǃe[^_]UWVS SVdPhWu uhWdSh*$l ,@uSVh8M!jZ f@tKRPh#hSblShX#贂0j(|USP]jEPS:U :9uySu heM!jY ]US]SYZt@ h#SZY]US]S^Zt@ hz$SsZY]USP]jEPSU 9t :uy ShwM!jcY ]UVS]u VS貨 YZu] EH!e[^];/t"Sh I!XZu E$I!e[^]e[^]Uhi#jX Uh#h#h#h#h#PhP#h0, jzUVSQÉj EPS U:uVShj#jX e[^]UWVSuEE@t"!/ 1VFe[^_]P_u hԡ!j]X VP ZYujz]e[^_]銋UWVSQ]EE1+hȓ#u um 2F$#=H"/tD"/뷃=D"/uH"/c뛁K뒺al5C8K t L"/hK\cPDl5dC@K@2K&gl5:Pp s4K #Il5C(KK@KEPuh#5l58Hƃu h5H!jV Et L"/tctKtK@tK t=H"/D"/ s=D"/tH"/c@tKt ,+sc sKsC  sC sh#VF@"/XZEth$VEC$KY_Eth#VEC KXZEth#VEC$KY_Eth#VEC^11ҋu}`;Ms.uQh`#hP#uu}Ɖ׋E܋UEUWVu uuUÃu;/m8u1jEE܉U+M])YM܋]M]o؍e[^_]UWVS0։1RslZ=vʉ׉jDnXZvE^u1RPh?#n 0hO#nY[h]#mXZ1e[^]USP]jEPSz U :9uySu heM!j.E ]US]S_DZt@ h#SZY]US]SNIZt@ hz$SsZY]USP]jEPSU 9t :uy ShwM!jD ]UVS]u VS YZu] EH!e[^]P;/t"Sh I!:XZu E$I!e[^]#e[^]UWVS]fU ffCffBCffBfCffBs s'Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssTY^} GWss>Y^GWs$s +Y^G W$CDȉGDs,s(Y^G(W,C@ȉG@s4s0YYG0W4CHȉGHs30\+h,Dh0,:30 40hXZe[^_]W|$wUWSøth41ht#XZ5X40h#5P40h#H61t Ph#_XX40t?P409} hѸ#j[()D!MMEuQQ$h#B j YP40Z1<61H61EE(40ۃH~- 40]PP$9 #RR$S040QQ$SEWW$S h+PP$Sh#<<613030]3030Ezu#ٞzu#=P40\$=X40$h?#e[_]g_1UjjXZ1=P40P9U=`+u =P40ujh uMX40ZY9`40~`40<61ueUSá3030xFأ303030#w#r\+y1]W]W|$wUWVS40X40ff5040=409=40u ; 4040T40f50f40Yf40Ej]Sjj5(61 yht#[jh51jjh405(61 y<61t h#蘐^EjSjj5(61 y h#j h40j Y[40T40f50<61 s$ 40ɡ40ȉ 5050s50 4051}Xf40=f40404fpjh61jVP5,61 Ã9t:y hι#蓏ZSVh41hչ#y%h0,6X`+X40ؙ%ك `61CX4030 403030 30u30 40 40 4030v.}fE fEm]mE3030#5840=<40@40 ]u}fE fEm]mu30މ3030301Ӄɚ;~ ʚ; 3030530 4030(#؉30303030 30ى 30ɚ;~3030ʚ; 30H40rW 840<40 3030 3030@403030=ɚ;~ 3030-ʚ;30<61t 8<61te[^_]g_UWVS<ÉUM<61tUUEčs}u}MăA;E}lE؍t E;T40uP4040u8}t2<61u)?EPuh# UЍe[^_]W|$wUWVSEU܉MwG]<61MQURuh#~t h #mXVh&#a<61Y^t,%E #RR$Ph.#*=61t"uG0,e[^_]g_$e[^_]g_US3"=d>1tC&ZSPhd#h0,j:UWVSƉPl ¡A1_tEtPh#E A19U|} Vh#j tt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ A11҅w =w"=w:=w?=w W=w=v=w 3=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPs+ PVh# S! PVh#BhPSjSPVh#SPCPVh#kh,肼Xe[^]Ãt"¸#7t#tURZø #USљRPQhSh,SK ] ,yUh,j :XZá,P, UWVSDuh,ϻe[^_]ÉÉh'#`#aYE1ɉt1\Ѓtu }uCEtHPDA u1ۋtЅ}t1}uI1}ʍ}j.hA1EPjQQ91}ʍ}u) VPh\#j.hA1WhA1hq$XZ5A1VPhq$xC :=A1UWVS @<tPh4#;Y[C#tRh!Ph_#^_Phe#XZCH<$`#h3"C Phn#C@# Sassh#C! #<t#<u#C[S C !CPh#iCZYPfwi$#h#h#?XXh#h#h#h^!_3h# ^!h#Y Ph#XZ1ɍQ9vh#L EԍsfCfhw:ffEPEPEPEPEPEPh#jfEPEPEPEPEPEPEPEPEPEPEPEPEPEPh#Et(}A1u1ɋU[Et$"1uu ^_1ۃ}uj/u- ZYÅtuԍU1EEEEPVhi&u t3Et/EPVhi&u 1ۅtuh#t/Exuxtuh#j? p}ui juM }tCU1}uExux uxuxu x0E@E< u2UĹ1jEPUR ¸p_!uE耉E 1}E@111M YЀ w)YwW Yw7 uEw$#@ @11@ 9Ew+E}u}j/uY[Ã}txEpVuY? Y[u XuYu>AEZP}Wp @0V t=A1uuà tj.0Y^ƅthC1@P[YZuUuR ZhPhD1GD1e[^]UUE PjjhhD1PR~ thhF%hD1 D1UVSE UZ1t@ȅt1 @!)ˉ t Eu7t3jSyZYt%t$hPhD1{ VRh1#hhD1mVPRh.#hhD1DσVQPRh+#hhD1uVSQPRh(#hhD1T D1e[^]UWVS$u} .E ~y11Dž119Ft } |7uiM L1tMw tLxw tHuGC@u?6ttxtu#" @ @u 5cƄ5V)э1u- uh$hD1[^zth7# YEtPjjhVPP t hF%VXZSVh %hhD1D1e[^_]UVSMQB1QB1يۊ@#BZ@#XÃ@.)օ~=B1uCB1[^]UWVSu] =4+tN4+hhC1z_Zu(j.hC1ZYth@PhC1U C1uhh$hD1/ F<tW<t<u]] FEe[^_]D1}ʍ}fEu jEP ^_SEPZY6e[^_]VPFPhI#hhD1 D1e[^_]US]U MC<t#<t <u&]}MU ]]؋]FS3PCPhQ#hhD1D1]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV _XUЅҋEtuu SVZY SPV) }yE E\#e[^_]StEEԉE Ey"e[^_]2EEԉEE E e[^_]UWVSXEEE EEEEEEE"EEEEEjjuVjj]Syh#Et@PnE_u jj4 jjVujS赇yh[#ۋEEEEEhs#Y; Y]r;]WCU!;U<}t Sy;U)sxEt  Cy;8+t8+PuCyPm S 1ɉttЊtOGDA uϋuЅ~uE'uPsuV~uEuPjju^E#CPih!"h!"h#,H,$yh,j WXZ,P, EEe[^_]e[^_]UUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һ#~kMUD8-u^@P1ZMt$Ut:u?DX,t*DX\}uCNv t}tEEEe[^_]UjjEPEPu u-h?uuu](UStPhq#h0,$Sh#h0,Sh#h0,$Sh#h0,Sh#h0,Sh#h0,$Sh*#h0,ShK#h0,Shr#h0,$j>UVSƃ=E1u l#2 2u!B!tVWjVjpjhRS ySXe[^_]U&"}t ]U}uX2'h#h#h#502X2UWVSE]uu1҅‰uVruEE xh W)ZYu u2Jh&"W ZYut/&"^ u븫 PVh#502Ee[^_]Uh#h2u uGX2U}uX2=2t02E E#]YX ]Uh-#h2u uX2UVSE] u'&"1҃=2‰2 trX2sh VZYtTh&"VZYu2&"AV`^"sh<#502X2 t22fPh]#502 =2t52hs#502 502h#(W 2ZYt ,2X2e[^]Uh#h2u uX2Uh#h2u uyX2Uh#h,2u uWX2=,2t 2Uh#h2u u"X2UVSE] t~ѓX2 1=x2x2~u=sh V)YZu x2Yh&"V ^Zux2<usl2Yhsh`I1踜t2`I1x2 x2t2t't8u502h#U x2XZ4l28ufA" u&"SPRh#502̱x2X2e[^]Uh$#h2u uX2Uh-#h\2u uX2UVSE] uTX2ujsh VĽYZu 2[h&"V觽YZu 2>V6Zy.shI#502X2 ]1=22 2 1t  &" 1QRhc#502蔰1=2X2e[^]UEu^X2Huh}#E PEP tЋE ph#`YZu9=X2uM=2t502h#yS XZE ph#`ZYu 222USUE X2u q1Pt ]鏐pXtgSz Y@u Sh#DBA=2t$h2h#502MX2 502h#R XZ]]H]UEt~X2=Huh#E PEPi tӋE ph#_ZYu  2USPEu褏X2 Huho#E PEP t1h jӜEXZjhJ1 Y[U tnE ;u!1jju گà uu=1tڋtSh#^Y[u  2=1u=2t221ҋE t12tujXZ1]UEuxX2}Ht}6h#E PEPپ uh!#E PEP达 t}E ph)#]ZYu!E ph1#]ZYu  2UWVSu] ;E#e[^_]UWVSEu (H~}6ho#E PEP萼 uh#E PEPu tUE DMMEh!"PZ^_t9E8|t1EP[EuX23U|#th#E 0Y[^E1h jŘE_XjhJ1 ZYuhE YEH9=2B!t!E 4M}C#u9#jjRVQPz=1t C=1u?=2t5221ҋE 1tB152ujZY1E;Et EP荱Xe[^_]UWVSuu=X2;jj蕗9XZSc CYujjgh/"à u*p$j/Sף _ZڅtPhRW/ =2t6502S$L 02HQPYYy Pj XZ J N~j5H2h"WSf  jWSX Sh#=X2j~Pj ^9uWj艖ZYCuh#=X2X X2e[^_]UWVSPEEuԈX2Hh#E PEP: EwɋE ph#iX_XuE}h#y\ ^u ]E XSh#3XS褛1 tt[502h#J ZY~}h#\ Xu ]E X Sh #WSF1 t*륃}u"E X Sh #WS1 2te[^_]UX2}t錇=2t =2u#s=2u02E E#I h2h;#502IX2 UX2}t=2u#=2u02E E#pI h2hQ#502X2 UEu趆X2{Huhf#E PEP tӋE ph#UVYZu9=X2u<=2t502hu#H XZE ph#VZYu  2UEuX2{Huhf#E PEP肶 tӋE ph#UYZu9=X2u<=2t502h#7H XZE ph#zUZYu  2UWVSu huS 9}1hE4S*UF 9~hh$SU GSh\#TY[Hu jOZ 2e[^_]UEuX2/Huh#E PEP^ tu uh3"- UEu詄X2/Huh#E PEP tu uh# UEu]X2[Ht}6h,"E PEP辴 uh#E PEP裴 t}E pph#S USEuX2822Hu h#SYE ph*#SXZ2]USEPv臃X2822Hu h8#5SYE phB#"SXZ2]USEu.X2822Hu hO#RYE phT#RXZ2]UE} tuЂX2=2th\#RXbU} t}u蔂X2Ã=2t jjXZj`Y=2t jjuXZjUjjjUWSREEu#X2=uE Xha#V Xu]Sh #QS51 e[_]UVSEu迁@Huh#E PEP2 t݋E pSEY@u!502hj#D XZX2}u 502h#׋Ex u 502h#jh`J1 [^uhL j藎XZj_YEx t1=2u(502h#{C [Xjg_4$jVbhA"h`12ZYÅt$h`1)@$a1Sh`1 8 j E0]S  E XPEHPEP XZ1=2|2j^4$jʍY[e[^]Uh#hh2u ugX2Uh#hT2u uEX2UVS]u t~X2ou(d2502h#KB d2X2XZBd2@d2X2jvh42 u  2jvh 2 e[^]USEu+`2502h#A `2X2Y[u2X2~}~h#E PEP莯 u`2X2j 5H2^[ZÃ=2tC; tH2j S^ZYh5H2h 2 C; thSh 2 ]USEu( 1҃=P2‰P2L2t>~X2E Xh S谩ZYu P2h&"S蓩ZYuP2L2^h$SlZYuP2L2  =P2u&"PRh#502蝜P2X2&"ŋ]U1=2t1#Ph 2u uX2 2U1=2tC#Ph 2u uMX2 2UVS]u VS~XZu ]e[^]UhU#hp2u uX2Uhb#hl2u uX2UWVS ]} a}t~Qwhv$VZYtJh#VZYtBh#VY^uEtFwpZy+|EE̓uw =X1ɿ11jjPEjjDEEtOu 5 2 2}t =2t0 2 2 u&"QRPhq#502胚EtOu 5 2 2}t =2t0 2 2 u&"QRPh#502.uj芈uj耈1e[^_]Uju uNX2 U}uzX2bh#JZu2=X2uF=2t502h#= YXh#eJZu 222USPE] uRzX2= 2u02E E7#fu@j EPs xM9tsh#502 2222 02 uM E<#]<< RPhW#Q贘]US}uyX2!22h#GI2X]USEuTyX2=1u502h#{H~}~h#E PEP虩 u뭃=2t502h#o; [Xj E pk11PF1 u ́1q1kPkЁ1B́1ḱ1,H1,y h,~Yu!502h#,P,< u@1k19́1u@1 {u@1KZX2Ch,P,8 t ,yh,}Z t@ ,y.h,}Z u502h$#.: X2Y[,P,8 ͋]UWVEupwX2mHuh#E PEP٧ tjE p}ƉXZutWVE phP#5029X2e^_]UEt~vX2xHuh#E PEPB tjE pEUYYBu@t)EPIP輜PE phY#502wM;MUX2UEU uAvX2]Hu E_#]EBE Ed#]EUS] hB!jSutsshl#502]UWVSQEuu.Huh#E PEP1 t݋E p԰Zu X2}hv#8|Xt:u RU讈É4$褈|<$iWURP~Wh$S EWVSE(S7_ X2S=V7 e[^_]UWVSEt~tX2Huh#E PEPI thv#n{Zt8u SǍ@$諩|GWS@P}=222EU22222jjhl#M qVhg#c=2EU222(V#Xe[^_]UWVS]u tsX2>h#WKZYt.h%W:ZYth#W)Y[t밻v趝Zt02u6h#Rg t1t15151h#R7X2e[^_]UWVSSU} uRUyZUuUE #02Ee[^_]Ë@tPCYWECZ=2ttP3h #502袑e[^_]USEU X2tIt ]gr+Hu.t8Cu3"PRj h #502@jrr X2]UVSu X2}t e[^]qvxZuvh#502Ԑ1@tPCX3h)#502諐X2 e[^]US}uqX2B= 2u02E E:#]3 22hg#A2X]USEU HvqX2V= 2u02E El#]l3 22Hu h#@Yrh#@XZ2]USMU AvpX2_= 2u02E E#]2 22BuPh# @XZrPh#@ 2]USZKJy ;J| t Y RP茑XZ]UWVS @Eu} toX2Hh#E PEP= tЋ51} 19~j k1Pwv t*Cu%wh#502rX2 h@h`1Px DžܿDžk1X ؿ9X,DP@tC`1<$t<\CFC=,KDOtQ1KԿSDOtk DЋԿڋMQ9~ox`2)PE 4VwE 4AiuHCDžܿ9E~5`2)PE ؿ4VwE ؿ4eƃF;!r10o_u 502hj#u!502h#C0 X2Y^x t=2u 502h#΃=2t"502h`1/ 02 BXZj 6Wv18P51V =2t~t02h@Ph`1vq1E1E 9XCܿt9Ee[^_]USËt P֓YCtP“CZCtP譓CX]USdi1jyX=2t>%Ph-#jd]S~!02fJftPSRC jhL1 USdj*yX=2t>$PhG#jd]S輆~!02fJftPSR"C jhL1 UWVSƉӋ:j:WKYZuWha#V> :WPϚYZtj%WLKYZtWhj#VWpC uf{P Huf{tCPh5#V֦ hq"VȦXZe[^_]UWVS ERU8~ZEE0U;OwtCuRSg u=]< „t <w#;Ow tCE1e[^_]UWVSË@tP|CYstV}Z1CtPQCXe[^_]UWVSljӋu2u<MPwEPMQSW<jw>yFE8 u@Euhu#: XZ,HEHwtE1e[^_]Å8UWVSH%Pt{=,ufTwfUtaPtZftwftK0Euf]fۃW})0ufۃW)ڈQ@YAaAXZ[^_]UWVSUu u h#j=\ ljjh#Pe uWC fCPjh#WWe uWC fCjh#W1e u WC _t36葝v臝Cv|CF C FfC (Wuh#^ Ed:j/RUG^ZEUu R8)ЉUHQM蝜ƋMQURPp{ uEuޜCXj@V[urVj]RUFYZEtH:UttWuVh#)PERVMVu WuVh#fEPx:t1j:VVFYZtP>t3tJj EPRUj U:tM9u HvWuRh!#蠰 =fC*C ttp2ut2t3"R[CZ{u7%{ u8%P;CX1e[^_]USZKJy ;J| t Y RP XZ]UWVSDDžDžDžDžfDžDžDžDžjh#Pb jPu#;ZY@tt8tt8uVh>#B C8j;P~ [_ÅhO#P ZYtChW#SY_t>h_#S_Zuhg#ծ [VSh#Dž DžzDžV茙j@PC t' 2@PWYj:C_Zt@P3^DžG8>1ۅtK>tBj/Vl} Y[9u"uFjh7%Sl tC11ۃu t=2Džt^1uNt;th#S1_ZDžt >th#V1ZY 2=2tjjYX 22hPRkDž tDž 22RP胛 22YZuu0s!)Hu?h uPh# DtuRjnRj艾XZujhd#h#jU 1u2j/SAZY…tBu 1Ҁ;hhu&QPjDž 2Pj5= 2u/;E=X25h0,h#" ^_*>!t3hSSihh7%S/hVS/$hh#SkiDž tN522=`2t hh|# hh#S i Wj 52Id2uj/Vny Y[‰tBDž=`2t WjiWjXZX2-1҃c‰XЍe[^_]UWVS\<Dž@DžDžDžDžDž0Dž4Dž8DžDž Dž(Dž$DžDž DžDžDžDžDžDžfDžDžDžDžDžfDžEDžDžDžDžDž,jhL1/ _Z_u Pu#[^@6ђ_迒Z譒Yfu-t#8th5#PzY^t h?#0t8u+nu =d2uhf#- PZ,,d2t <,j/Pdv ^_t@,PՑY P‘[d2 t 8uh#_2222DžtDžx=`2t0 tRPL_Zu222#,hh!PĘ[^44u ,x4PZt$PoNZYu/tx2252=2 t34P$WVPay,Ph#=2u=1u`1 T,Ph#502y 22 02 u502j 胨 ^_RPh#QOyDžDžDžDžDžDžuhhK1bc  2K1 = 4#u#PR_Xh#h#h#V1u4G"u1#t>=2t!Wh#502o CQh#苌 t2=2tWh#502o CVh #U u>4hq"P=Y[4P蟍^@u8h##$] =2t502h,# XZj^]_<4Dž5+$`h$ +Xj /[^t9@`j lRPz ltS,DB@uFDžDžDžDžDžDžQ`资Y(DžDžDžDžDžDžDž1ۍ\P +ZP\ d8#drt>j `Pd] 22`8rH#d ƅ#zI"dd8*u@xj pVP p8-v@dj VP讗 O99pdd8/Pdx*u,j pPRC pdd82 2:hW##dtXH ׉dR%s^_Džh8HRZYtx#dwtd2#dTtVr#d@th#輖 Xi#du jh#@7 #dt#dƅu$#dutPrDžXV_t<'ਯu 2 2h6#t;u h[#8L1P8L1~ h#21u>u$PڋY^'Sh#502i ƅuf >Sh#502}i Ճth# XZ h#ה XtcU DžDžDžDžDžDž1DžqXt p_tSpYuh#{ 9d2 h!"P_Zu Dž8,c 8|uXjj VZY hB!@P [^88u @Ph# ^_Dž0M.8*22 #At;}1uLuC 229!A=2K502h## Y[4u t=2=2;u;t Ph1#蚒  h! hB!PZg_Z88u PhS.#Dž0hj!UZYh_j U[^1hZ#hp#hhj#芄 ;J1v&J1tPnX1J1Pl|_J1 2$22@tPjvT[^DžjTY4P5J15J1 u h#QZjP5J1s ƃ J19u h#Z8"ty-Z"J1R)Ph# % u @;t,hq"z_Zt$h#2 t@uƅ= 2u 2șuJ11jPY[؉|tL𙋍|9Ή| ||=2F|19=J1|19||Nj4PWj5J10ǃu4PZ1 2$2|)ډ|8J1@DžftS uWtڃ#u)uË9 PhH"=,2029 2$2|#@2R$,Xd)h= 2tYjP _X++y @B19|@B)R[맋e]1u2V4P5J15J1R uj/P$#hq"5J1CZYt h#` |ft=2u4P_tch5#; Q=,2uڋ5 2$219}Nj29|02 뤋02#^/jP8$*[0=xu tjSD ^_txDž08RDž8 $PD ZY@u*tPcJ$g$hB#502` 1; 2$2|2 2y )jHY22 2$29؉| 2$2Dž@u @u"PjnNXZ㋅Pj \N^_@tPjCNY[@tPj*NXZ4t4P~@t P[ X0t8t08R_ ;d2t! t PqgDž ^sh,t,P$gDž,[tPgDžY$t$PfDž$Z(tg(PfDž(XNSDžDžDžDžDžDže[^_]UWVSÉjh#P< jh#S< toh#Sp ZYDžt$jh#S; tS)Whg#jp2 t F t-t(h#bE_t18t,jh#S; uVj11҉ZYe[^_]É؍e[^_]USEEjh2 ZYt-=2uEE@Ejj)Y[h#jnKY[hrj `KXZEE;EEj:M 4[Zt{8L1= 2u  2EU 1kEd2t'h!"S ZYt;|tSdd2YE~E@EE@EX=2uE]ËE@tjjAXZUWVS$u j h#]S{F]EEEunrljEP-PD<:#̆ [^XSqEG/ @PqEYCEPjXZyV1ۃuFEEPjX2-ZY1ۃc)EEPjCX2-Y_cw u1ubEZtPbX؍e[^_]US Oi1jH|i1@|i1NX]USNi1j]HX=2t%02fPftjh4!Pn |i1@|i1= i1t jh@i1 qN]USaNjGX=2t%02fPftjh4!P xi1@xi1= i1t jh@i1^ N]Ui1jGX=2t%02fPftjh4!P $i11|i1jh@i1 USdi1jGjdh#]SFC02fJfuPSR  uJYjhd1 USdi1jF1|i12Yr]tsuAjdh#jdh#SB jdh#S 02fJ ft Ph#j, PSRu jhd1 UWVSƉ1tfPft‰EfEtfSft‰DGfDiQPEPZm ~1tfEt fT҃ Ѝe[^_]USZKJy ;J|< t Y RPYXZ]UWVSTEUMEEEEUEԉU؋E1҉EĉUȉEU} tE EE} t jEPXZjKEUẺU11;EEE9Eċ}}}EPuu@ à yK8tK8# 2$2)EUЋ}SWu ƃ yJ8tJ8#)Dž˃}WEԋU؉EU 02E9 2$2E| ʸ#zEԋUEUEԉUQ_} jEPEU+EUM[^+My @B19@B)PZJ8}tG 2$219}4;UE}02#02 502rXI8Ct1Fe[^_]UWVS |i1xi1hIj?ChJj-CDž e11DžDžDžX2DžDž2u<PBi1XSPYy PI;X J 'i1Hy P;[ J= =~-v*si1Hy P:Y JPh#i1Hy P:Z JPhhh.y#5i1S5i15xi1|i1jzAX}t9i1@ t.jAjAX211jS_=2t61u 4#h#502R502X2jAjAT tv 2'ƒ5t[~R= 2=|2t/t uu5 2hL"502!R 02,DXt_kX2 DУX2MuX2v1=ult%u ,DXZ t4)u -tt2i1s7@&du1(N枃du-ut X2uE9G25u$  2u02 i502X uGuhPhi1 ; =X2ui1t R[t'X2;tu1t 1j`>j>j>=X2t ujPY|i1I!ȅ!Ѓ„tt jZxi1J!ȅ!Ѓ„tt jX0$Re[^_]UVSu=i1uh1#z X2[1|i1hIjV=ÍE PV5i1覫5i1hq"F 5i11 h\#V^ZPƋ|i1Y!ȅ„t tjYSj<XZe[^]UWVSDžXP2d1d1jjd1Pi1 yh]# X 1tjXRjhPH d1<t <= 2= 252=2u 2hS#TÉ52_~St6=2t-X2-wD502h#  2Y[9hi1h"502'M =2u 2h#Z=2= 2= 252=2u 2hS#yÉ52_~St6=2t-X2-wD502h#  2Y[5hi1h"502LL =2utM 2hX#Z=2'L2t 5i1Z502h#BS#hX#V2ZYÅu6X2$ =502hr# ^_yhS#VY[bDžlX2-w 502h#ERpRRRPh#h e1"Q t502h# XZ:u:u:u˿d1d1󥋅pffd1jd1Phd15i1\y2i1=L2yP` i1P2X8=d1u%DžXjXPjj5i1 E 1hd1j5i1__Zy h# ^52d1<<d1<d1Pd1Pd1Pd1Pd1Pd1Ph#Ã=2g'=22d1d1=2t fd1i1tP _jjd1Pi1 y"h]# ^2=2u#jXRjhPC @uh #$d1Phd15i1`= yh5#B Y 1tjXPjh5i1EC Džhd11󫍅hPR5i1U @ hT#됃= 2B= 20= 2)= 21<B\td1<u Džj j WhStPtPJ 52=2u 2WS\h#YÉ52~5t=2t 2ahi1h"502HG =2u u<kfd1RPjd1Pd1Pd1Pd1Pd1Pd1Pd1Pd1Pd1Pd1Pd1Pd1Pd1Pd1Pd1Pd1Pjjh#MÃX1t 2<DžXjXPjj5i1@ 15i1 i1=d1t502h#X2$ w=t502h#lpRPRRRPh#h e1zK t502h#Sd11fd1 Ћ Ћ ȣd1lp ffd19d1$502hR#X#d1<t <OlpRPdPRRRP`P\Ph#h e1jJ , J\h`[dNd11fd1 Ћ Ћ ȣd1lp ffd19d1?lpRPdPPPPPPPPPPPPPPPPV`P\Ph#h e1I \t502h#i\u`u dt502h#>d11fd1d1@ulp ffd1jhd1hd1IY 502hR#502h#e[^_]UWVSD}i1=P2tWPHjjP ƃ HPj5i1z @-i1EfEjEP' M]ġ2ZZ<ډEUjEP M+M̋EZ[+Ey@Biy1PjEPJW  68t68#thM#d1EEPEP5i1, à ty5i1 i1VjS @t?}uEjEPjjS; W5i1#Y[Quh #al X5i1 i1Z1(O58\A58#Nh0#& 뽍e[^_]UWVS]|i1hVIj.EZYt#=22@P1Y1!=2^2Y1@P122 2thPBUPf* UBC 2 d1d1 󥍺d1d1󥡌i1<<i1i1@@i1 2DD 2 2HH 21LL1p2PPp2l2TTl2h2XXh2d2\\d2jh42`UP.)j`Ph42)jh 2U썂qP)$jqPh 2(`2U쉂`2hh 2P(hPh 2($hh 2UˆR(hÈSh 2x(uji,|i1 t|i1EEe[^_]e[^_]UWVSQ}j/W8 [^Ƹ %t9u7%jP@XZt/y Whn# khWh@L1'AL1ƀ@L1. d1+F9t=BUjh@L1?XZۊUx&0t(uOu502h# Y[10@L1F<.u1F@Fōe[^_]UWVSui1u1h#Kh X=$i1t X2Ee[^_]9=fDžƅfPftjjWPft h# Xhh#5i1E<5i1 i1)Ã(t h# X=$i1t X2j<Xt(t#fVfthWP| jYu=X2(ujZjXe[^_]US EEhg#u[Zt Eg##=l2u#E 2u= 2t= 2ۃ9 2u%h#Yt!502h# ZjSHxXZj]X=2u)502h!#N [Xj:XX29 2uh e1h9#sZYt}jSw[Xjh@i1 ZY'hnJj(Y[E22 uuuh*% Hu.RPhA# tԋEPj(XZjXlj $mXE@E22 u{Eu Ph*% Hu| i1j$$$E$j([XjX i1uu hK#502q9RPhA#- mjhd1ީ ZYhJj'XZ i1hg#uoY[¡2tt =1tSjtj[XEt1=2P?[=1t(MEu Ph*% Hu\jY뼋Eu(Eu Ph*%U Hu/=1tjZ1=2PX=1tEjX=1tsjQi 1ҡi1%~j$ X=2u06u=$i1tX2 ha#m Xjr8Xj=Yj5[=$i1t X2EPj&XZ]UWVS2pt2rh!Dž` 2$222,2P=2t}u=2tTuu uy E 8-u}tuhU#5026 u h~#5026 ʡ 29 2u<DždDžhDžlDžXB!jhd1& Y[u#jPsXZ븃=1jcXhj$XZh4Kj$Y[hh!"u ^_uDž\,,2 E 8|uijj l$ZYlE Xhh!S訽 ^_\\uSh#Y _XX2,2DždM.hh!u 5[^\\u u hS.#Džd\fzt \@xRP ZYxE%=tu h#502!5 NEЋUԣ220jhd1舥 ^_E52=2 h#uZYth#uZY 2twC\fxu \jWVPP \@jWVP^yu h# _X(5252hA# DžXl#}tEuuh*% H 2X~^``u%uh\#ZY뽡1h#h#h+h#Q ;tc1v&pc1tP;X1tc1PI_pc1j"^l@ujj !ZYl52t=,2t ރ=2y52 2 2tc1T pc1`fxt `P\ft \@VSTo uu hH"! ^_'8 x 2$2o\P[Y ` 2$2\J볋pt9 2$2|B02#x502+[pt2ډptu`@ @tu:c` $ 2$2B\H 8$pt9 2$2|02 \@ @t#02#u hH" XZ`@ @tzh# Xxj_dtd\R^Dž\`PpDž`$[thPjZYDžh=1i1xP1 Xi1`t`PXDž`j3XX21; 2$2}jCXh@u l@u"hPjY_X㋅lPj G[^i1xP Yi1du `u)\tꋅd\RZ؋`P=XP,222 2$2e[^_]UWVSDž0Dž42PT2$ 2$2DžL22,2(\2$hg#uY[DDu =2uVu=2t}t}u&E 8-u}tuhU#502\. 뺋E Ph~#502C. ɋDtE uPu Dž8Dž<Dž@1=T2uDHjhd1m _Zt=1tzj^hjXZh4Kj Y[<}tWE jP/Y[E j/Pl( _Z!8tN!8 tDE Phn# [^X2$ E h!"P^_E 8|utU 7%9t %tE jPY/Y^t/x=l2t i!8 uW@]!8 u"E hP _ZyE Ph#P=l2t 뽃=l2tE PYE .D 2uJutW jjiXZ 29u(jus0^_22X2=ujPbiY[@ujhd1蓜 XZvDu}u-k22 tRPhA# ͋E8t8Puh*%k Hyhh!,_44uuh\#4Y^ȃ}E h!"P_Zu#Dž0,,2\2E 8|u^jj w_Z@E hB!@P赲 Y^00u E @Ph#G,2\2Dž8M.=E uP+Y^00uE PhS.# XZDž80fzt 0@xRP^_@t#E%=t,2\21hZ#h|#h3h#H ;lc1v&hc1tP2Y1lc1P?Zhc1j_52t=,2t ރ=2y52 2Dt@22 t/0f{t 0IjRPQa 2lc1, hc10fxt 0P4ft 4@VS, u0|8 u 2$2h#L ^ڃD2 2{0jjjP_ 11ۅyUE Ph# Y[F0JyG 0PDZ t t*; 22|0x:уԋ0jjjPĊ `PT9ȉ|M02#A502XPT2ډPT 2$2u 2$24J4POX 0@ @uL0 t|u<4Jy4PXt uL@L7ue O#4H vHq00 2$2v4H 냋PT95 2$2|02 4@ @tA02#8 u 2$2 h#萻 X݋0@ @tE PhH"s _Xj^8t80R[Dž04Pf Dž4$YLu 2$2y3`LPh#502a% 502h8# XZ뾋D$ u=\2ujS _苅8=juA*[^X\Bu@j`S ^_X\lpDžtE SP ZY@XPQ$+U $Rhb#502}$`jhd1 Y[t$X21; 2$2}4ju X*hJjXZ=14P4X벋<@u @@u"th#WZYEue[^_]2ø#=2uE"Ph#502l +t$=2t~ tP2PS2 S%YE ]e[^_]8 QMZƒMuQWh#502KSu QWh#ދ}u#Uj PMQ2MMEPjUR rPj h #502릍e[^_]á@1 1!t$uCd2tJu6d2H2%d2P@1+8!t+UVS t t u@d2tJt d21&d2H2 tGtBB@"u\uXu@!@B؀"@tՈBut B1 1@1u.d2tHu d2H2 d21ɉ[^]US@1`1 1@1d21@1}P51T0XZt1ߋ]UVS =2t202SPA "[^8tPhr#502 502jh@h`1h,C*y}u2502h #t=2t02 w=1O10YÃu 502hj#+u 502h#x t =2u502h#X XZ2j 3uV-10P51S =2t{t02b{ h#jhrj e[^]UEt]1]US]u h2#j SZu ShY#j @]U=+u ( +02fPftP Z9+ÍL$qUWVSQ02 ,2 ]jP + |22Z^+2y @B{!ڽ߭ݕ 2$219ؾ}^؞vK߭ٽf f٭߽٭ ؉Ήء2ȃ¸3" tx"PSQh#hPNٽf f݅٭۝٭Q~DQ3"tx"RPh#)PPÃt Ph!)PPÃ<RPh#)PPh؉19}t @u4#%%y) ڃkdd%1 Q1 RPh#+PPWà 2$21;݅22o52=29C)߭߭ٽf f٭۝٭׉h#)PP+à t!Vh!)PPÃ<RPh#)PPË+p2t2Ɖ׃x29y9},h#)PP{à h4!)PPNà u02f@ftSVR eY[^_]aUS1; 2$2}6=2t%02fPftjh4!PT jXo]UWVEE왉UE}ujEPj e^_]U0E EEEEEEEPEPuƒ xEÍL$qUWVSQ@@u5jh|2R p2|222h2l2XZjP 22 2$2+p2t2^_x29y29=h2l2sHp2󥋵5h2=l2DžDžx~t;}l諩Ph#hS 02fJftPSR$ jjjjh2舀 =,2uhjjujjj =,2`6Sh!P2Y[tPh\#hP X2219߭y{!ݝ݅ D!߭ٽf f٭۝٭y1d~dWh#)PP2 Ë5(2~-2t PsZ)ƅ~:ƹdh3")Vh#Ph!#)PP Ã11ɺ9st @u4#WVh+#)PPn ؉+|22+ 2y @B{!ڽ߭ 2$219ظw ȉ߭$s9ٽf f٭߽٭?ٽf f٭߽٭ʿ 9ƾs tGȉݝ4#%1d PSQh8#+PPá22; 2$2)ލ ;݅9;}hZ#VQ à +22߭߭ٽf f٭۝٭?~~hM#rtPh!VQdÃh$VQQà <ЙRPhg#)PPÃuh4!)PPà 02fPftSVPW eY[^_]aUSjj\X]á2@ `t1US2HyPYu1ZJ, uɍPv"u|22HyP^ZuJ"\u%2HyP+ZuJCC2uh#}4 Y222HyPZu ZJ, „t@Pv8\u"2HyPYu JCC2uq+=2th2P襷ZYuC ߸ ]UWVSQƉUh2P[_tHj.V[_1ۅt6uPZYÅu#)Wh2V u1ۀ21ۉ؍e[^_]À=m1UWVShh!hm12^_u$8hm1h# Y[hS_ZyƅEj.S&[^ƅ3"}en tnRU ut36 t&t!K~\=252n[1y1뒉 2kuE]Ån1뉻낃t tP]E uh2M h2P舵ZY- E th#PeY_tB2fPfttRP_Zx|?th#Q1 h#wE8h2MY2fPfttRP_Zx"|?th#0 h$0 ~5E8)h2}zPYt) u 2Hy t J܃ u>502hB$Gh2h$B0 _X@52\Yf1u502h# XZk11Ɂ1p2HyPYZuJ,DB@u GG;pu t$2HyPYuJJס1uÉ1q1ḱ112Hy4PZu2502ha$$kPkЁ1B́1뭋J< u61k19́1u@1 u@1OzUGj502h$e[^_]1US],uh$SZYu 2DB@tCjh#S u  2Uh$SNZYu  28h%S1ZYu  2h$SZYu  2]USZKJy ;J| t Y RPXZ]UVS2=2u 2h#^tGh$hi1TZY9ƹ} i1.uhi1Ph$502jh $hi1 52tjh#hi1 uVt  2  2 2j hr#h 2 tbh 2h4#502< Ht  2  2t*j h$hi1Q u502h$l Y^ 2 2 2 2 2 2i1hg#oZu)1< 2u  2@u 2  2i12e[^]U塈i1tPZi12 2 2= 2u  2i1 2 2|2tPX|2=2u 1Ui1jX=2t%02fPftjh4!Pݷ jh2Np UVS]0j{Y=2tli1t0fPftjP 5i1i1 i1x jPĺ 5i1蹹 i1 2jBZ=2tCi1t0fPftjPp 5i1Ui1 2|2j Xt Shi$j 0e[^]UWVS]2=1t =2u6u d#2=`#2<W`#2Y1$u9=d#2uEd#2d#2Pd#2xd#2=`#2h5 2V /thh7%VG hh$V4V4yVh$Ւ XZsP =2Xأ252,22,2} t1=2PRXB!EEt!jjRPPh9#p!ҡX2-cvti1} t1=2PX=252,2hh!V `#2VM3=`#2 uu h$' ;$P5`#2hh`2' ǃ u5`#2`#2[j h`2ƼZY`2te[^_]UVSQSMq2=2u 2= 2u502h$ Ph$)؋u N9CT!"=2t 2u!")ڋE Htn<.u}mtd9voCD!"=2t|2)؋u Nt79vBCTE H9v3C%U JU9v"S% 9UvMA%[^_]UWS$]؍U1EEEEPShi&u ƒ1uu; Xe[_]UWVSu] }VuS u/N tt $ t$fN nS6YHˀ; uLUJ9uD ,yh,Z t@,H ,8 u҅t,$ff te[^_]UVSPuh`1Zá02?vPhC$ʑ juh_$P: Cƃ`1 EUR@)Ra1Ph,yhe$uho$502 j21191 U e[^]UWVSHuVbj j ShWuu e t hhs!Wj hs!Sh2M I9Ot uwwV à ucjjjhVww thhs!VS qVh$V XZVjjV" ǃ u(PPh2u#h$ PjV à uPPh$fDž=2~"jPl 2[Xuu V輦 à 8$}u8AvPPh#W VjP +‹YY+y@Biy1fDžPjP" uf8u=2~s8#tDWjV臥 à u%PPh h$胀 1~uv<tQDžPPhhV @h  ؍e[^_]UVS]u S Xu ]e[^]  UVSu ]h3#V~YZt'hi&VmYZt>tuh$ XZ 1ۉ؍e[^]US]SZu Sh$j蟾 ]U u h@$j肾 US] Sut ZY@u Shi$j^ ]UEu h$j PZu h$j, UWVSduE ]EEEEt PE_t SE[= 2tMEtPEYh#bEEZtPEXh#yP9E_XEPEPEPVy$X25q1E[Eq102t^RVh$PQ EEPjP]Sh,yh!uho$502 X21Vh$P Sh=x2tPP#É4$|<$WuP&Wh#SWVSwE(tPY]uh#SXZu[}u-h#c _u]SES1[^uh# ËuVx1 tts;}u-h# Yu]SwES81XZE8uh$Y XPh #蒗ËuV1 EtPh #e^_uu|252[219~Lk1Ph#蚕ZYu0h@h#h`11051WF22EtPEXutV_1EtPEYutVZ1EtPX؍e[^_]UEuiX2=2t%5 2h$502B X2fHhҹ#E PEP UBw x2t l2u t2u)E @tt2t:u h-$jx PRPE pZY=x2t"=2t5t2hJ$502 2j h %h 2 2 2j hq$h 2` 2j h{$h@ 2 2$j hq h 2{ 2j h\&h 2` 2=2tjjE p{ UWVS0u=2u e[^_]&]ȹ 1SjhV u}uVh# S 1E0ES݌ XZEče[^_]UWVS,EPu EP? Uȃ u ỦEЋE0ufEjEP* 2EUXZ1ۃ=2~wjEP E+E‹EY_+Ey@Biy1PjEPS u8t8#tu<TjEPV蓚 u  y8E8#7ËU9| u-X )‰UE؍e[^_]UE]UE@(]UPEx$tEjURjj0j 1UVSju脛 [^1ۅx%j0jdZYu VC X 0@$؍e[^]UVSPuEj0j(ZYt,0@$jjV蚛 jEPhhV ؍e[^]US]t&S(3 ssS 1]UWVS(]=2~jEP 2EUY^EE E̋C t ;EvẺEЋs})C C)E2}E&uW3 t}R)EEЃ}u488#tyC(8uE;Cw">uC,8#us_ZCEЉC{uMEЉC CUԃD@fE؃=2~;jEP豊 E+E‹EY^+Ey@Biy1VjEP u'8t8#tC(1@E;x52Ph#502 m<C(<뼍e[^_]UWVSS]{uhƉCYC{(t1{,uC 9Cts C);E E HCC CSjjEPbu{(u{,t{uKSBCEC9Cu0xWsXZux C($s{} us}UC ։e[^_]UWVSQu] }VuS u-~,tt $ t$F(]SZHˀ; u;UJ9u3VjjEPTt} ut$F( te[^_]UE Puz XZ=h#2u h#2UE Puz ja UE PuU XZ=h#2u h#2UWVSSƉ׉ˉʁv )…tRUWVɔ tUuJ؍e[^_]UWVSx}E|ˋ7GEGEhEYu h5$4hEZtUĹ 1u]EEEȉuEEEEEEE1E11U}11ɅMEEUEEu+}uhX$~Y^i$$U:t41;EE}uhs$LXZKh$;h#2`BUHEjjj軵E ]3U t th$BUHE U:th$[BUHEU MBUHEE}EU]BUHE|U  MBUHE^}uxNEu >U:u$ Eu U:u BU2EEtE }u MEHEj8h$jEP:u h$jEPW<EZYwI$$}tK}uEEmh$h$2Y#h $h6$uhN$XZ+ẺEtM9u71MUEEE}t:jEP͏EZYvh $1h%UYEEEPhZt h $e~PPPPPPPSh) $hu ,UEth%XEUuu]EUSe[^_]UWVSÉUM=+t h: $|1 Z+jjjS0Bu11@tCjEPS跍 uu hm $ thm $*X1u1WVuuh $ E1EU)ӉM܉]E ËU 1 tL}xA19}M܋]M܉]1 tiE1-Ph $j]S LLD.Sh $h, uhE"3 $e[^_]UVS|PjZYyh+!pU1uEԃ=l#2t1h $щ1CSpSVj8 tpt)u߸)؃u h $nt h $Xh $tPj1 e[^]UWVSÀ8-u2xu,=p#2t e[^_]1_xDžtPx[<^_=p#2t-8uvx+Dhl$jtYlhu hR {txJ5+󤋅txJDžtSh $s%=@uxh $F=0=p#2jx諊 XZy xhq!_XPSƤY^tSJ xh $~ %Džl=u TlhxW蘺Wmơ+9~&)V5+_YZu5+V XZt#2 l#2u xh $?:XȲ?v.X?v"?tP?uP ?uPɉ[]UWVSljU΋C2vX>2Ee[^_]UVS/t*$@t{+t9~o\@1ɍÅu552552h$x1Ҁ8IuCu F9FJ@>uj RP F 552552hF$j ؍e[^]UWVS ÉU;]C2{u C10t @Ѓ432t2;Vu)UNqMW vZYMUu F 6ʉsuW552552hh$j% WX!e[^_]UWVS0DžDž#2jhh+2.à uN552552h$DA@tCuG;t,tDJ@tiC<,Cj‰GQY, ,552552h$j <#<;*jdNj8gG Ph$ tmj-‰G^{ ,t2DJ@CDB@DB@t0Cu&G#GG1WDž+tT8ti 狅>CDq@u<}U<;CAR552552h$j诘 @9}VPR552552h$j臘 x @$ $DA@tCuG҃ ЈGO'552552h$R552552h%$SCtDq@[u<\t#R552552hX$$DA@ Cu DA@I Cu C DQ@ @C DQ@ @DA@tCuF%ƉG;u552552h$(1څt @ 32tJ;YuAApVqZYuV552552h$ 벉j0 32Xx@ 32YsC<\tu552552h$aj$j4G1ɍeXZu552552h$(wu F1ҍFwDžhCF52FhHX1DžDž؉h<\t uuBhh<9  e[^_]UWVS1ҡ#2132t2;{ uCp552552h $ S7YFu\>2tk P`>2ZX>2@PT>2Xe[^_]UVSƉj pX`+`+Xe[^]USj@\+\+X]UVS5H>2vtQhh!6躶 YXtKySGZt# PSP" S؛  SțX1e[^]UWVSu]862^L>2u52PtJtHhh!p 462_ZL>2uph\#jO @52862iphe"jh62* vh $h,62 ZY5262L>2@62862|5462u V tI=52W52Ju>#u~nu 52462R fL>2L>25462K862X62=52u8#uxnu 52M 1M I"t6252tnt @uMf 62/t62862=L>29G L>252tBJM l1e[^_]U62@ t=<62t/=@>2t@HyP葚YtJ562P XZ1UWVS|u=62uQH>28u==<62t h$jɇ 62,52R$52,52  6262tQHyPߙ[t@ J562PA 562h62h62r ÃeN62=,uF1P!Y=@:2tdh@:2]h@:2552n t @6252= 62uH>2@H>2  62H>252=<62xRPLZY52uhF$h^$Pht$j豅 <62:t/hPh@:2Wh5<62h@:2a=wmh552R!h552S S? XIÍR蚍 WSPh~$hh@62E =v552hVY"j h@62J52_t=,tP[hB!h@62胰 52ZYfPftSQPpm %52fJ ftPRem 52@62_X=@>2u%5252,52 hh!552ۯ 62Y[y552h\#D D>2XZX552h\#j t62| u F KWF u S562V52e[^_]US]SԮZu Sh$j虃 ]USE] u ]]SP腳ZYu Sh$jc ]UVS]u VSPZYuVSh$j8 e[^]UWVSR]u P>2tPeXjEPVS1 PGP>2WPVS P>2e[^_]UWVS 19p>2v}k `>2tJtc552pjpoKhh!p& ZYt6Vh jWB t552PjW_oV9XC{52@ @t1¸:tPP552h!j p>2h>2e[^_]USu=d>2uh$j豁 d>2T>2CE CC 1}uX>2@QSPR5d>2 t 1҃t5d>2PLPh$jE Ћ]UWVSE>2>2z *&\u3rE,Dpt zu0yd<&8<\0>25>2V9r0M>2P5>2?ã>2>2>2XZM >2C1T>2xutyPx utk>2)ʋ >2L 9r2U>2P5>2ã>2>2>2YXURUT>2M 0QSCU>2 >2=>2W9r*>2P5>2Yã>2>2>2XZe[^_]GUVS]uCP9SsCPs CXZ}uCVu CPBss0 e[^]UWVS52Dž8jh>2 ZYP>2#2;l>2CSu u K u52);B`uB5>2j1ɋ>2_Zu529BC8 529HC u1u*@5>2j1ɋ>2AY^tԋCu(u 529Hu׋ 529Hv uxul>2H52C u@5>2j1ɋ>2_Zu 529H Ct t  C=<> $\ $\>29p>2r\>2kP5`>2`>2Y^=p>2k 5`>2CFP蓜ZFG=p>20 >2>2{u552sK Y[ =l>2uCu =>2 >2t5>2CPj Vs u>2 @))Ӊ>2SPV? Lj5>25>2h>2;jjh4!h>2j5>25>2h>2Fj5>25>2h>2U1 jjh4!h>2:j5>25>2h>2" 552suJ >2<>2@=52,uX=d+u[h="}Zt8tP d+X9TPhht@j~ uVftd+d+<=d+u d+t 11<tR<@PP軯Ht%tv$@P 1DžHP u?F;5d+r552h$8I ^_552j$ 552j 1-W軮YtJWZ;d+r552h$H Y^1552Hj@ gtfW ZtZPhX $fY_Njd+tAF9w552h$}H XZ1X $$Ph$552  nH<>;d+r552h$+H Y^1@HЉ0,Ph$552~ ,B 90uH@)< F;5d+r552h$G XZ552j$N 552j A 52@ @蛘¸:t芘P軰P552h!jx 52 >2u45525>2j5>2e=>2t552j _Xjh>26Y^>2f_jjh4!h>2jjh>27@=>2%5525>2j5>2d=>2552j  XZ=>2>2=>2BHPj Wn ƅt*>24)>2>2H85525>2jWTd=>2t552j Y_S8>24>2852 >2u45525>2j5>2c=>2t552j & XZj蟘 \>29p>2r\>2kP5`>2`>2^_=p>2k 5`>2CFPYFGp>2=>2CH@u. d>2t$P;Qv@52R552Ph$jv 5>2j1ɉ@^Z&>2>21҉HLC0t[uT>2H 9Hu;Pt$jT>20Wh>2CP 4T>2pP @9u9t)HL1H;HL}jjQh>2T>2PHσ)HLL(Hj@ZY!L HjHWh>29Q tUAQ )HLLHj@ZY T>2QNu9AuAQ 똋 >2j)ȋ5T>2PQh>2rCP T>2P @@DjH+@P@4Vh>2+ t>2󥸤>2>2>2>2>2t󥡜>2>2Cxt45525>2j5>2{`=>2t552j _XsF uq=>2u~uhh PEX F @t"5>25>2CpV ;>2t Cp jh4!Cp}V Ht1 h>2=h>2h>2[=>2{uhh sW C @t5>25>2sV ;>2tsh\#j\r jh4!sU Haփ=>2ujjh3"h>2_\>2󥸤>2>2>2>2>2\=>2>2H{5>2=,u>2>29Fx>2Tu@1,jjTPJkH<‹;HvA;@u,PB0PV 0,uk552hu 552 52 >2u45525>2j5>2]=>2t552j [^Ljr$B(Pht>2<)Ht>2󥸤>2>2t>2>2t>2t󥡄>2t>2)jjVht>26뇄bC e[^_]U塀#2txt@ x{u@jjh3"h>2US];] ttCtE8tsc1:"u#C@؍e[^]USPmYt@Ut‹EBu ShJ$j&n ]UWVS Ek< +E@ÉE19E~GuVp9< u01;u)QLQPq1kE/UVSu] h)/C Zwt @t2E0f~ufFsHPh_$h.e[^]Ee[^].UWVSÉQ-W-VPh^1$s}e[^_]UEU t2t Ju62'u%ģ2`2 `2]]UEU wS$$X2:2.`2"2`2 ģ2]]UEU t2t Ju92'u(ģ2(2 `2]]UEU t=t+JuD @21u2=22 `2 ]o]UEU wG$$ 2.`2"2`2 ģ2]]UVSuU E$$1if2Z Kh$P;ZYt u hW+X   e[^]he[^]US]E U $$1Ƀ:i2~22`2{ģ2o}2 ch$h}2>:ZY2t=2t h*X ,2  `2 =2؋]v]USE h$P9ZYudhRh3"h .1]U@2ƀxjjPUS] @2ƀxj3P@2 )t P=Xjj3P]UE 05@2US] @2)thej9XZ9ƀxj3PQjj35@2j35@2&(]US] @2ƀx3j35@2]Uju ,Uju Uju UVSu jVZYtV&jSP}e[^]UVSu jVZYtVSPB e[^]USRu ÍEPjSiu ugX jjS  ]Uu 8US]E $($1Ƀ=<2i 22J2 xh$h26YZ;2t=;2t h<'Z A:2 5`2 )=25<2=`X ؋]]US]E U$H$1Ƀ=2i22w2.k2 _h$h2 6YZ2t=2t hQ&Z (2  J1$52k_X ؋]I]Uh覷21U ?2j _1U ?2j^ c1Uhhj1$h2`pE Uhh1$h29pE Uhh1$h2pE Uhh1$h2oE UE.tgzEEPjjpҺ UE.tgzEEPjjo诺 UE.tgzEEPjjf茺 UE 0]Ph1$jjckUE.tgzEEPjjhb UE jUE jרUE j轨UE j裨艮UoU ]U輬U ]U衫U ]U`U ]UjK_U Uj5_U U轾U ]U@2,P1RP(U@2,P@1RPu(U@2,jhT(U@2,jh@3(Ujj1Ujj1UjjҰ1Ujj°1,Uh1$M Uh1$M 1Uh1$M U@1]UT2j,1Uӱ1]Uji.1U=21]U^01]U+1]UEU ttu(X22 2] ]UEU ttu( 2`2 2]]UVSE 0ڸ uh#tK h#jK XZjSh# jSh# 1e[^]U:2 =:2uh#K h# K XZ%jh:2h#葂 jh:2h#耂 1U2 .=2uh#J h#J XZ%jh2h#0 jh2h# 1U2 =2uh#TJ h#JJ XZ%jh2h#ρ jh2h#辁 1Uh$h2/ZYu;2dWhh;2h3"h $1Uh$h2G/ZYu2d hh2h3"h t$1Uh$h}2.ZYu2dhh2h3"h &$1U5@2Zujj5@2+ US] @2)thejйXZ0ƀxj3Pjj35@2$S ]UE ]UE ]UE ]UE ]UWVS É֋EEE ECfƒC19~Cfx fCEC9uh;3$RQugst.h$RQuKCuDSu0Kx9tF( FaZYƃUt)JMPWE@PRUsUt >t~UCuBEs4+EECES _9~Mf{ufKf9|A)fKsu)K9M|9~fs)y1fssf9|MS;M},9~(CPuyRuFYXCu;M}ys(uzXZ1C9uf{th1$uQsCujjs} uCES)Psߣs~e[^_]UE ]UE @]UE @]UE @]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE @]Y"U ?2jR1U ?2jQ1U251]U`2 1]Uh321UX2e1]U2q1]U21]UE uU]Uģ21]U`2e1]Uģ2J1]U2/1]U`21]U21]U`21]U 21]U`21]U`2 1]Uh覨21Uģ2\1]US] @2)thej軱XZ*ƀxj3Pjj35@2]UWVS ]u t/{u)PfvP t6vWϩC EC;E~Y}C48"Zt>vPzZYt/{u&MVU7MQURPkGE랍e[^_]FUS]CtBPwC YtsPXEs C sTs CXZ]UWVS +1AfEE1;E}DQF @tf~u;E}֍~@k2lu蚍t'jjjhh5[5v,>25[5q,>2j5[5k>2@jj@ x>2t* +1҉ B<.u>21 ؋]UWVS$]E؅t' 9>2 >2 fCC!f ufCbKt[fCfsCf9}ID t<@fC=4sCf;ssfF t]UC,t{uu SXZC0tu S^_{NC E{CE܋CuE 1EuECutlP^EYt^8tYUEj RUj3YZNMUt)9M}MԍPuRfZE;E}MԉMtFEuEEI"CЉƃEԅy #9}Sf{ ufs K fMҡ>2)+u9~%f}~CDu +u)y1+M)fK K U9|C@tNf)^uu5>2WuCPC Ph82$E)+E9~fC }}E}t'E܉E;USBu2^uEC9E|PaeY9E}Euu>29~*u5>2uuh2$h0,p j~g }u)UUU9})EK u>2+E)ȿuWVMQ5?Cu3BuuWuuuC Ph2$h0,Yp $jf jPgBYZthshs CtsuWVC EP>C :RC tOP5[5T?^_?sCƒF99fsK C9|)FfsU #sV_#P$l$D==t'3=R6S<sσf}׍b$$C*h0,j XZE{G  HSB ufCf;CfCs$uh0,j贝 5[5&5[5&jjWP=EtPu5[5=5[5V ƃ1Et9}} < uEF5[5oh3$jj5[52Vjj5[5"$jj5[55[5p5[5Z=,DBxt;xdr<^+=>2quuGLul5[5!oqOCf0S K)y1fK)y1fCWCfEECfEЍP9UK ω)y1s9~fSM}9 E}|8f{snXxu f}tfCLz `~x~Ha (mS9aSB OfC?> =t\*=S=VYv1,DBkh0,j Vn |ssmC Zt sP:_XskJY-t5F t!u S_Z(t Cz~ftbF uQs mC YtsP:s 1C sIsC>2XZu W_XF zslC Yt sP :XZsIXCt6PrCX&uCD0tPrCD0XEC9E|ыC4tu S_XsfCC ^PMC Y>u3>t.>2|=tP=t܍jh0,j XZ9}s$ YqOu =Rt=S벍e[^_]UU>2U fP]UU1x9>2~>2]UWVSP.5>29B  MP5>2n_XҋMu1 1>26>2>24uj2~(>2CtCtPPX1e[_]UWVS uu 5 ?25?2c E?2}u|S5?2,?2?2?2>2Y[;DN@uGu ?2 ?2 ?2u;?2?25,fDFf@{uQ<Ztj 5?2h^X=?2tj 5?2PY[?2>2z u_=?2tQZtj 5?2^Xj 5?2?2?2?2>2Y[*?2Љ?2f)؉E1=>2u=?2uuQNEE5?2gYZ9E|*5?2UZ;E~j 5?2LY^1?2t Nj P6XZuSP=GH߃ w @t ?2 ?2>2@=?2t35?2Ytj 5?2XZ?2>25?2ihEe[^_]UWVS(]E EԋEEEEEEu}tuEEu ej5?2\VSj}tNE8tFEtuPWQO 1hH4$5?2u5?2hĻ"5?2h$5?2WX[5?2oE5?2lE5?2+EHEEEEԃE+ECE9u+EE;u~}yES9~Љ+U;U~+EE+UE9~PEPuu5?25?2}thb;!uu5?2E+EPu5?25?2~f5?2註Y stO txu11E'=t%==t,@}u)PPKPGNELDH@t JJt LDH@t)PPUPU))ރ =5K/ u(}uuWLWVƃ9CEH9~6,DPt*U̍ )PQMCPvMЋÜF h0,j# XZ}t0j E+EPu5?2?2>2}t1Eԃ t 7uW}tM9MtuQuK }e[^_]iUWVS}5?2tc=?2W{WhCY_; ?2v-SCaZu?2tPPiX=?2 ?2?2>2e[^_]UVSu@+t5>2PXZ@+1ۅtjjV à tWjjjPH>2jjSjjPj@+,SR 5@+XthK4$VY[Åt jfZV >2X؍e[^]US]w>@+t-t)9>2r!DPH Zt9>2v @+`+؋]U5?2a?2>2XU5?2 XU5?2@XUS]uQu PnSPj`]US]u(u PmSPj7]UE Puj UDuPh\# UuPh\# US]uuP]mSuuu jPm$]Uh3"uuu uUWVS}5?25?2EXZup},u0u(PlWPjjZ ǃ}t%E8tE$9}uR^|E$|9}@u6/}t$~ E8tPXe[^_]UEPE 4mUWVS B P Y Zp j h$Vn uՃ{ uC WM h7%WG VW@ Wuj~Ƌ;7P yC9C u=CPW|\_Zu YaCPsW\_ZtۉC{ CP GC V Y^e[^_]Ã=2u U塤2t uP8 XZjM Uh -YtP> Zt h7%> Yhjxh~YZ hyZjqXUWVS$E}1T2jjׇY[]߉jjP N =T2u:SZxEPj _X}ejh訐[^T2nWxYj@2PgZY~>jhcj@2Pgyjh@^_=2;SEYujhXZS,_u@2ǀ$HuVX@2Ph\#jXnj蓆@2)t]SV^/}EEjPXY[{EE119EtMЋ 1҅t9t; tB C@܋Ekl9tH41҅t9t; tB Cl19t4EPYZu EG19tPZtGEPf_1;}s7klE@0 t(Pdt!ztHhr2p8p4xkG19t4EPrZYvGV[_}kSZZ^u`SD[Ohj]jYjGu8j]S4ZYu'.SDS=jj^EPXe[^_]UWVShPV=hh$VhVWa=$hh$WV?tOW2Zt/SSSSSSSSSSSh!h4jj[Y[WV6XZe[^_]UVShPV<hh$V"hVS<$hh$SSt VSXZe[^]UWVS}1ET2jj[^_ zj|VPI e]@2$*u u^)uYjh\.Y[,u>tPZt@2$PX@2$S螙^_EScSjZYS9^_#$.$S-^5[5Sjj5[5x5[5R5[5SEPj }tChj_jZj=u,jS-ZYu#$.$SXe[^_]UWVS}1ET2>jj胁ZYHxjSPG xpu@2*u$tPV!_XEV\[u4EPj ZY}t!hj`jj>u  V6Xe[^_]UWVSDžDD;E E8u EDDžLLUEL8< t tLu4CY$}Dž889E4S CZ9$ PuS6 _uDžH<%sC0VPh "hZ$j[M#>0VPh$h0,I jy@ 1]UVSƉ5[5Kj5[5;5[5MCMhHPjjb [h,PthPjj1-Vh\#9 ih\R$9CPj<L5[5@jPSR)R5[5 $uh0,hð$_ j? jP7aZYt'5[5NmPSHl5[5>PSkjjSpSK؍e[^]UWVSӉVjVj(P$PuNjE$ 2h2hpt$/ =+h+hbt(/ uf=+u]jhP&j& h+hf@$/=+t$+h+hbt(f/ +D2tPX2tP_ǃt 2JE$j j jjh$ jj. 谶$ 󥁍 Pj(E (D2t&u h$PF 5D25,D22t&u h"PXF 52,2hu&3Y^uh$sz_Zu s ^e s h`2YEt28t(P  ZtSPh $V S3艈 3h2$= j2281󫋍$88DžDž EtYDžDž C981jj P9-X8󥋅 ,0Dž4,PjjXPha 0uE 1uh~% [=D2080QPh<$5D2&D  hVS 3t h" YC#XtƄuPV$" u'뱊t@t 대?tzD2tPW 5D2  8uE shq"P/V ^Zt f W0N0E xP$ D2xt SPB ^_Sjn ƒt=$^(SD2Y[tP Z2ͼ ƒuh M $=t thu X1e[^_]UShhjhXjjjjj jjh+hy4y.h0,ht$B D2Y[t Pht$, XZjR8 jPS1 ]UWVSEPuhS = }uExPSZYtE Bthh!SA Y_uC"hh!S XZDžtu6D2tSh@$h$P@ 덿tt txW@‹E X1ۅtllV; pZ@lG9w9w ttRHE X"WRFE‹E YXt pC딃}uV%V Xu#D2tRh@$h$P @ 뺍e[^_] UWVS0u EEEPVEPn ] EEuiVh$E܍t0SE)Phi!V蓜 h$SR E؀8'uE؋E؀x*h$uj Y[]EԊm<'uMCj'S^_E؃}u Sh3Y؉E؋Eԍ4VuCE_ZTShٱ$j j 벍H9Ef%u@Q)IP*@6j/V9 ZYDžtVg EXuЅt GE/}u2_HEu  M܋}ԍYtqUĀx .tx uuW& uˋU;2tEԋEԍRUuCEZYUWVE)Ph$E܍DP y;2tVF_u ^rE܋MķuVhht@j% f}ufEf}ufEPEt|e s+[5EjP5[5e5[5S@6Et55[5!?j5[55[5@[5EELEfmEPuuU܍Ekh,6 tE@ Eu EEE$PuXZ[59EthPPjjjE[5t-t9u h4!r^CudY 9t%hP>_XZ?tE@t t}EujE;[5tPjPc t h4!^hPw?,H,ZYy h,", M?j| _EtG;[5tP^}ter+5[5?=5[5 j5[5>ufCYu܃Ft PRCZuGCXt EtS1 ؍e[^_]UVShV [ZuYtPEj.VZYÅuhVhF2#% 'hVhF2 %hCShG2$e[^]UWVSIM;]sg>t^}t1E t/t&,DxuUWu#ZYUtCE)؃~Wh$PS5 FE ؍e[^_]UWVSƉUMjjj à @t5$1UVjhH2V$$VuS!Sm؍e[^_]USPhH2h$EPjh4!uy [Xh4!jk ZYttjh#$S! u؃h+$S4L ZYuh5$S#L ZYujh@$SP! t؊t t@hSh`@2J# u@X]UVShF2-$G2,$hF2h@?2# =G2tR)~F2.uF2PhG2DZYt+hh %h@?2"hhG2h@?2@?2e[^]UWVS1ɺ!idu$xtxp jPhF2W"1ɺ%idu$xtxo jPhF2"jjjz à < 1jhH2V!Vh8i(SRS*ugL8P#hPhD2!2r#8PXt*hVhD2hShD24c%Íe[^_]W|$wUWVS-Thh$(Pj+ y,D2t Ph$ [^h0,h$ j2- h6Ƌ(Y1ۋ(?RX*ZX9h$WYZPWV(7 h$W}|,PDžX+XtIQH9*$LHQV# uLPDAu&XhViP C iƄV=(=_Xujrjp[^TDž$Hjj$V(Wh$= @u"Dž$ jjVWhӲ$ @u/z ;Tsh$jPZYt,뱸 ;x|s5h$jPY^u#heZt ?2V jSU8T^_u52Y. T‰f@ @ #9uhojjjjjjjjjSTjuL4DžXDžPDžhjthPLؿh uL@T;XZ1h  ?2hiPhH2jhF$hH2t(jhJ$hH2 J$F$1DžPh&$j@$W. jjPpVW $@t pue4X$hH2hZ$h'jdÃlDžpjVjj$V 1@CVh8$^^_DžX=H2su'=H2luH2,fDPfX(Ph7%| Y[u7h=#Pr_ZÅurDžP1ۃXEjv$X󫍽p!1󪍍pi^@_hh=$WY[FhhC2hC2j=C2 hhB2hB2hh!h)$1 ÃPhV$j ]h~$S]h$S\h$S\$h$S\hC2h$S\=B2thB2h$S\ h$S\XZhϳ$S\hݳ$S\S8h$jw\hH2h$ho(u)hH2h$h$S, SBDž$hhD2hD2j~uhN$hD2Yt~h$hD2C^_tihB$hD2.Y[tThK$hD2_Zt?ht#hD2[^t*h !hD2ZYth$hD2^_u D2b=D2tYhD2hH2hR$jct7Y`A2hhд$TXZh@`XhH2hд$hݴ$h1ۅ `A2h$\Sj ~h\hE2 \6j hE2: th\$Sj ~h\h2 \86j h2 t=2t `A2h$SjM ~h\hG2/ \5X=G2u8hf$Sj ~h\hG2 \5_j hG2N[^t=G2t `A2hhF2 ZYu=F2t `A2RhP$VyhhF2hF2jx[hhG2hG2jwE, PV)^_t%`A2PqjhF2hF2jyXtjhF2hF2jz_hF2解 Y=F2u=w jh$"P?w jh$-wjh$hF2 jhF2hF2j{hhE2hE2j}h`A2u<DžllPjXZluhh2h2j|#t#X=E2tE2DžHt#=F2t DžHF2t#=F2tF2t#=F2tF2N$=D2tD2t#=2t2WHVQRhH2PhF2hG2h!h,=E2tE2t#=F2tF2t#=F2tF2N$=D2tD2t#=2t2WVQRhH2PhF2hG2h!hW(jjjI X$x P'X`@2Rh\#h! h[_JLTD2h $j tjR ?2=2hB!h&$@* Y^u>=D2thw5D2P+ h^h0,P j; h7$jUpV/ VWPhT$hq$SfU =G2thG2h$SJU =2th2h$S.U h$jUjdS=F2"XhF2hF2hH2h$jhȷ$hA2 hhA2hA2jjFj jh< u`h$$Sr hA2Sdh$dPnK _Zt 8tV k [^^jj`RPHPuB=F2t hF2hF2hH2h$j hF2hH2h$j=F2thF2$hF2 ZYPuh=E2t&h/$hhE2hJ$hh[hh$hy  ?2j ?2X ?2䃽X؍e[^_]g_UE= ?2u]]UU3"wH$]UWVS] }Rh$^Zuu ƅ=jh$p:jjf@jh$MZY9t x/t/@?/uGjh$MXY1iR4$SRPh$hu! e[^_]UWVSƉˍPh$ ZY3"uu$VRPSS`2uģ2PVSWh$hke[^_]U 2E]ZUS]SWZй2؋]9USPEEPj EZYt=2~a2=`2/t`2譳SPhy$hh2 1]US]= ?2ujwXE]EPj 葰EZYtt2~2a2=`2/t`2+SPhy$hh2 a2=`2/t`2SPhy$hh2 1]US 8Ph2m ZYuIh=#P"Y[Åu0hh2h2hh`2h2Dž44Pj 茯XZ4u^h`2h 2h$jaÃu2h2h$hh2 h`2h$hh2 ؋]Ã= ?2UVSh?T[y`A2u!h%fYuPh$NXZ=2t h&$&X=C2t h)$XhH2h$hSH hB!SԳƃtK0SPh$jGNh#V_Y}E@ǹN1jSEpS}WSuVt ~u hPRD_[^tEPPRZYtb^ 8tT 8uE@҈$t$QP^^_$hw$EPY[thEX| x$t(p,hl04t:$VSG^_Zt'EPV4Ph$hS EpFjh $$ZY@h$h($S'Vh7$W'WhC$S׏$WLePh}D$S9S,e$ GPhT$> t0Gu'ha$貎[_tht$P衎ZYudXRh}&P% tjj h3",4,0RPj$W聟 S, tH$LDJ@t$SPWVh~$hFP) d :I21󫍝DžƅDžI2DžDžShQVN[ +I2Dž$f=t&fy!fJ2f=NEf=FX!lj$11J2J2#$t'wEH#$ȃ'w*A $$u(t#$A(u$H< uuƄ$jj h3",4,0RPjW詝 SWVh$hFP 41߹J󪉍$1󪍕$01ƅ0ƅ4J0,4f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`V~Y~ j!GjAej6Mjj h3",4,0RPj+RX (SGP+RVh$hW* Ijj h3",4,0RPj$S SVhd#hW 0E@8$@}‰Ѝe[^_]UVSPjjuVjjh$#@t.uXtjjVSjh$@u SY12h$SZYt PuU ^Zu S[ h$jԍe[^]U EEE EEhEPOZYtEU EEUhWEP#ZYtE1UWVSdNjEh$w Y^C h7%w ^Zƅth $3ZYÅGtQ\tBJ@u xt@G52@2$t.t"P҉^Xt@2$1ҍDž9@2PVYZt]P,40V(ƒt4t(RЉXZuaRY8ku $uP҉XZtԋ$jjjjhSQRPx jjjjhSQRPx h$Sk h@2PSAh_!PF h@2PPW(Rz^pT`~a9fhGPSǻhwVP費;h$S hwS蔻h_!S hwSu(t tYh$Ve hV>hwS Ph4c%S à ƅH1ɋÅh!ScZYu!Ph4c%jm à uh"S1ZYth"S ZYth #SZYth[$SZYth6!SZYtt hh$ hh4c%V< hSV- ƅGw PV莛à twh\#jyj:t1ۉ؍e[^_]UEEMU ]UEEMU ]UWVSR]} E$hgj6S u E$4jRHDjjSRǃu E17‰EuE@WV$XEe[^_]UWVS E Dž1D󫍕D1҃=T25[5mc h, 5[5迿¡T2 Iuujj%B[^1t,DžfDžDž#DžZv DžDž111Dž9tD5fDŽ5DŽ5#H5=fDŽ=DŽ=#@C8[y1҉tt1DŽTfDŽDŽ#DŽ@t1DŽRfDŽDŽ#DŽ@hjjjjjjjjjPPj;Ã4uh\#jեDžPS{umu5hjjjjjjjjjPj趛ƃ4tBDžPV XYZHօxPh_Sa[u?t6hjhPh+ @2`+Dž=T2yuT2DžT29Dži85Džy;F=T2i852/2@2ƀyǀLǀPǀTǀXjSPhCP@2"PjShX25@2,, 0$4(804$ DHPQHDFPj$@2()",, 0$4(804 EDH$=T2pH DH9jj h3"RPjV貎 jj h3"@2$P@ RPjP D28t$@2VHDPh$Rh @2$p ơ@2$0RRVP@2Pjj:6DžDž$PjZY6PT2P5@2 tP3[Dž~SWZYjƆy$RP,40W$$_DdžHDǂH5@2hYM1_ $Pdž$^@2$JZDHCǂ,ǂ0ǂ4ǂ8ǂDǂHƂ(@248<=T2tq52_2Y2tu 2h£2a1Xe[^_]UMw1vੈB ]UWVSDžDž@2*)Ph$hS w$t+h`j/^~Sh$hڽ ju\h7%@2Ph7$hSr h7%Sha$ǃ(h7%Sh7jlE0p1DžRJZYtuE9klEX{4Dž Ctȅtă{,tjjjRhRs8WPx yjjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CLPQh*%h8ǃ@YcLu蜟XZ=T2CLS:SRVYǃ}SRjj\*1jjW6:$$=SC`,tPh¼$hV& Vhȼ$P:X w$C`,tPh׼$hV CXtPh޼$jW WVLC\tPh$jW WV'STMW!t3#u8$VPh$PW w$$CH@[$CX,tS\tPh$hV! Vh $P5W $j$h$PW _X*$p$h0$PV Y^<$x$hD$PV XZP$$^0${TtH$PPV ^_T$$01)tt1ɍJB1;1e[^_]UWVS @2*PPHƅh$yhB!h"xۇPh$j$=D2t"@2X赇SPh$5D2 u6hvD2Zt Ph׽$ _XjjL3[^h$W$@2ZYDžD)SPBY^_PdR P,V dRh<$W$TPVAL$ TH\@H1;@td8Dh}:! @upWXe[^_]UWVS}19t2klwFLt#UFh7%PZYUu NPy#C19tklGx,uHPC171u0kl_${Tw$Phm0!hy$EP*I Ee[^_]US]EPu 5XYt$UtthքhRP9E]UWVS\1}󫍕E21҅aƅjPC[_1} tE pS薚ZYtbP,40S跶t;JP2YtJG89wtfE@ ]BujR}_Z 211҅t $;] t t B܉tEoÄhjjhhjjAjjjjh +虀4VPv ExtSx u^~19v}O19t }?;tBx(u PYFËEx uZ1&1ۋ9vx(u PXC܉؍e[^_]UWVSu1ۀ~ tD~9v,ً1҃x(u9t;t BPXCˉMe[^_]e[^_]UWVSQ8ME111ۋE9Xv-E؋MMQrPEPL tu}CˉeY[^_]UEPE P0]UWVS}EjjjjhSuPRx u1=jjjjhVu WPx tVSh$he[^_]UE8b]UE$Z2Ƃ@Z2Y2fP Y2fP1]UEPE ]UE E EE]ޖUS]$Z2)PCC0@Z2RCY2C Y2C1]UWVSÉME1sNփt[b2tM}+t B '1Ƀs,t+uAqtB KEE뚃}tB BBEEZY[^_]UWVSHT1󫍵EPE jhjjh jh5b2jj jPSj|Ã8VP+rS}1e[^_]UWVS<Ɖ׉E19S vMQRUSPL <]UBjluZY1҅EEEE9C M9MMQuSPL k}lE̋UЉQE܅t8tjPQHL >_4EG8EċUȉG[2)hpť ZteP ;hx .th PVTxPh@Z2nM@tO2t +9|qP5O2_Zupƈ YO21P5O2S_ZtãO2 1ۉ +E%=utO2@ h;=@tO2@ R+lPh7%V轒 O2O2<$Z2@Z2P%z O2CO2Ylƀ@Z2O2uFO2fVh9jRPe[^_]UWVShx"#_ujV [^Py ÉY1hy"P  ZYthhPWd =whh7%W译 =whVW虑 =wjW _ZuS[ SX1e[^_]UWVShwtVSx Vҿà +];]th$h$hh$n Ee[^_]UWVS EUMujQY[tIËE URjSuPNƃtPEV XZ]e[^_]e[^_]USj$u跋ZYtFEXEPjhjjj EPS‹M Vt9U wj$S믋]UEPM UDXUEPM UDXUWVS ljDž<Piƅb Ph%$Vd <PjY$t$Ph4$pjXZ$u$Ph2菿 Wj&U  Hvw= ?2uj>_1\+Dž@+Džjhh\R$iPj(Uu1 h2h@+W 3"=\+u.h=+h$xZY3"u=[+u$WVRh?$h衈VSq = ?2ujNXDžjhh\R$hWj'OT-= 2+=`2=2hX$Wݽ Wg h2Why$Sfb Wh`2h 2hl$jˇ$VSh*$j貇Whe$j蟇Wb VSh Y^DžWj)ySXZX=X2tZ=2tQ=2tHhX$W W螹 h2Why$Sa WhX2h2h$2;e[^_]USڸtjS' ZYuSh$j軆 ]US1AtjS ZYuSh$j{ ]USSF9tuRfEEPj%DREZYtt`Huƃuj h %fX t&jR h %fYXKuh$jTׅXZ1]Ã=O2uiUO2 (2$į2$ 2z$2a$2 ȯ2]USE] tPeYSj=Q4eXZ2E] UWVSDž8DžZ^1Dž@DžDDž<jj1$赬 t0hh2h2迮hh`2h2諮1@󫍵HDžP@[2jjjY ǃ ~Jh PLji RP0 9|yh$h$hh$ HhV̴LT jiFd(2Yu%h@[2h(2K =_Z1ۅP[2؉ى8f@ @ #t9ujjjjjjjjjjRSjlYÃ4u jmc8PSNSsZk8t@[2Ph(2謸 [=2tjjnXY[DžHVjNHXZtt T1ۅÉ؍e[^_]UWVSE=2t h`2QYESSlj$<$SPh$hP jj: á2 uWHZuWU2ЉXt4t2hoaujPjPXVS t2uPX} tExuh$jhY^}tuWh-$hMƃWhV$h6ƃ S S=XZt2t2Wh\#hFajjD=2t=2tPhz$jȀ E@b2t2e[^_]UVS]u StЃ uh$OX$$-t7%jjPVSe[^]UWVShh]$*2_Zt Ph$c [^211۸+P*t 8tb2u uA؄t 2Dž+{52*z;ib2\2u1uSZYH0252j5[5΅5[5=5[5B322P52h$jaR_2Pj Jtub22uc 211W,t+u@*u !xtb2uƂb2A뻉t/ 2'tju_Xb2t22u9uh^jJ 0VR525252Ph$h4^ jj[^1ۃ}t_b2tVh$h}ZYHu%h&d^j^_th$j}Y[h'$j}hS$j~}b2t.}ho$jU}XZ }h7%LRP' urh$cLxRP' uT|9u;xt8h$h$Q^_th$j|h$h$TM蛙}uuh$jT|Y[ju%XZ1e[^_]UWVS+{t,t#W3PYZtWh\#h}\ 11ujhXZe[^_]UWVSDžDžh($&KPh\#P ytQP_Hh $JPh\#P xh!$JPh\#Pn y6륋tPv^uh\#h-[jjH [xPuhl#m ƃ t YhB!P菝 [Z1ۅV{ Wuuh\#h-[jjZohA"W ZYu®$u諢 t/Wh\#N VhW u<=uVƟ 軟 ^_vZYuu^_uWh*Zj7ZYuGu_Xtjh,>[^1jh-,ZY m Xa uj_ V ؍e[^_]UWS]S 1E CM [_]Uu uUWVSSu] V 1EStet_klЉE1}9z4u@l;Uut>FjlPe‰FXYt(1}9{4ukl4 @l9]uް1e[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF9s wEtEȋỦEUEЋUԉEU؍e[^]UWSPU] 1׉US)ZUtÍBٍe[_]PUS]s qs$iXZCE]XUWVS]193v8klCxdF@0 ttW X9vklS9zduBd@193v>klCx4uFtWZF 9vklS9z4uB4@sžXCEe[^_]鲾UVSjhPjuÃ1t4uu S8 @uت0Sq˪0Z1 SpXe[^]UWS] 1Sh|duu t#S;S t%iSR3ƺZYt3X1e[_]Uu hzd@u'UVSujhPjV裞Ã1t(ju jSVV,S2py 01e[^]Uu hedAuUU EHJ Ju BklsM9N@uLM9NXZCH@H th$v&Y_CH@H@th$vXZCH@HE $FEe[^_]quCHP5252hi$-+{jPMQKQWsPRdk B(0FE}WP52hi$v{0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4H8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhH SPXZ1e[^]UWVSu jFHP]S趎jSSjjjjj ?H,E܃,11t]DS@uu@tA^Ht҈Uth!"W>SZYUu CcL'/t C/jWjWS# FHHL1e[^_]UVS u vDh9l&j ]Sa j SSjjjjhwG0SYFDVHB`1e[^]UWVS jj%[^8hBC hBCChBC C, E1҅t_tZ $tOE4F }Ou/UDEjh}EZYUMB"t}$vuh'BF X}$th$h$hh$S jjjjhchjj jjj%SjM8ƃ4xu P .V9S)e[^_]UWVSQE @4uE x8u-u uyXZttt =t ujj |XZ{ 1҉j4$U迊G bUBYXu؍{shAh@Ch@C h@ǃjjjjhhjjjjj SjM7ƃDxu P,Vl8S1e[^_]UWVS] ;G(S119tuklKI0@戍jj h3"GwwgRPj!V@- jj h3";G1҉SW׋cRPj'P- 8ɍ}th?jPPWbE@ tP?jPPWP3"u hq?Xpb?0Q?'QVMQWRPpjjAĚ2,jB?SPhd#j -P, Ě2jC>SPhd#j :P Ě20j->SPhd#j GP jD>h> %YÃs2Z£2~ް-T1~CVƄ5T -߉TPh$jPh2A j.>h2P5252GP:P-PhI$hh 2 Dh\R$ CXe[^_]UWVS] @2$DVZY7V,(C8@4jP聡@ x 1;4}aGNu CP@@<098v SklLT<R+A<Q@+QP$@ ;,(}fF뗋8@} EhojjhnjjjAjjj4@hi3E4URP(uN4@Ҥ}j8Hl4^_j z$YDPRH89t0u+QP u,p[1k lCx4KS 19t;@8 QPWRL Q裗e[^_]UWVS ]u F@klPv4_Zu1FJ MklV)tklR8RD8lPr' ~1C@PsXYtM< }C+EPWD UP%'}1E@ ,USV$fCEfCFfC SVSe[^_]UWVS]Dž{ u'1u$RSPL uC H9rˋ,0 t4u׋$(  @ƋD;{ s$RWSPL ,0 4$(; |>9 |B9 99 QVu5P21P5Ě2WV ?RPWV ?RPhu$jPTS< ,D@u5P21P5Ě2WV?RPWVs?RPhu$jPuVه ,VSjhmGe[^_]UWVS] EEPR\E^1t1Ƀϋp EDEjP[C$ZY1҅p9tD ,B 0T02fA }tAkfAAkQ 1BB uBfBB B BofBB )9Uth$h$hjh$辨 jEjjhnhhrjJjjjuPh 2!C(4ys$虒C$XdE<}@C,Ss(X^_{,3CE1E}9}tLk}l{G0u:8t4GLt.MUGh7%PI9ZYUMuBy GD tO@E묅u}u6VLYtk]yvpb)Nj0W)WPjhpB)Nj07)WPjhV Zu(V_uujVY^ƃu1s$IC$s( C(XZ11e[^_]US]t*h7%S98ZYtj/S˃ ZYt xu]UWVS]u}tE)GWEURPh hb2uyG= uʋWO uEueEtMUjh$hb2О UMutt3"E U EUh$V="c2)uMUjh0!h2c2h UMjQb2 t2c2tƀb2HFu޺'c23c23),T@DDžXDž\S ^@u.DžXDž\48@DS<<j1RP<@1RPXPS@D DyjVz<<X \[  t@ D@ ڋKWVRP0ٍ4@DD49@D8}48+@D6@948D}D@D+48Ή; }48@D@9D}0t'j8XYw$(@DL蚄,菄XZ@DeY[^_]UWVSu vv0N ^$ t(N^9ȉ} )ӉN ^$F F$FV1e[^_]UWVSQMLqyA Q48AQDHLP@LCS$(WVSP|+48׉PT P2 uPT1ۋ48DHSQ<@RP.Ɖ׋<@SQ84Y.)׋H9T<@u<@D9Pt"SQTP .<@PT,0P9DHT}DH,0<@ ;<@}  @ƒ VWY_t1Ҁ{uhU$bXЍe[^_]UVS019tklYCLu@u19t klY{,t@klA[^]T[^]UWVS<Ɖӡ@2t*)t!jh7%h$r DžjjPPjh+@t=ƒ u'@l+Pjd=_Z@t p+h`+j*@2Ph\#h- =l+@1h7%h$ ZY@2t )uV{XutWP Wp tىߋNA4jjjjhVq8PSx 5p+l+4$h$hSc WVSh$j((WpYh$jXZe[^_]UWVS|jP!_ZxIǍxPW;Y^x- uhVW! =t W'"ZKW"Xf}u1fIҁ󤉃EfǃU1e[^_]UShEdjjEP]Sh.$ @t2h`3$S)ZYu L2hA$SZYuL2]U$E]TUWVS8EEE@2f(j@2$u}jjjPPÃu1 @2jjHDjjPƒt͡@2$KS19};DH} DH5@2$Eȃ=H2ufjj]Sjjh+y EueH2_uh0,hF$ [^jjSPjh+E=H2EċEE;E}k]T EPVyZYt E@Eut@2840h$h6EPEPEPuDx!}tuuuh$h(P2EPEPEPuD}5H2 LMhhF s{jheWVPVsss shW$h(hMЉ P2hP2j, P2u1EEԋEE؋EE܃}t+EPEPEPuBPUԋPU؋@ Eܡ@2$tuuuR@2,jhP@2$tKytEf(u;PHZHt)@2$P@2ǀ$XhhE^XkEEEE;}SEučL H2AEe1Puqqq quhU$hME$럍EPj-tEY[kUDH2DP2De[^_]_UWVS5L2t/uFujP]d SjthjXZe[^_]UVSPE X(uRpjƋ0_VPsjhS uƈEh9jj Ee[^]ðUE1Ҁ=L2t]M]UE} t=L2t(q1]U ԍhd$hp$j!EjjEPEPjh+? $@tE Eth$j XZøøUWVS,]EEH2L2uCSEUCSEUURURSЃ tԡP2@EU @2;\`|.}t1hjqY^uCP@sK t9։}ȉH2L2 5H2 L2EEЋEE̋E E1E}E,EE,U}Fhj辏Y^UuE${ v t$u$у E u7fUu)8t$EU=@2;\`|ɀ}tU uRIE (Ѓ Ѕu uuth hh6XjʎZuVh\#h$$Se[^_]UWS0]}ȹ 1EEEE =L2ujjS@ jP4E܍EPjS@e[_]1@2f(u_UWVSQE E1Ƀ1} uAu@uFI t }DZ[^_]1US0]U t/MQRSPL tsuuh2$j3]UWVS4}=L2PklUVE 0`XZE UlVSClP 1CC,C0CLCPCT @2$F( t19~ vJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC Xu5WSh$UD2 tYWSh$P!X 5D2f! ǃgSh$jAjPh$W/jvXv\v`h$Wj,Pvdh$WivTh$WiDž;aS 4`$PsP3Ph$WiC P u"KQPS RPh$WoiH;~h$h4!WJiZY^h$j.iW" PPVh$h%$jÃ(Vs Xe[^_]UVSÃ=2u 2KS19Ή} ǃ*@89| {v ǃ@ ǃǃ[^]UWVSE Eu}hj@ZYǀǀjhPju%@HC,PhedA# x.u=;|1ҋ9}SCY[^~1E u CCCs {$s{ECTCmYDž;G u ?C <t+<yWǃPPPG1RPtA8thojjhtvjjjAjjjRVh虼E4URPu~V.}/1Dž4Dž89uv<`RVSPL t$hl`d48FjHE)0F ZYw1<@(,9H%D8`RpWQL`R7}WS jj84@h jH^_u%D2UPh$蚺 Y[UjSѹZujhQ_X1J5jS[^&sjhs@2@u ǀ@>U1]EEPV~XZ}y1N1҉Hùxt%| q1@ 4S-|GEE;xrB;Us E11ۃ}t E;]sP,C_PYVk5p2XZ}1Ѝe[^_]UWVS0EDž}uEf2jSC^_UjS+ZYu`X0jS^_u;0Y[ƅDžDž922} tE 9WuE(u)tURZu#;s{ E, UHD9Ɖ}djj h3" WVjWՠhj蝳ƃ 3葳WVPhR$VV V ƅ3\P ^_00@ Ms8cw؉1@uβhh²jj h3"E,MH},DRPjV譟E$hi`RjPESYƉ<$T1 ‰$YSP8 S[Xf S $mf <$S W3VN9r$h]$h $hh$/ u莱Z1hjjjjjjjjjPCÃ4tPS裝_X1;s <1;t4z@YڅttV]ZQF; t S螨X1e[^_]UWVSljfDžv/ƅujh %Y^yhh %S" p脟t0{8t&qWPhy$hS^ Džp!shWS =vhQW Ƅ/QPhZ$hS j/S _Zt-xv9tH9s8/t@QYykߍxPWz YZu^%=u0p:>(hQS n=@uWXZuhWP =hS^2 Y_Džp;/u1{pt}S7l<$#ZplT =w9puhh7%Sw =whWSa =v ?VJ _y V&YV$ ZV X1e[^_]Ujh$Hj UVSÍ|PSx Y^1xeEt\jSXZxJj \PS{ t SY,S\Ztf u Ⱦx1e[^]UWVSEUPA [ƃ}t1EV Zt{fx vX jh$S uSuhy$EP'j @u hw"蜢 3Et}tESWuhp$juYzV XEEe[^_]UWVS h$11tY+ڸ$xuڸ$nu#WSv XZuWSv Y^1yah$腛hPS WS7w 1u h$_PSh$j Sh$j7hSv h$SȚhPP+ WPv u'h$S藚PPh$jh$̚hPS Sh$jot!Ph$h$jKuh$S"hPW h$SPWh$j,h$ShPWR h$SҙPWh$j,h$S趙Ph$jMh$S蓙Ph$j*h$̙hPW h$SZPWh$jc(h$蒙hPW h$S th$S Ph$j h$7hPWE h$SŘp14+Phy$hW{ ztpWh$jC utjh%DXZte[^_]UEt2fP]USE@k ` $t!` $ShWE 0 Cx2 ]UWVSh表ƍPhW@j @1jh$_ZRhW@Pq 1Dž w\k ` $` $u Dž"BVP ZYu=t2DŽGjjjjhjjjjjj!ShyÃ4tj菨PSғSRtXe[^_]Uy¡x2tRRPPPh$jUE @1]UE @1]UE @1]UE @1]UE @1]UWVS(Nj@E̋Mȋw1Ή}1lj)áP21RPSQLRPhB#j]S ]СĚ2Eԃu6VrURjP9jPPh2 S e[^_]UWVSĀE@kl} GNjE @] CuG u G08uw0EEEPj 1[^}|E MQw8P uEUPuYIG8EE u9pwk]lE X{8tIC] []19Mtklu ^c0AO0u uu ]u]u t;Uu}UEG0uW+EU] CS}t ]U]EUWE ~ 3"1e[^_]UWVSlu} E 9FEklNA0t ]h URjP2E~W0+u@u8H=uPEPhl$Ept uX} ue[^_]UWVS] j)臟{X1119tklSB0u z8t @މɍut$j,;j+2SPh;%jPVF j,jPPV h4!j*URjP3h\R$ӞĚ2j-ԝSPhd#jF^S j.踝 h@"$PSh{$hh2 e[^_]Ätj+臝jPPEPhUWVS8Ë@H1{${$Csu19UtklD00 tfA A LB܋E@"$fG G5GG G,G01G8G@Ep x$+s{ EM9H v%MQuPRL t Euu}EыK19tklSB0u+2z@s{S(xE+C$PRXZE+C$e[^_]UWVSEU΋}EEEE;E k]l_C,EFU;uFt8tKQP苫 ZYuk{8ueEC8EC4FV SVC CMfA@C e[^_]UWVSpEUEU EUEUEUEP 1E}8WG;E}}M])Ӌ}O_ ]u]u]u}GW9E}} )}GW E@jlj}G[^u2Ee[^_]p"$M=9ËMsBEH19t6kl}Gx,u xPtB@@@ EPEP5@2K EEEE1ۋEp9kl}G}x4@8x,u%PPtpTRjQ8 t }WD2,}Gz(tPPtuH0 x,u6}O 1T1EpF,uE}9xs_]ZuU~h7%Wפ ZYth$WƤ ZYu;F| ]]]FPu FPuFTC1ҋEx(uPEt1t,BE@(9P v7]SRUPQL Ut܋E؃8uNjE@(jVuMB 1URSuPL uCE}9_ wFEuE؃8t EċU;E}|EU9E}|jVuMĉڋE WPHEUE@EkElEX]9]vMEMHy8u>EpxP@EUH2L219| EU)AQ1@tA"$SwE@u9ukUlЃx8uP@P ExE4FVEU1;EE}wV9E]}hM9MvUM]+EUuuRP趦UUMNk]lMMUeʉT EUVEP$@ ]+CS EU11ҋM9MvV]9]v klTu9uv klDT ]u)։]u19Mt-;Mt";Mt8uW t G0u)EUAl΃}}9} 9swkulEpu6xEU+EUuuRP臥UMeʉu}9}EUM]M])ڋ}WE}9xvsCM] uuRPMʋUeʉ;M}|;E]}ӋuEFX)M]ExuFVEU1;EE VEUF<V@9E]|F0EU9E]E@;Ew`;EkElNjEU+EUW19|WG 9|1GEUVF0trF0O0fEUӋEU+EUuuRPϣM]^k]lUыUeʉT EUVVFV e[^_]Ëu9ueEx8XpPX t 94X*UWVS4PEU 8 PpHP0x[j0Pp0ZYu2Ee[^_]pPPRHHLX4@ 4_9_$uDž Dž$;GtHL $0Dž@Dž(HLP@9(k(lPGP0@ut (@0xH8t54t@(SQPRLP@ D0u+s{ 19}HLHWVHLH $(09@4P$@ ,+ $P+HX k@lp(6x19}JHLLHRP5HLH׋(P@ $1; $}_(H119~.u2FN<uF EuPEXZC΅ju[ÉY_E1MQ}~ E;UڹUfB EB h5jjujjj(jjjuSjfƃ4uP\VgSEEE܍e[^_]hj XZe[^_]UVSuE ]wi$$$h>\o A[4h?2[2ǀ,ǀ<jWPל hW2"PÜ =2u12ǀ2h,2alj_ txL2tByu/29u2ы9u􋐀뺃a2OHk<˹1󫋅F@ FBB )t B8#$t6B8DžDž$u1G9x vRPVL tLFj$t}_[Bk<W󫋅G@ F$CCC C89X RSPL uCuu惽t݋rI__k<ι󫋅F@ FBBB B8g?1fD @9v=2t1&$󥍅P[&$󥍅PY=2teDžDžDž2Dž0&$󥍅PDZ=2t1D&$󥍅P XpxÍ1 B T B 2xHfF Dže[^_]UU J E]UWVS0ljUĉ1ۋE9}oFE̋FE11ҋM̃<tN9tKBE;UuSuh %jUR苨 2Uօt1AMRP[ YZt MЋChj)XZe[^_]UWVSPtIMMQt>TPRL Mt.ẺEEЉEt E9EU} UUM|>XuC,@utVF$t#u0ˋEwCe EF(N,ʉF(V,FP2F#~ye[^_]UWVS 1ۃ=2u1yl2th$jW hB!W藫 ƃQWh$jl2ppp h$V h$V_XDžl2k,<P,0uh$V_XDžl2k,<P0uСl2p$p pph$VNh $VC h$j4V jss l2tPh!$hj pCl2PxZt{Wh$h0,軩 D2 Wh$P蚩 XR0PRY GPZYtUOTtM8jjjjhRQPWxl2؋QP :jjjjjPqTRWx Ph"V :XwJ0PR连 GPZYtUOTtM8jjjjhRQPWxl2؋QP :jjjjjPqTRWx Ph"Vj l2t裇VPh6$hOh;l2thK$h,h l2th^$h h l2D؍e[^_]US]1{u6{ t; |C2`F!{x[]Ã=į2+UWVS`1Dž1Dž02PzZ2Dž$9H QPRL 8PV蚜 V /t h7%VlY^502 RV肹 YZ9uJt(tR裚 Y蕚 Z9v}tt$;H s41V D 02$Vhy$hP} 502g!u3"PP] XZt02PtYV^Ph$hEe0288  RPVhw$he$tt;,($ PRPh$hd$!PRPh$hdu&02@40|81e[^_]1US]1{u({@uC42z${x[]UWVS22xtl$u ƃxYPYt0$xt=jjjRt)PZuD2Sh$xÅtD2ySh$e1=2 2P_2pt::t/}9z@u'} 9zDu}B@B AH뽃=2EËl21ۃtP}tJEJP1}t(;1u$} 9yu}k,DPx@,0uCp뫃=2EË21tL}tF:J<1t']9u ] 9Y$u}t#k8D<@8=uF1ۉ؍e[^_]US2;@2t92t329u2ы9u􉙀[]UVS0]u$MQu PRL t!21:uJ Jt;@ =uiMȋu1k 92u92u92t(Bu;k 2]ȋủ22ǀ2ǀ2ǀ2e[^]UVSMU192u2r92u;t = u1[^]UWVSGDž2Dž|?1$%$9p WVPRL } t} t!} tWVS jVSOx k|<$tjjjjjtVRPx|ǹx󫋅tfDŽDŽ#| Fhojjjjjj |}@Pjj|Ph/Ã4u1}=PSd$S/ 9|vΣ2k<}Ee[^_]US<] EjP2ZxD1k8|<u$MȉHPCdž$X!uCjjjjjMQ3PRx } t E#} t&#$URPh$h?SjjVe[^]UWVS ]u Exb$jjjjj}WVPRx Wh-$hR u-t4t|Z~H|e[^_]UVS]sjhz$Vz u*Vh?$h{R P@?jh`F!Vz u3VhO$h=R 0|1jhF#VFz u&Vh_$hQ ugtX@Ojh:&V z u$t9VRhm$hQVh$hQ u ƃy1e[^]UWVSt1=+t=2u!hpjl2Y^u 2=į2t!h8jԔ02_Zu į2=2ujHj覔2Y^u 2=2u!hju2_Zu 2l2X2P2T2p\2`2Pd2h2022228 2$2P(2,22<24282H@2D2PH2L22212222B 282p2t2tx2|28222+1󫍵MڍhjhhhpjRjKjjj@PVhx%ƃ4u 2y2T^SVV>& =2uL@2$t>2t5xt$hZ2/jǿY^tjjDXZǃ=2 ؍e[^_]Un=ȯ2tuh$jP N UVSuu1r$ugjjjVExÃtjjHDjjFPt$@2KS;DH} DHe[^]UEx8th"h&$hm h$m @UWVSQ} E@E19u~aEX=mu8u?G8.=lu8u/Gx=guWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$,6$zuubPrYtWWZtNjE@ u WV0_XWPV_ tjVS_E@ t VPZYVXjjSƃx2 e[^_]UWVSu uUYP}Ĺ 1󫃽PuPZt苅P$S_xt2jjjSǃtSYt P$SPHHLd 1Zw j&$RjP8x u0h"h&$h h$ R_X茈S耈ZYvrXue[^_]bUS]sh$j4@ ]]_UWVS} EX,1t)C@WPO/ ZYtCWP?/ ZYt FӃe[^_]UWVS,u}E E thi&h ($hh$誝 EPu[Z1ۄtbjDjYZYtQ($u CC4C8"C1t4Q,1t9E t @11tt:[]UVSQMp@19|hT$h'$hh$Q 9ù|@89¹@|1ۉȉڍeY[^]UVS]1C49C s6SrY;C K$}%jjjjRPRPU Ɖe[^]UWVSÃ=2u1t9;t42E21;}tSB UP% ZYhG"EP7 XZt(*$>ttVP_$ YZuG C<e[^_]USPQRh$EPjC3~vh4!u;Ejh'$P\ t0u|[GhA"EP街 XY:tjME-[h4!j;EZYuu|X1]UVSDžPTRPRP( !"TuPj(PXSn^ P|@uKhmSPhd#jxuVo VSSd$ uhhn#h'$hh$謑 e[^]USEP]Sc+XZ1}u!]UVSu EP]Su) tEHw q11}ue[^]UWVSÃ=2uEt9;t22E=21;ut}Sw6" ZY ZY{E @ uC F4V8)C S$E+C,t9tVpXe[^_]UWVS EEM EEEEE@,1҅9t B닓uF t t9t}{09~u;S,tShjkY^u}2Mu6lj󥃣E0jMZuLuVK89N u;S4t EP @+C4S8u)F V$U؍e[^_]71e[^_]UWVSuM~ t-^,11;E t9vt@ڋut $1IuF,tF0j:Zu S oXN C4S8F V$e[^_]US]{ tjjST u]UWVS\E E thQ$h'$h=2uh\$h'$hh$Y uhe$jPJ& 2uhw$Pjy$jDjiY[h4!,XZƅ1Džh4!j,ZYwƅDžDžhA"P YX>tރuNtjXj jV7  t t/j jVj7Kj jVR7 u7thh$P  hVP   whWB#V; YZuDG8PW<G4heB#V YZu)+hHB#V YZu)j h'$VSK uhjfXZu,k[1;WjXj`VC@PM C,S0C4S8 u2t)CQ RP ZYuƅu_, G 1*E u^ GGGO_O _$UWG@jhRjPJƋ_,tnP4tKRPPs0s,Vt'8t"P PaYX@8u ǃC4S8)G W$mDžDžSh|dVH iR`ZuhYSh|dVzH u܋19v̋G,tpH,9H0u0;u"H49H8u;t밉jSPzJ BuVZ1e[^_]U2t 1=ȯ2]USYSYSY SY SY SY SY SYSYSYS1h E#RPU[ ]UWVSEUPUfPfUP Uf@fEExsu>1ۍujVk*$Wu uu wu~I u]CuEExlu<1ۍujVk*$Wu uu wu7I uCuɍMU Ee[^_]UWVSu] t>u1}WEPEPEPEPEPEPEPEPEPEPEPhQE#V:d4 uy 2CFU,U9u 2@Ce[^]UWVSƉӉϋ@VEUFV EUEUEUv1}tF2]:U)SEC KF t h9!kE UP< XZe[^_]USE PMk K( : uBu'@ ;Et0j RkU P 1]UWVSUE}u NtGtRutGtvpS GPh9l&vSB FD64t(vtvPSn0 e[^_]USR] = 2uj EPuk =w uU:tt*haX1kD2ľ2ucÉ؋]U U1vEEUEP[U EZÅt*UVS14^MFZuSQMXe[^]UWVSu>pX19|hF$h.$hxh$b 9} ǀ!@89} ǀ@ ǀe[^_]UWVS0]u=@2U։@E =~Mȉ\LJ`}@8;CC| CP1RPv{ tfURjSPL tSEċUȉúu@ǃ9|Ɖ׃!! t9׃}sjhse[^_]UWVS]`t0`󫍓0 Se[^_]UWVS,E E thQ$h.$hh$a hjF_X /$u. CEU^~1CCCSƉ׃s {$Cǃ?ǃjh>RP@ǃEPu裌ZYt!EԉE؉E܉EЉC1҉؍e[^_]UWVSSÉ։ʍNF(E19t<v u1(G 9Muߍ uZ[^_]US]= 2uv19 2v(1Ҹ9tkD2B=v1kD2[]Ã=2u ^<2UWVSƉ $41󫋅 EU RPVh.$h4P< E jhPjV)x5ShydP( @u VjXVajSu* 1e[^_]UWVSluU E EE$EEPRV U EPbJXE8t%E8h^$h .$h h$^ 1~,u3FuuuUM~ uxMQWPRL u GF,9x wËEċM9Mu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà j}w}t }t#1R}tPh7$uPu) 3}tPhz$uu: ]Ph$uu: ؍e[^_]UWVS@Ɖ˹1jhPjV'4DžDž1DžDžDžƋ!DžuD1 RPhS)=fU=_tP9u9uI!ֹ󥉅R~E^99:ƒ<<„t <{n0dž0Džff=Ut f=uP(,DDž1Hu1xȃ<u*UuF,U-w RXЃtt uQPP,1RW蠲P PXx 8t<t+@,dDž $tf;,vPu1hjo>ZYt'DžDžDž Džx Xu1fǃUe[^_]US0E E thQ$h.$hh$W hj=XZE u CEUY~1CCCSǃ?ǃjh>RP@ECǃ1҉,K0SSEEZ@uS[AM{ uCC$9K }2URjSPL tEt%=u SX1ۉ؋]UWVSSӉMt]0uƀǀǀ6,0Mt,ƀ)߉)X[^_]UWVS uM}] MWЃ<E‹Ut&`t[t hZEW,SC { Ct{UǂǂƂ}DtP?DX}1`t05ǀ`1ɉU슔׃ttAuEEU‹}싊M9`uƆdždž{019t0DžuCp$q00e09u+0t!0uu;LJ0MM`UE0 Ee[^_]UWVSdE}Ĺ }0}@S€t E1}t ߃tu‹}9} uE@u9t$t}ha}[E1C1EUWSRP9؉σ}1ɉEĉM11҉utfك 9E ty@tI`t?1 Mtt΃t}t 9E t-@Guˋ0Bu}E$1;]׉u0ƒt ]<*EċUȉEUE`EUEUЉEUEEEtR}tƒtO<tK,]CEEK1M];EEE9MEEE}u0u]su< MtBuh"hD.$hTNE9EċEȃ}}tth+}Y%UĉUẺE4,M9sMjPEpuMUy}t E$EEEEE1ҋM9MM}ẺUЋE,uWSE*E tE tEUEU9u ǀM܅t,DU9ttP:u UDXZEtDEtT9]u.E9hGjjEPi E̋UЉEUEċUȉEU1҉}ttBuh"h4.$hlZEM]M]։uE9΋u})щE"}REDh$PO Ee[^_]UWVSE0E}Ĺ u }t EE @uh?$hT.$hh$N u}EV$}EEEEE u v ut tu!]\JMEJ1ۉM]E}u] ]t3] ] €tu$}EE EE PEUE;EEEEUEUEUE9EEEE P @|UEU|UEUE9EEE}}uEgE`ut,1EUEUE;EEE}ދ0Љ/E9EEE|t1EUEU,EtDžx1tx;EE|,9t(9ME|}E1hj_2EZYEfǀUƀElDžpplxt9uE|N1+u}ủ}ЋE},ujPMEXU܃ t$4t9tP5u 4Y^E0^F1EUplRP։щEUEM9}E,E+u1u}u}uĉ}ȋ|U9E}}EU+EUẺUЋEujPEkU܃ t$4t9tP4u' 4XZ;]ue0u\E,9EE}Hhjq0Y^uE82}usvu,fǀUƀ0Ë0u00MME`US] v$}tM M}E] ];] [}ME @EjQEpQMUE<EE1ҋ]M ;YA EEEEEUEĉUȋA€tuJE]EC1EUuuRPӉ9؉ʃ}1ɉEĉMȋMċ]ȋEEEEEȉEUЉEUU9UEE}EU)ډẺUЋE\^UTuVuEU܃ t,ƌED4t9tP2u MD4XZEDFEhGjjEP U1?t9Wu} @u1Em1EE1Jtd9@˃tuLu0u}t:u1KMttt}t9tv@Fu֋u뷃;Uu1[,ujSEU܃ 49Pb1u 4^Xe[^_]UWVSL]E EEEut,C,uC0EMċUPX{,5ωu1)U̹ 1󫋳1E;E}u}uĉ}jjjj1RPWVjEPS,tEUEĉUȋEUẺUEؤ2jMQSMċUEG uaZuVh`$suuuus$C,u*E̋U19}'SjRPuus $C, X({,tˋC,tPC,e[^_]UWVS0ÉDž1@jhRPSYyPhd@ @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< E EDžh1󫋅,t20t"uh"hd.$hh$C  u/ƁƁƁƁƁƁ} }t~1É1uvB? ӈD>1É1uvB? ӈ49 fDžU1 WVщ#DžuAWVhPx301#^uPƙ9uI9uAH#؍S\ƃS+Y9m9a) X؍e[^_]UWVS]Euh$hp.$h ,1uEEE1Ʌuh7&hp.$hh$@ s{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVS]uh$h.$hk h$b@ Es0hE?t SE<;}u拶0u͋EtP^C,t PY`1d*FZus)X]e[^_])UWVS}G,t PXjhPjw Ãt7WjRF%YXtRVSVv)SZWXe[^_]UWVS\E4h[E0h1"jP]S jPSSjU S Ǎ@Y>w̋E0h1"jP]S jPSSj! S ƍ@Z=wʡ@2EHDEU}~EERWuuSVRPމؙ9Uu9]tAˁ~ƉЋM\ǁ`@EWVSuE E0E8e[^_]UWVS]E E܋EE؋u@20}481ɉUM싐HDEU}~EE}u?;E}9jh>uuE=~EE?EE܋ME؉8EtuU؉UU܉U ]e[^_]e[^_]UWVS ]@2480h$h}WuVEPS$xuuuh$hWVEPS.tuuuSЃSe[^_]Ujj  j j P@US軷 PJ $3"PSh$h0, j U=+u +3fPftPZ9+UWVEE왉UE}ujEPj e^_]U0E EEEEEEEPEPu ƒ xEÍL$qUWVSQ@@u5jh3 333333XZjP 3333+33^_39y933s=3󥋅33DžDž=3uhjoj+(tv!j jj> =3uSh!Pj 3Y[tPh\#hP8 X3319߭y{!ݝ݅ D!߭ٽf f٭۝٭y1d~dWh#)PP Ë53~-3t P Z)ƅ~:ƹdh3")Vh$Ph!#)PP  Ã11ɺ9st @u4$WVh+#)PP ؉+33+ 3y @B{!ڽ߭ 3319ظw ȉ߭$s9ٽf f٭߽٭?ٽf f٭߽٭ʿ 9ƾs tGȉݝ4$%1d PSQh8#+PP á33;33)ލ ;݅9;}hZ#VQ^ à +33߭߭ٽf f٭۝٭?~~hM#rtPh!VQ Ãh$VQ à <ЙRPhg#)PPl Ãuh4!)PPB à 3fPftSVP eY[^_]aUS j X]UWVSu tT}tNv;Ev 79u]}9s$;}t:CGGPhl%jS E1e[^_]UWVSuE E1H-tt:to tjUx}HM=,DWtDOu 1>uxu 'tjjEP  FCEyr؍e[^_]UWVSujuZY@t)Vu SS9uV 7؍e[^_]UVSu huà @tuuSSG؍e[^]U|EPu~ ZYtM EUQ1UWVSPu} RUj S UuRjS tw)؉@))ʉ u C u  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U 1XV Sh%0 e[^]UWVSWPE褰ZUt r$t@s΁ǁ u K tJDz u/ t+ <@uu RUR^UujB@ft Ks CAB><vD&0r UV YUw{t)1BȉCXuY t~z txj<TZu h$/XYǃXf@STP1.19Xv$kTрyus1TD@Du e[^_]UWVSSƉ׋|tQ9t3{ t- ufujQMP" Mt[ S Vh)%. e[^_]UVSÉ1uT%PSʥSYjS>"u\%PSXZe[^]UWVSÉ֋8 Phk%(.YXuc%VSzSjj&C <uj$'XZe[^_]Á@|tcUWVS։ϋ@@tH{ t=  t1҉C[^_]UWVSSƉ tB׉M6iXۋMu hH$H-K   Y t6'Z@uhH$-Xe[^_]UVSÃPt3PT~t` PXPQ ǃTXXt3X\~t$ XXP ǃ\^ht3hl~t hYP ǃlZt1tV;C,X ǃXt1tVC,Xc ǃXt1tVB,X( ǃYpt1ttVB,tZp ǃpXe[^]UVSFjjjV>jt}LHPjVfg<@@t@s s t<@SVgXZe[^]US]jP螼 t@tky ^y c 7H ZYt&ǃSh6!hp$*j$# ]USË>uQh%SXZ{LtS,YtFtSHt<"Jt%PSϐXZ]USÃtt1u?hvPxtPh%)RP{XZtu]Ãx t_USËu1S%Y t=uS`Z S+YuS)X]US]jPĺ t*@t h$(j! 0u jP!XZShǠPn]UShSE09 u 86t"h$(YƄh0,S٣ XZ]UVS])RP׹ uh\$'Y;t D8t@h, H 1tG ,yh,j ' XZ,P, ShǠ$j'V e[^]UWVSu~ t %% Eu s&`u!VY}t u\1ɉ%@Eu s`uMV&Z}Mtutj`aY1e[^_]UWVSE<@ف` |8tf%ځ tWQYt ߉%ځ@ tW"&Zt 翉%ځ` t1r rr%e[^_]UWVSS]%Nj<smuf|0t0V=Y%t1҃w$R Vh%$OvSZ%tw4$Vh%[$ZYCth%m$j Shj+<ǀu!-t茕 Ph%h0, EjEP4 @u h%$X<j4P4(ǃ4W$e[^_]UVS]hF!#<Zr:|0t~ u hc%VъYXvjXZe[^] <]e[^]UWVSD]u Cpt,PCMPhj@EP裔@uh$"#E_E{ VEPW3bƒuVWh%" ut#Ej@VCtP VWh%"UCtU3_UXYt&MLHRWP^YMȍe[^_]UWVSÉUt0x11MjSYZMu C cS QuPRU3j^ t(;xUu;0tRh%!1҉XZ{ t11ɉ؍e[^_]Ke[^_]ËLH{ t0Eh<"S2SB>S0]e[^_]/e[^_]US]C P|y)ZYt!SH9PHts$RP ]]]UVSS]31҃{Hy-tC$tUjjS U1>tutEC$u?tSP Y@u h,$ZjjASW @u h,$X]e[^]4US]][]9UWVSUMu { ;u}E4W[ ZYu{ ubFuE;E tx}tCh%S葃MUWVSS#S/SA &;ut"C MUSuX[De[^_]UWVS] @?@tjE1t6HjEP4| @h$h%c:hD8%h\%h2% H|+`RL]!hc%hl%h2%| _h"%h+%h2% h"%hB%h2%h 1hJ%hT%h2%J 1gD[ht%h%h2%D8@uPh%=YCjjjk /Ph%1 >u 1ɉV$XZe[^_]USS]jEP4 uh$EY!wjPh$h%EE@tPSPXZ]US]E U{ u0C щ‰{ tG][][]UWVS ]]} u|SE|$XZu { tC Ph%m%K^_CStP }|QSS[E fEPjEPuXEuh$tYE 3Su!$XZuT E ~ WE|#YXt5{ tC Ph %XZF$C$N>K>~>tgC**[FVtPMQVFE|PV2VP~ tWh#%7^_} ~EPuu# { tSYE Et#PHtJ}OHPZuXE e[^_]UWVS]DžPPhh5@uh$h7%Dž_XhF%Y^1hP蹨F1׃ u Vh%eXZun 87td 8 tt Vh%7^_d`PSƃuh$[|tlPx WV!ZYu WjS ϋGOt=HOG P|!ZYt%Whjj >u5NG|HO9OH t҉WhV|XP|Sn!|be[^_]US]SޠZ@u: 87u ]] 8 t 8VtE$]]UWVSD]} uMMtFMPVZYt3Mv/ 7S UE $E!e[^_]xEC(f9t { tQPC Ph%f{(K>:Mu#M}tyEPVC*PR Mt_{ tEj<}WQC*PdK PQMh%jt S*ȉe[^_]UWVS$}E EEEEEh %SU Y^uEE  %+h %S4 ^Zu,E@8S Y@E] EEe[^_]h' %S ^ZE܅u ,Eh7 %S͚ Y[Åu EH1;]}E4 ZtCV<E[E1;U}>E UQMY É4$MQum ]܍CE UB 뽋E@uh@ %u ,E E1E1EEPh$hU %uutrktA'NtP4tS6uE뾃Uu@뱃ptxtnuE뙃딁댁M냻yEm!<@EEE|tb{ tW ,UK u;u}$UԋE4QM ZYtFuUԋM;UuuSjv E[jEPEp ѡ uw|t\{ u[ ,UK u;u}$UԋE4QM| ZYtFuUԋM;UuuSu1v @u<D<E@tc U܁  ,;EuM܉7jD [^mEE;E}bM4|ZYt;x t5 ] t14E롉EE;E|*1ntC ,;Eu㋇|tV[u4|0Y[t5E뭉|= ,WRuMUuXZ؍e[^_]UWVS] U1{>tNf}fC(ffGfJuj} ȋuFZK>s*S>+Ee[^_]UWVSu} t.hG%dPV҈à t$=hG%hh[% @b 8thG%h\#KYXhdZuh$*_dpu^Džh%jjhPnWhu%p@t2h%u)Wh%蕕 ZYtfWS~[_ud;Y1 dtt>u?G Ph%[ |XZ{>u[C Ph%. XZ1pDPWdhnRPddnR =nwHƄn ƄoPRhhG%V@u-h$h% YXptjWdlà xpth%b Xϋxe[^_]á3tU3P3U3]UWVSM Ep}y1yy9s)}_+Yy tʚ;1Ƀ}t}[^_]UWVSǍ]SjEPGPShEU؋G$uʚ;)U܃tBP1;U]s @+UPH 9su @ JPM)H 뺃ue[^_]UWVSU} uh>%hh$huhz%hh$hhL%q }ʚ;vh%hh$h܉É΋P$t$9zuM9Ju Ju K(݉HS,tJuK0JjXtdUUrEB zEBEBC$t%9pw u}9x vHJHPC(BS(1e[^_]UE@]UWVS}] uuh>%h$hI Euh%h$hJhL%B u t 9XG@;GHv jPwDI uGDGHG tHtJOH j ZtNjtBGxGXp MHupMHt p ]X}t upUP@G1ۉ؍e[^_]Ujjuuu uUuujju uUSU] uh>%h|$hhL% u } at 9Xta B}t)x t#@@@t`@JB؋]UWVS]U Eu}xx xʚ;v [^_]É}u M[^_]USEU M]]]] E[]cUVS]u E1EEEE i@BU[^])UWVSUuuh>%hP$h#hL% B$1ۅtK} t} 9xu7}9xu/t9pu&xtyz(xz0xB0C뱉؍e[^_]UEuh>%hD$h7hL%1 U PP@LUE@L]UEuh>%h0$hJhL% U P4UP8UP%h$hnhL% EEEE19s8v,C4 I>v  DFu EPj @u?EEEE19s8vjEPC44耩 @tF1e[^_]USjTjZYtR@PjZY@u SX17[C C CC$C$C(C,C,C0CP؋]US]CC4C8t7HtJKHPHXۋHtJHP.XC uKHtJHPYC$uK(HtJHPZC,uK0sDCDCHX]US]SX]]UWVS]uCh>%h$hhL%\ 3t,3H33Ct Ӌ`!ft1f9thWhi6@؍e[^_]UU1B$t0zHu%1t]UWVS\}_>u Vv 7EEEE1uMu EMQUE UJHKuԊEEjPV苾PG Ph%G>PVW|(u W*O>e[^_]USEtSXjST[ ]USEtSS\[XZ]UVSEu Ʊ9tt ut1t 1@1[^]UWVS}] ?jWS( s jWV wmj:V{ ZYDžt?EPjhjjj jGPp C8 }t UC8jVCP覽 ,  DJu <:tFu}Wjhjjj EPV C0E t0it.u$Wjhjjj j@P迨 C4E t C41e[^_]UWVSp] F1DžjqZ@S9 _@u&ht#[[^Džh}VE@:hjXZfh$`X@ t"xtuPpZYuËtC VP趀 Y_t[}~D1ۍVE4葀 _ZtC9]uDžY19]A}uPE0J ZY1E@% 1ۋE9X~9jPE\4跘 tCыE9X~ Dž1ۋE9`~!jPEd4q uE`t9uDžC1ۋE9P~!jPET4# uEP9utDžC봍Suy^_HSh%LCEPh9SEl4~ ZYGӋEC jP迹 @C$@ jR腹 p  ɍyDž@RhiE觶 @t @u SX@C@C*RtE<@u1t(StY@uhq% SL SwfC@CCDS4w_Z@t CLCDC pSvCHC@CX[^HSu3vZYt&Sh%Y[DžDžDže[^_]UWVS<}u tAu}*EPV[Z1@u0tC WP{ ZYt[u{ 1ۉ؍e[^_]UWVSS} E{ sWkZYSs F<t<t+nKCtjRPQVsWjuBC~uN ufF UPjURPVsWju$SE0 9 EXe[^_]UEU tt ;Pt@ۿ 1]UE|t @$u@]UWVSuU `d$1jF PSW `‰t fthShi6<hSh~i菲 tte[^_]UWVS4U 1z BXu#xu[vV v p }u>)u9X.t/t* u%p }u}t uH }8O\ zz9wqE|t 9st[\ ؃4[^_]b US]SpZ@u:jhj @tjhj @؋]ҭUS4t6r$B4Ƅ4ttu ux []UWVSljQ` Zuh$ÉEhG"EPX ZYtfP` Xuh$SK[_LUj@PVc Uuh$SUR q7SXe[^_]UWVSSƉϋ]jh}%RU UuUMd} hM} M@u ð`jh%R舯 uRUl} pMuU} ðDM\u `UC}C0MCPu pE$e[^_]UWVSÉUQȺ _E>"ux"MF-Vj賰Ǎ@ZYw;}VS藰ZY1}u>t tCE9uuHMt 9MrN\<~Vnt>0bt!  tt:xtBrt  C E ,MNMߋUDJt!M߈M~MDyu~~U}EjjEP]  E1ҊM΃0wGMLBu}t?jjEP] t.S=~t%tCEE}u0@t+9Es 71}M;e[^_]Åu À tt @ u1Åt8t u@ t1UWVSljӅt΀9uj/QՄ ZY…tH@EEPjj jjj juř }t uh%-t SP#ZYuUUWV ZYUuVh%%^_tB/1t72[e[^_]USÍEPjjjjjjRU肜U ҋMuȉ1j{Z~CC1HuCЋ]UWVSE׉M܋ER&[ Zuh$Lj=P蕃 Y^EuWh$h%:S+ES¶ Z1F}t^EEEEtHRUSu葪 Uũ}tDWZ _uGE0^S;XS/W]Z Y_uf/uFuu. lj4$$ EBU$uZYUMt:u8 D8NjuEDzjFPu uh$SXZDMe[^_]UWVS]s i{X19s v WF,XsIC C{$Y19s(v WF,Zs$C(C$Xe[^_]UWVS*EPjjjjjjW };Wh~%*XZ3)‰U썄5j_uh%Y34D3:j,Wz ^ZƅtxuWh%Y[N9uHO5j5Zuh!KX4s%ƃ4EPjhjjjjW_ , }th%_N4)‰U̍EPQM} Y^HMЋUu-蚭 774U䉔7'47j9Zi4ɉ 5 6D44t4u Ѐ ?6t 6@AEPjjjjjjWP }Wh%r[^BoEЋTP-MЉTj,WKx ZYt W蚫 P U$UAXUuh$[Wh%RV 1ɉ!V)_}uEƀp3h%Wf ZYuEƀph%We [^uEƀpho#We ZYuEƀpWj訠E[^PEtEZYuh$XMЉtWP^MЉx_X]Iuƃ14h !We Y^uƃhx&Wd ^Zuƃ h!%Wd ZYth&%Wd Y^uƃWh.%XZƁt,j0d_uhE%x[L1 $ ECEPEPEPEPQEPEPEPMԉE^ jWuuuuuVIjWuuuuu4IjWuECjEPEPEPEPQEPEPEPMԉE jWuuuuuHajWuuuuuH?jWuuuuu~HjWuKCj=Ws ZYuhN%Xa@Ej hi%W. uG1҃uMtj hu%WӚ ujh%W跚 uM12ujh%W腚 t@jh%Wq t,jh%W] tjh%WI Eƅuh%X@EȋM̍UE@u vM1ҍE@t uH#XtTEPV2EPFP2EPF8P1uVP&%$t1ɉajh%Wq M1ҍE@Nu"X;EEPVp1EPFPc1EPF8PV1uVP$$]1ɉjh%WӘ tjh%W还 uHEPjhjh\jju袉 }uh%[^j h%Wc j/up ZYDžtGEPuj$ ƃ uOt?EPjhjjjjW }t'uh%I^_ƃt GN*uh %1}Y[bUE nj/W p _ZuEj@PDP D@J@M @J@M #UEj/Wo Y^uEj8P<ʱ 6<8J8M 8J8M VEЋ\XMЉ\`L߃0  ߾% ƁQP 󪍓 fCPfCSfCVfC^fǃƃdƁSƅtF1ҍEjH@PL mLHJHM @Džu#EC EPEPEPEPQEPEPEPMԉEk jWPuuuu_A蚠 8Wh5%XZS PW+D P^_lh$\[ E>tuh%,Y CƃuWh^%XZ    w @c O ; uhn%>^_$ EM>tuth%/[  t @t;j/W9k ZYEЅt@EЉEƃuWh%_X EXEȊEEĊEEEEEET19MtCkPu*t,Uf9Pu#U8uU8PuU8Pu U8PUAjE@PV WTXQXkËEfCCt)EECECECC}t }uC1C j/ui Y^ƅtFWuj= Htuh %1XZf{zEPjjxjjjjVC }TVh%CC^_    \Eč`1dEčh lEčpEčEȋEEu< }tEHMă Eȅ h%f[! }EÅuWh %8XZ EPjjjjjjW迀ƃ }tWh%^_ CDžtuh/%[ EEЅt@Ej:Wg ZYtCURjhjjjj@P2E E}t2h>%k_& j=Wg [^EEt@Eh0#WZYu6EBuhW%_HM4h- %Wղ[^1u!EtHMho%W衲ZYu5 Euhx%[OHMhE#W[ZYu5E{Xuh%N[ HMhv!WZYu5E5uh%[PUh%WϱZYu ΀3h%W賱Y[u @h"W藱[Zu h!W{ZYt-h%WjY[u h%WN[Zuh%W5ZYuh%WY[uh%W[Zujh%WZYu Qh%WѰY[u@8h.!W踰[Zu h %W蜰ZYu h %W耰Y[u h0X$Wd[Zu @h %WHZYu @h %W,Y[u h%W[Zuwh%WZYu^h %WޯY[uEh$ %Wů[Zu,h."W謯ZY tWh%Y[k}tuWh%bXZE s!t@uh%9Xs,}u&h%X}u#Wh!%6[^}urI݋E. thG#SZYtS: E_uEEċ}u9j,EȋE@PQc _h$u[^TEˋEȋE9vU9t{t@E,ޅt9tS^Y4Ef}t }tEEƅtFEPjjjjjjWzEЃ }Džt^j11yXUB=vhB%XMRUڠXjỦ+Y E1j|@Px uh$V谨XZxUЉt|J|ЋUpohZ%_"vb N:Ws^u%EЃlWht%EY[@UЉlƅt @h/%WN YZEЋEt+h/%WeN YZth$WTN _Z}Ёu }ЁẺyh%VN ZYth%V N ZYSE @ tV6j_u h%Yl5_QCuuh%nXZ+1'EH$MčH(Mȅh%@Ye[^_]UWVSEu} EEEE1ۉE싀$tM܉UVPL ZYUMtCguFE샸$uu u E8"@EEEE}  $EEe[^_]ECuu Ek%e[^_]we[^_]UVSuhj萠ZYu h$3^ǀǀ@ h($P~ <ZY@t s s ؍e[^]UWVS ] }} ,t\%E싇%`E>URh$Puu t9jj5l5PڋEƃuT %MCuU %몾t' ]쉟 E艇e[^_]UWVSSEE] 1t 8t R%YPZ1t 8t RXPXE|u7jVu LǢ<輢P豢\%8tjjVn txTuxTjP僻`tV,`X\[dXhtV,hd/lXptV,plx_|tv|xաYtVE,詡T螡XZ]e[^_]鍡e[^_]UWVS(uVZ,3 (3up(3@,3jjj1 tPS (3 ,3Xjjj1 tPS (3 ,3!D_ (3 ,3hF+PP =v1dž} 7C*j,j$\ZYu h$ÿ_ ǃ`j,jdZYu h$藿_ ǃhj,j̛lZYu h$k_ ǃphh$W% =vh$h%?Y^PP3_ZhA"Pi _Zt u-PP1҉xWF YD9t t ux\tH@ߋ\`ǃ\ǃ`dhlpǃdǃhǃlǃpptǃǃhP8V7u8h$h!} St=w@ƄS8V_7DžDž 1} 1DžDžPPYZchA"PG ZYt u t:`R@ YD9t֊ t uʀx\tH@߅t$䟁1ht#C YZuy} tu jh@Pl诗 t+lh, Zuh$豻YGhh+%WC YZu;}uP0C _ZTh2"C ZYuA}uPB Y_utDž}tuh%B YZtOPPًU DžDžzu}tSV\ XZ1+u8؍e[^_]UM U9w]UU19U t]UWVSlj΍BEGE ˍEMfUfV ZuM8ˋUvu9usC+M}u4 89v "  @G19r)SU9Uv M)1e[^_]UWVS} uWTuh+%h$h^Tuhm%h$hh?%v JHCH9t)]Au'RU;ES ;ZYM8Ut u3F|G|u t tBD+CDu9we[^_]UVSjjVu à tSV6v S ۍe[^]UWVS8}1}عEX}ى‰:E pE؉U 'EPW _ZuUBtt U Btu VS ZYe[^_]UE UU E]rUS]h8$Pq h$àSq ]US]Sz Y1t Sh Z]UWVSĀuha%h$h h?% Ɖj<|RSk CP x{8jEt*SPh ZYtbHT9KTuZ8PC8P3Y_tE1ɉt8SEPk SEPi 9t{ h$SXZ]OVP9_@uz 8Vt h%ѭ[jjW/k à jSWk EC S9;U tSWSk SEPg uqCTt <@% s=t8ڸ%Sj0ZY@uz 8tz 8t hp$XSY]4;E NSVj SWqh 9ty h$躬SXZjjuVj à uUEuh%h$j;h% Ptt ^y /1UEuh%h$jQh%谢 Ptt y /1UUuh%h$j}h%j Jttt8x /1)z 1zuz uzu 1zUEuh%h$hh% Ptt1t-fx /1xjh$Pk UUuh%h$hh%蕡 Jtt!1t>x /1/z#1zuz uzu 1zUWVSu] }uh!%hh$hmuh-%hh$hnh% FuY<u9FuFPh#WS~ @u84WSPFDPlÃVWSPFP0 Ã1ۉ؍e[^_]UVS]u uh5%h`$huhA%h`$hh%S {t~tSN8t#)kSZtVX1tO 8vt t1&vvPVSv e[^]UWVS(uuh%h$hFE<t<F~}1JF1 G!)JO9tuu au G@u1>1ɉUк#]tAutU@;Es 8t1q_u /\1ۀ=03uQ}ع1E׈E03S}W8WV thM%h$h'h%{ 03؍e[^_]UWVSW]C<t<uEE t /S؉ǹE ^y1ɰE tE )ѸFE+E y111=03u303SZ;E the%ht$h`h%薝 03e[^_]UEU uh%hT$huh%hT$hh%J fPUWVEu uh%hH$huh%hH$hh% fe^_]US`$tPh%{ XZ]UWVSDE]S3Zj0S+EEEE}WSk195$v/$H>v r  DF195$v/$H>v r  DFWSur u uSjE0EPmaƃ SXEt @r 0e[^_]UVSuEPu VU tVj蛬 ZY@u؍e[^]Åt3UWVSƉ׉ˋtPWh%Vu 1Íe[^_]UWVSU} u19s$@u9v8uh%h,$hC؀xth%h,$hh%ٚ u1Y9s*jCPU tًUGJ:N9s@uЍe[^_]UWVS`։ϊB _`u1P`P#lXZ`S蔫 X?@t _t^Fhx"R Yu%Ph%S" @{ Ph%S @ujWh#%S @Tdhlh%W* YZuNltDžplxDjVYZDžpDžph-%WP* YZW0o Z|6h5%W)* ZYth%W* ZYh<"W* ZYh%W) ZYjh%W) ZYUht!W) ZY@h%W) ZY+hc%W) ZYpDžp Džp_t@F PhB%Sb @p<$tPhO%S; @@<t p %du"Ph[%S @GVH^o&t %Jt1$Phl%S @vDhy%S @FLPh%S @v$h%Sj @jV٭Ph%SL@~Lt?vpFMPhhtR@ttRh%S @k~tu8?@ǀh$tP.Z |XY#FtPh%S @uz u RuARTXQXtPZYX9Tth%Sw ZY@jjtP\ ƒ ttqXjjP\ X9u-BTX Ph\#Sw @XKjR뛉Xh$h\#Saw @XujPSjc @hc%W& ZYu"d %"h%WQ& ZYh%W<& ZYh<"W'& ZYht!W& ZYh%W% ZYth%W% Y_twpuhehxOpu VZ;ptp/jVY_llxD" %"Ph%SX @Wh%SB @VvZ%u6?w_%u*Ph%S @ut|:u%u"d t>(W3vY%uPh%S @u(h%S_Z@pu^h/h@hq PVh$SaP@d$@urpll@LlqPPVh$S@]pt puRdhtqh@tdhqPVh(%SO@d(%#ptH2pu)Vh(%SY @1dufwpuVS _Zҋtσ8tVYtlpHpDVh(%SPh\#S @tXd0uS< S }Y^u h $Z#_tFP`P u,h $踚X_Džpc؍e[^_]UVSË2tPSg e[^]UWVS}u }t}utSP| ZYtgEPjjjjjjSXC }u9uBu1;} t>Sv > ZYt)EPjjjjjjSC }u9tG,Ëuuq7^ } u,FuFuq^ [TuqX1G];M IwE!e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]E;U5EEErE,@x\ Vu<9utBE%?B ȃ}uz}E؁}E9Ew E;Uv _\ "q}?v L\ ^E}DEt,O;Mv &\ 78ߋM_.MI+MM;U"}v[ G}}9]ttC }Ut;]tC } t}E[^_]UWVS} EEE]1E9E0EEPes2$$CesxEu$y ‹ ,DAuZ Et\t(x$B ,DAtesx t/unUZ U\utvif\\t0vM\0C0C0SttOCFt:u/Z 7(esUEu EZY[^_]UWVSÉ׉UƍPS_YZ@Wh\#Se @}uSj= _Z@u$p h!Sd @un@ s;Vu hVT6PI sVu S: 8 s Vu S9s.Vu PhV=@Vh\#Ssh3#SsZYsE1)D0<0tu FuU tSP Y_@uyu } ;K;} u@tPh9l&Sj 覒 ^Z@u2tPh1"Sfc @G륨tffPh9l&t&ffPh1"S+c @e t Ph9l&@tPh1"Sb t%7 Ph\#Sb @sWj.VWjM tbVh\#Sb @tP?tGuUWVC*P*s Uts[փVSk_Zu VS-lY[tDXLR/ZtP|^_/VSZYtXP / P 1ۉ؍e[^_]UWVS(E̋A tӉ΀ytuXP xVx}WZ$1FCtUЉ F tCU{uCCF t#UԀzu ztK|@FtC8F t CXUF0CxFftPE|褏CT_X#F tU tUUЋECT{Tt14~tbO h$E|CTZYuҍe[^_]UWVS É։ Et A@E}E)ȉE9s'UW|5_ZYtp|UzuvRUY^U苃| lj}t21ME1ɀzuMjR褈XZMȍe[^_]UWVSƉjjj à @thWVSA Sb؍e[^_]UWVS8tL F1Dž@jE PRA fDž ˉ󤍕i6MI>u*󤍕i ؍e[^_]UVS1ƅ@ CtDžC8PYCP ƋƒZu9F_u)CT@fCXPRYu tЃtЀC| t Cxt(Dž,usT1fDž Ffp׉މ;tHH trt󥃅 QfuCTpV}XZtHHt'CstHHt󥃅  t'CXsXtHH)fSPE  @؍eY[^_]aUWVSDžLDžP"DžTEXDž\Dž`jjHVjjLS @uH1 R?QDZtjjVPjS u@D4YX@DH@D;@9@w ^E pC u]dىEuGuXu hH$x_5$RuSU ^_u1XPhfB@s&, @tXCP)DC YuCtPZS3LX1ۉ؍e[^_]UWVS ]c{u)ss s@ SCSC ЉEԍENjuEEEE؋EEЃ;Cw:uu؋U;UvUUV3ZYCUuC} E܋M؍DCC;CrCCK-Ѝe[^_]UEEE EEPhgBu* UWVS`fy(u}$$Xҍ4uV$DžLDžPDžPhBSE* ;6 .$DžLDžPjRS e[^_]UVS ME fz(u2]EfEr*ufR.fUffE]EEEEEEEjEPqe[^]US]sVs IXZ]]IUS]x@u$1҉g@th~B s,) ZY@؋]UWVSM}]utDw 5 .E C[UU +29vw5 "101U 19t9u} A,[^_]UWVSS1tލ<}})v ~׃kJufЅt‰Z[^_]USS\t$jr^s\nC\]USS`t"jR^s`C`]US]PSCXZ]]EUVSËtBC><v:D&FT|tL9t(tNT9JTuu ) Ë@ˀ{>v P Sh"%f e[^]UWVSÉ։h,jBZYt:PǀcScufǀ,1e[^_]UWVS0ÉjRGs^_@u Ph,"%:[5h\sZYDž\@u Ph:"%e_Xth, PjAY^ @dtVWv<u?(9x u1Wt cScuGhu @G @(FH>A<wNw*󤋅 t&x utmtdf@ tStJSjFjPSX9Ѻrf‹fP@TȋF,|D0㉅ǀcSc_$1҅tkDcScubtuPOdt Ghu;Yt>)ƒfǀ2@$)f5XH~$t>~DcScu5tt,~<t )ڃYf@6Vt9)؃gf2CtGt2)؃f3ȉCC+f7Dž9vprfуuL>t2L7Pu uJƃv;#C,m\Dž9`9s 8 ttBprfуuL>t2L7Pu uJƃv;cC,VP)HFt0GWu*)؃f9ffC3tHGY u<)9CM3A3󤋽3\ tC)9C= A󤋽 \t tk@WuMtB)9C<A󤋵\tuK<>u+@t@Zu)؃vfPhPqƃ tjt jV_ZH)9QC t CfCt\SVY^Ot/t+V) ZP)9 SKtu@u7Ft#@^u)؃DftC5t<)9C5A55\|@_)؃f|tȉCsx19|v\ ‹)9ws{|9v Rhc"%a~t <‹KL9K@떉S+)Ё+wDB% Rh|"%[ < e[^_]UWVS EcSct9( V EE1EEEEtIeBlE؍E];] {GE܄t;}u)' /EeB,E؍Bl뮍CE{ECE;Ew}}4EMt}u [؃ȀEE9Ea}tqE}9sE1ۃ}t])ÉUuPo7ZYU艂}؉EU}u E苀EM}}uԊEE} tE ]}tM}E苰u& 1e[^_]USSӉʍMQM QMZYt }t1҉Ћ]UWVS$Ɖiu7h"%Xf,Xfth$QPà +_iS@ Ph"%hXh$PS6Ãu2% Dž8iW Vh!X wh$ Vh"%{X I?@u j5SY^@uƅS0Zuh$XXDž lj󤋅e[^_]USSӉʍMQM QMpZYt }v1҉Ћ]USSӉʍMQM QM:ZYt}vȉ1҉Ћ]UWVSS}uh"%h($h{Ӊ΋S IuN Ut`t#Cty KsjSP> uh#%h($hh"%^M P S@tCP-Ztlj1e[^_]UWVS$ϋEE Eh-#%R ZYu}[ƅP! $'-Xۋuh$T[uQVhRSV5<@t-PdP$ ZYuh$GTXe[^_]1j60j4@uƅw x,!j@,Ph@hWu*dWPh!dWPh!SVhB#%\R$v!tr$u)cPWVhU#%R(cPWSVh2#%Q ]e[^_]j3UWVS] p$tPhE"O( XZE1E9v31;Et k, 9t@v 6hb#%( PV蘽G,1;uts 3hb#%' PSrF,܍e[^_]UWVSEvvE E] VEtEubSPh %u_* @E^PobPhq$u9* @tk;]sP;] us v Iuj *Y ^_@u8CT9Ubz "ujX XYBue[^_]UWVSuE ]xKt tPSWhS@t-Sh\#Vȫ @u07aPh\#VL) @uLt 5uuVj8X ZYVj ,X ZY@u 1e[^_]USS]u:t0ASu*JREPjZYu1 }vff]UWVS,E E@hx}ԋ@E܋E E@_tE@o'EPjyMԋU܋E RXZtE3"(EPhMԋU܋E (^_Ej#%t7Ev$؉EE9]s R E@Tt EEPj!MԋU܋E XZt֋}uE9ECEtu 輙Xu EEU9t M;At;A uEEIʸy,%=tс1utȉE@uFtEPVFEPFP9EPF8P,Vu誚 ]E@PEPjMԋU܋E ZYuEE9u 蘘XEEPW虦EPGP茦EPG8PWu ]뤍{D9Es] "Mu YEtENjM )كȉEEE^;Et u;Ft;F uEE}uBtEPRU迥EPUȍBP该EPUȍB8P蟥URu "EEu3E @hu$űE Phn#%KE؁ Ee[^_]UWVS$}ƅj4uMY[@uƅEXuX uExlSc\Pu h#%u苦@ujuM^Z@t'^2Pu h#%uD@u-S2P[Pu h#%u@ujuM;ZY@t2E@#P[Pu h#%uԥ@@ ÉSv[Pu h#%u螥@ut Ex,u@GhElPhhSSu h#%uL$@ut 1;j@E,Ph@hS讻Su h$%u$@ul9v VC,X鋇\1ۋ9`v VC,Xp1ۋ9tv V`C,X鋀Dž\9Ή⋍T1Pum`19t k,; tYBRPMUXZt5_ VhbSu u7 8},.Dž9`vhΉ⋍T1Put'CH%h%V蒫jEo=${HuJCt.Chu(SJ9Hu{<t;t CH+%CH?%%;u CHF%%CHM%%{0uC8C4bVhs4jESiRUWh%%BsshUR6. @Uu Rh%% C_X{hEu/sHVD6juVz*CdCh=V3Yu2ECh%yBjE; E>uxEulCtSJ9Hu tQCdPC`ZuhD$CBXe[^_]g_VhɭPE<9e[^_]g_UWVSu} tuVjj:9thrb  CiP6׻VD t;{t5{<t/s$RPF Ph%%3AB1ɺVjj9VTs !C Cs!CCCC CC{Ht V2_CdChWVZYsd!CC C$Xe[^_]W|$wUWVStEUM]EEuZPSCYEHT%%u$Pt :tQRE Ph%%?EE@Lu E@L@w}GL E@L@EixLhb` EuB_ZEEEm5#EHT%%u$Pt :tSS$QRE Ph%%>MUEE@%E@htEEExdtj$Pu& tϋE@$Et‹E@XZEE@uEEPjLY_uE Ph)&%=XZ@NjMC EC ECCDCEffCfCUofCEh3^ fCC@EffC1ɺ:_fufC fC uShEp\SFu$E Ph@&%*=( [^441~4uX}teuuujEW5E7t̋E>uhu&uZYujjES5E댍e[^_]g_UюE]UWVS]3Sjj4Ghu'PtShdjc4{ tLPWhM&%;%%r8%PWhy&%; ]e[^_]*U幧E]UVS]tXwNShj4v$ LPC Ph&%: 'FL]e[^]뀍e[^]U0E]UWVS]{ Wh&%:F0+F8PWh&%:Shj|3F<FL$]e[^_]fUʐE]UWVSQ]v F FXuHjjS! C Ph&%9_Z>FH'%h'%SJ7EPWSy! ut>t Sh$'%9[^jWSI! t jP (ZYF MFuWS! uh#%h$h1 h"%/  FdH PF Ft''N V$vX]e[^_]e[^_]U=E]UWVS ÉU싰V Et9Bt E9F$E;E0_IPC PhK'%8FiP3Eu~@u1ɺjuS EtjP&XZESjj1EtBFH\%h\%S}<%@Y^ u-j>1XZShjj;0Ee[^_]UWVS(Ë>Sjjd0V BuB EjEPS! t@tdu,N }vuu܍EPEPWS'5@t P3#uGP Sh_'%6SXe[^_]UVSËuPˆP@P  ZP \W(P O>w*󤋅X s3 t)h`RR@PP\ Phy'%:\@>tZh`RP\*PP\ Ph'%2$h$V3_\ Ph'%A3\XPjeX@Lp X@ @TT t\e[^_]XP \VXGG tx@`j`P\XV cSctTt @RX@ @^XH p$p\lX@@[x(PV\P HtmXHQP XGYt?w NjP󤋅X@XGHWdOhj\0XZ h$Q1_X@ cSct PX@ @^TXx0`PXiP\0 j [ut_Xw0P`dP@DžD)HLH9PDL}B\ Ph'%/Xp X@ @@$ )NjPXH0x4x8X@ u\Ee[^_]^cScuߋT uЋ\;CLt&P2Yu\ PhH%*/XZRs5s$?P\ Ph'%.\Ee[^_]C cScs$?P\ Ph'%.\C<\jj\L' t{@t \h]r)\hj\&\Ee[^_]cSc%Te[^_]UVS]C Ph(%-NhFLXZ]e[^]LUVS]C tPh=(%-NhXZ$Phe(%-h\%SxFiP3諧FL]e[^]USE] tB:t=tRdt9ZtE \%E[][]UWVShd`\Džp:d BX9CTtu`dh h@><w!Ph*PdP uhx  E\@\u8WD1ҋ|!9u$h)%hgCiPh0蔣hhsPjh!CPu CPu4\Gt(jjP`d_Zt 1u`dh)% `9Cs s `C Y^`C{ d󤋅h>tispCCCC C CCCC CCH%h%hڋjhC\Hhhюjnt"hhRn<u$u`dh)%<t!u`dh)%[;uc\@t+jjP`dh=_Zt,u`dh)%7 \r)u`dh)% \CPuQ`9Cs0s `eC ZYuh$"CXw`C{ dC@hjjhEhE0!3Ph Ph)%_"be[^_]UWVSEˋuw62PSE Ph#*%$v%62PSE PhF*%"e[^_]ÍEw )ىM1MMىuEe[^_]UWVSƉ׉MBȉE|ta9tXtN8tIU9PTuAC><wPC*PGP u$C PF Phu*% uM6[뛍e[^_]UWVS(EEԋ] uEEu莳Zt99v&uEԃ EE $E*%e[^_] )VPS蘑 PЃ<@A{ 7fCf9$9EЋ8@fff9f=DfC}1EC EKME1ɉطfuHEuaEЋptTfuEf@MܺE蟷f֋E萷f9tuO0PEԃ Ph*%-fKf)эTEPEXe[^_]UWVS$}^\cCubh$RS詳 u#>t=G PhP$h!WsPRWt^\ue[^_]UVSE pjPu, uE$e[^]uN]e[^]z\uN]e[^]e[^]UWS`(ÍDž( 1DžDžDžDž,t @`jWP肯 u h4$YWSXZe[_]UE‹]#U1ҋE]UVSuV|Yt,sss S|t}tt:uh@苃t&jPR*ǃtP ǃZUǃXe[^]W|$wUWVS tu PZK>vur s(Vfu  s ure[^_]g_Jht< ljEEm5#PP$C Ph*%>ShԔWj(e[^_]g_UVS]ShԔjt~ht j3 kXZe[^]UWVS E} _uD9~dG PuC Ph*%SFdh\%SSF Gu\utF tm@;GueP?+PC Ph+%+t SX5SgYtߨtWC1E샸sSZvFFO WFIFX~C$E}tnUҊMM섄tLGEFȀ8t PD)ʃ@v w M@MH@E}uFH4$%j3hvHSue[^_]UE1҅tB]UWUBv 2E JI} ډу¸)Ј1_]UEt9ʸy,сt1H%]USU MEttt9Xut9X []UEttPf1ҁ]USE|tju S u[1]USE|t$ttP] 3#P uI1[]USE|t$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u wm^Qt u ]uTIhFhu t ?t61t0t,cScu=cSc =cSc[^]UWVS\E|E}FEx .Eu1E@$h$EP jju ÃE8uǀxhtxduh+%h0%h*h+% h$uV; E@dZYx tYu`Xu E1K|EPdB#B E}WSnE@d@ EWCPnC9SV'bjjEEP jjEP E }E8P>i_uqE0Y_^B$NjuuP_C| SEPajuEP_ EuEPZY@E@$txtiu_XEuVSmVCPmE@dEPC8PqmE@dEPCXP[m SEP`^_u[jj}W à SW sxC|ZY uC|E@dEPCXPlSu 9tS_SM\X떀{tjSu : à ukSg_tߍC8EPgE^ujju  ƃ t9tGuVniZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EEZEuF$tDu4Ghu. juvHSt3Q e[^_]UEt tH]UWVS]E EEU}uM MM$MM(Mu|u2 _RPE[ZKPwYu 0EjWum Ã}Ut}uQUj4,XۋUuE$e[^_] ECCC CBCZ t4;C t/C 647VPh %jC P }t ECCECc%tOt;C uDKtHJSHwuSuà }u]e[^_]\e[^_]UWVSut=t7;Ct+| PjCPC PSF P|jR$ōe[^_]USEt6t,ttHJHPX]]]UWp0Tg Y_}UWVSQÉ ذtZָ%ljU%9M9 u*%ljU%99u!Z[^_]UWVSPL}fJ}xvg ÃtCEH@hEEhPdfGd9h,%PS:Ɖ  8th%h,% YX?w,j@+Zuh% YIǃ@h& h2@uhVV =wPƄ ƄPPhh,%Su,hh%h,%ǃXZh~dwdhXETE`\fu `\\@+hD` 7E \@󤍵V:L dPV8T VlRGT PLhDdhlt NjD}@ugPtXE Lh󤋽Xu M󤋽TuMfJ`fJf1e[^_]USQRc YYS]UVS]CTƃ CTCPtCXPC PhK'% tFuBC Ph,%vY^KtPT s((t h-%QmXZe[^]UVSËFt t=zQw/hX!' FXShr{Q+FPje[^]USSËu>jjZYuEh%"XE@@PP ]UVS]1u>jWZt)@ǃǃǃe[^]USPE]UURP@RppPMRP>RP*RuM UuU]UWSU vK -1}}1t %M[_]UWVSt΀yv  y ׋QTs1t|B$uRPuOXtȅtGpCxF PS]FPURURCP]FTt KthK&u WC8P~]_XC9@VCXPi]ZYEh-%XEo؍e[^_]UWVSSEϋt<u[98up|t1҉tH|Pu=PXZ61e[^_]UWVSQMAE1t u@191ɾtAut1uB;Us :t14Z[^_]UWVSE Eu}MEHfw Afv f9M1ۉ tf@u ¸ u u u u xKEU)ЉE9}v " u}uEEftbf@~:f}?M t1҉EU+M t1"t@+M t1u}11EEӋE E ֋U UM ًEVEUF1[^_]UWVS}E uuGT((*1ۃ t%jPG@P{ ut #wTۉ؍e[^_]UWVSu }WVu&WVuhttSHID9JDs؍e[^_]UVS]CtPjVSjjVO7]e[^]&UWVSuFXPF Ph/-%/Vj=@u3a 81t)W 8tM 8tC 8t h%1XF@tEPV$ZYt$C@u NtHUJNV^‰؍e[^_]UWVS EEEE;} t!CtGUBC8} CTS%t =} uKtHuNKjC@P2ƃ tC9FtSzYCu+t'E Eu}u EPj!XZEPVZYSX} ue[^_]UWVS} E|0tYuvtCPEPZY@t+C@3#Eu!CD3G#EuCH3G#Eu CL3G #Et뺉މe[^_]UWVS] uENj@t)9Xu9p tXp W PG 1jRZuhh%Ye[^_]UExuP u U ffP @]UU1zuJ u fB f]UWVS8u EE]rBtEPVu#E jVu E}tExP EhjLXY8EBzPt"ZTEBǂ<BTtQz Z@}J tu@UPEPQuSU@uu sz tz j.EPB Hz@UEP]SY^@Ur@tXz 1  L @uj.EPB@UPj. Ut!JQPh %j.BXUP UUhX%UR>XZ1҉Ѝe[^_]UWVSEEE EEU}uM MM$M܅uE䋀| RPEZYEuQE؋EXtjWC@P: }jVWurP'@uC$C {4s(E@CEXECPCTEt CT{@u CACu<~*Sh%WX tSh%WE u   VE]1Ejj@EPVHÃ@$@ Et;EPVCPC PC@Pǃu SZWE䉃C SC@SDf~(uXF><u,F*CHF+CIF,CJfCKF-CMF.CNF/CO%<uF*V.CHSLS V;CHtSnս !CHE{@2SK貽 1XjA@MPW Mt uJyPttEAXPA Ph.%8SF 2j.CXPWj6( E@CEXjSD1e[^_]UWVS]} FtHtJN HPNXڃЃjPV t!t;E Ee[^_]4?V ǃSjje[^_]US]XE]UWVSQE 81EjG@PE@P tGT(1}tS}usGTtGXPuG Ph6.%gTGT@tHOtHU JOWZ&E@PGP uGT uFtWXOT }@tÍe[^_]UWVSRu E@EhE@PE PuÃǀ@4uUr4{(s41ҋE'CEH$Q+B9vȉC$}O : v: K vu;F v莺 SX1BCZ؍e[^_]UVSÉփXPC PhT.%VSt VPeZY h%Xe[^]U URjMUEXZUWVS Et_*uVjXZ؅t_t @ FUMvjXZYUt0Mt&@}wFH r*NjM;jC CUe[^_]UU t,t9PuƀRhrjjUEP`у1t0wt*tRh%h/%D UWVS EEE stqpCuKF@D9ADwgt tUt tC{du~du7u~hu(SEVZY9E~FC3^Z6|Ut&HJUPEC]&e[^_]UWVS0}EPj[ZYEEEE9{EnCTE܃{dtojPEPw‹Cd 9v t/uECPG Ph/%pCd EE)9E}шMtEEsxF @u jF4PEPN 9v trVTtRNXdX$ux%QPF Ph/%Vje@uΩ 81tĩ 8t h%XF$F fTE)}9MˆUtME6#ju܍EP&E̋CPE܋CLE؃ }Ef΍4u9us) KuĉуuĄ@u[tuQ}vKE؋ptAu(t.9us!+u9u}шMtuU EEEE)E7}uƃEЃ}v1ɺ%]c}tWh>uj}}t3G Ph0% Oj7*h5%W?Be[^_]UUt&t9PutƀU]]UWVS}u1-0t9~t6^xtuu S u؍e[^_]UVSEu1(0t^xtuu S u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EZEPQdžZYtU9pu 1ɺOGE|tu6@t&jP~lǃe[^_]US]t9XuPxtJT8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`ty @tѲ1҉[]UWVS@EPj蘺E _XEE 9CEuh10%j uVP CPVh70%u2 @uksXsTVhB0%u2@tuuVhS0%u2@tCtPVh_0%ul2@tS$C`^E- uE3"y !t #At3"! u3"7#@u3"y"x3"uRWVQuVhn0%u1 @*sdVh0%u1@C1C9v WsPF,Z拀d1C9hv WGPF,XCPECLE}EfE9Esu SM@ukdh1}9t 98t(A, 1}9t398tA,}čOQ}OQh(PB PEPu2L UU)U0sx1t8FT%u'~ t!GFXPWEPh0%ub0@6ċCe[^_]UVSu Ft%tF9CuuVCxPuݍe[^]UVS]Sjj1҅t#09Xuƀلt@j3w$%Y^t=t h5%S;XZe[^]UWVS] 3EC@EFEj.}WPj\ }wWh0%EPSuE u h|%nEx f  M CS <E! }wWh0%9E=tWPh0%c~u F Gh%u8XZEE>j^_E}xx j.EPEP+ E@xxuF|Ɔ ƅ~ƅExPu~uFL^hl%[<uv[.MQRPh3%EpLU;PPuuSVѿ tV3E@P_ƅ~ƅ~ƅRljދME}xPE~ElE ElPhC1%WETdPjTCuF`VdfCfFdŠtuluhd1% Cu@uFtCt=6wFhE@h E@h0uC tuFldžƆFphuE@xZYHTtff`hu uh1%h9xs uh1%upۉ℔`t^E}1p9t 9t B,tlp uh1%FlpWuh1%+@<<x<`t uh2%!ENjtEtj覻XZE΍e[^_]UWVSRƋ19XkTKfu{u#{u{ u {u{t_fuCUhPCPVUt3ǀ, KfHGYe[^_]UWVShEw蚎 EnEEEE@|tXT@uXTBEAEEE}rEf;EwH;Mv# E Pho4% _X1u<}M)AEffEftftfu f9v#觍 E Ph4%[^LʍEĉu)f]MX1ۉ9t,kMTfMf9HujRPi Ut@CЅuE?@u+j EPjEPlPE Ph4%葿f}tHuΉuȋ]ˉ]̅tB9v>j EPjEP"uSVPE Ph4%蚿(nEEEEPM1ҋEEYtE3Eƀ>$f}uEȅWfEEEPjuWƃUЍ M))Ufw# E Ph4%XZUܹUʉUEȉE9v' uuE Ph5%衾qEX|ۍEjPS uCTuCTcT{4u EC$U9S tKTS C E}}uuE Ph%5% f}t4}W`9ruuF`E̅t}Wdt9suFdE}E؉EjhPu!ǀ,fEfEĉ{(u ECE};};GhGhEe[^_]UWVSljUMu w@ PhM5%݉ u1ɋUY躉 EChCdC`ǃu uVj̞XZƃ>VuMUZYu];t}tG Phh5%a[^=SDtKHuh5%h%h h5%蟲ƃ>VuaZYe[^_]USUE MvɉME BE[]҈ 1[]W|$wUWVS4E؉UЋEu#@u5C|t @Tu!Eu@EEƃ@}t'QuЋE؃ Ph5%u2ǃ8 ǃ85%ujjE؋觳EPj@$%8u ǃ86%EPj sHsDtf}t C`Q=WvC`C`XCdChǃV8u ǃ8 6%8u ǃ86%8u ǃ86%8u ǃ8 6%{`t|s|C`t>FTu4N !Bt(9…tFXPE؃ Ph(6%ǹ 16뻉t%PE؃ PhJ6%褹CdC` u;t0EEm @!}fEހ fEm}mދEȉC`{duGtsL舙CDCLCHCPCth%P1;Dƃ?K`qw$)/t@+uVQjACdPwuh-PjE؋Chtuh`1PjE؋E؋C|PNX}s|NjFT rHV t%tFXPF Ph%3%ܶ F$uvFXPF Ph|6% VT s(F$F VjjF蚯-NtHN sV=XVڵY>E؍p C`;u PVh6%MuVh6%,KdSh tRQPVh6%u{)uVh6%ud RVh&%uPjE0XZEȄuA}t;WVh%%賵sHsDhWE00 @u Wh%%_XE؋_|t{CTƒ t ujC@Ps胶 tKT CT uVh 7%;XZE؋<r}؋t4r.j蜮Y[8uE0 멍e[^_]g_UVSËt jR|PS t j3XZe[^]UWVSƋu5h"%qf,XfthWPF 8PV Rh"%+hWP6d.f?@=RRPO. @{TWjej;" u +)CTSXWjZY@Kht_Dž+9}+uF Ph'%_XDžDsDܓ誋CDZYu h%'XNj󤋅CHK1҉P6$-sD聓CDCHh 1؉e[^_]W|$wUWVS,h1Džh#fDžBDž<"#K8Qff@H@@u DXDpHDž8 wk t]HuNNPj VS8t1@>u @ Ph7%[^Dž8WËDX4Yx8<8DPltfNu׋8 K&󥋅@@@><@D&׈S<ƆfC@|tv9@tFtv P Ph"%2 DP4B@>u-H@t@u<@x Hx@NjHu@NjD@4<4tf',t4 t41u G GG_S0, ,@fӀ'fGXZϋHuC5t8fpf ЉH5tGH61/H2f Ye[^_]UVS]t{wqSh@+j蛘FFF F XF}@u Sh%h!讟 ]e[^]e[^]USPhwj@@@@ @ @$ 2@u Sh%h!# SX]UWVSƋx Wh7%贞 CCCC CC$=1uZY@uWh$%h!語 VXe[^_]UWVSV]CTƃ CTCPtCXPC PhK'%M s  W|t=JT(t~CPt(ffEf"MtCTu{ tȋ뿈EV Rh8%vXZEt?ue[^_]8VY[Ee[^_]]xe[^_]UWVSuVhj'~ ;u Wh(8%Q WhN8%XZCCCC C X@uWh%h! e[^_]Éue[^_]UWVSu{Du ?~ Who8%PśCCCC(C CVjj0sD}CDCH "@uWhL%h!Y e[^_]Éue[^_]NUWVSu@u{Du ?~ Wh8%PCCCC,C CVjjfq@uWh8%h!襛 VVh1j jƓe[^_]UVSËsS^jSZYus S[jS|ZYue[^]UVSËƆ?~DtLt=C Ph8%֚F|YZtHT @$@ 11҉WmvL@{FDFLVHVPFDFHZt hT%SYXP3XZu)C Ph8%7Sjjْe[^]UPEP ERh8%)ZYEUS]Sh3j萒C Ph&9%؋]US]?S Rh?9%P褘 ؋]tUS]?S Rhj9%Pk ؋];US]?S Rh9%P2 ؋]UWVS] E1E9v31;Et k,9 t@v 6h9%~n PVG,1;uts 3h9%Xn PSF,܍e[^_]xUE@|tPT(t1]USEu1X|tuu SƖ u؋]UVSE|0t-uvX|tuu S~ u1ۉ؍e[^]1UWVS} 7G@4j.DSFPj4wSh9%軗}tE@<"jWu`< u h%iG8@Pj48FNj< tjgHDP< Ph+;%芒<);ZBPjR48tKfBuA0΋jjZYuE%e[^_]RWhP<Pa@uu-@t1uv@= uE%EtETt'TPu!EfHfE벀u t?u]e[^_]3GhLJXE1E1;UtkTf~tEB>IU;.u:X 8X 8LjWh%h!謋  P|tFBPtfftft BTuz uԍC Phk<%\^_؍e[^_]$@@@@ @s Vh<%轊ZY@uVh%h! 0SSh1j j؍e[^_]6e[^_]UWVSu} wt`P1Gu;t7ƃ@.H'jVw_ZV uk1t1hDjfÉZYC(C,C|C|1;fǃ<fǃ?VjhÈSjjV uF Ph<%ɈVh=VVkX1e[^_]UEtfǂ<:u]P]s]UM E]UWVS ÉUϋt <@UMtSjjP+ u }EU S.Z8m @@@@ @@$@u Sht%h!軇 SV^h<%SY[P3XZU(vLgFDFLVHVPFDFHYt.Et(E%e s=tu<%WSWXZvLgv4gvuQtBuC@PvXZtSh^<PC|tuS|PW%e[^_]UWVS]}w R EEEE싰1E9v V{G,XEl1E9pv VLG,XE싰p1E9tv V)G,Xu h<%EP c{EpDv"GE܍FE؉fȉM;Mv2Q  ffكM䄔1lpE;Ut 9t&E,fufvGuP|ZY1UM9pu"U싲19t79t B,t)EuuhVEP Ruu0N Et+]SRWRhPE PuuE0 }}u+uucXe[^_]UVSÉыS t%[+Y#$<$+Q$T$,$e[^]UWVSÉ׉1uMJ~D>Ph>%*X YX؃t w t u F1G1ɸ )E9M~ u"u!UM7Ph8l&W XZUMA΃^Ѝe[^_]Uh0,h>%jP 33t9W|$wUWVS31B3,у @5f@(5 s f3.s f3P s1f3f p3f 335 1s33 ut133 33 3f3,Of33ff3f3=3tjV- Eȣ3Eȣ3ZY,XT3 5X3U1E3]5\3`3jhT355ƃ x9u h7%XVS53h?%U @(5Hujh ,j 33󥸤33 3u3󥺼335,=,u؉}mrq,E؉ 33 33E33=ɚ;~ 33-ʚ;333 #we[^_]g_UWVS4ƉU)'h?%mT Y>F h?%YFfVRVRPWSPh @%T j.]SFPjuuj.hs!S2A Sh/@%S j.SFPjEuj.hs!SA SɳF^(ZU)ڃ<,wJ<w1tR<CSPSPho@%<+hG@%"<:tI<O 53hmA%.O 53hA%O 3t PhA%O XZ3t?39} hѸ#N _(EEUe D!QQ$h#N 3=333~4؉EE]-3PP$萌XZERR$5353QQ$5,5,hA%&N $h,= _h,2 X}ɍg_W|$wUWVST3,u 3h3jiZx3XZv2-3#=3ݝ0Dž@DžD"#ݝ@Dž0Dž4h3jYH3^_t"jj jP$ jF D3tD3݅0z ؞t$-3#=3ܭ0ݝ@393݅@؞vw33#r @(5t=,t#@(5t33vܕ@݅@z3k , %,ʉHL߭HwݝH33E݅Hܕ@v݅@5`fDžd #ٽZfZ fX٭X۝H٭ZHPj`P #ݝyB 8h Džt|1󫋅TtxDžDžjP55ǃ y& B 8AhA%j?Y[) {)uj{,ud,u_jh5CPc uS$t*$5t!9tA(5C MPhA%CC(=L 9weA(5cPhB%I #Dž\jhP8^ZtuxtA(5-h8B%,A(58PWhIB%w  vEt7t1x)ux/uu@ (@uBL 9rhmB%~)tT 9ƅu~.u݃ u؋THT<T@fPf;3m Tf@ffP3 @3,=3T@1ۋT@ ʋp)Љpyhl@Bphl)ډhl݅ڽp ߭ ܍3vٞv؋ 313333,v,3v 3P@5ЋPPt3 3 ˆ@5@(5 tjh ,jݝ 8PWhB%F (hB%sF A(5݅ tSݝ8׉fDžF mPhB%F Y[݅8=3tRR$hB%E ؃Pt hB%E XT\\9H 38tQRShB%E  C@\<jh3T P^ PjT@f f3C3@5s33 @5@(5 83PWh#D T@‰ff8 ft2ftGfTffRPh*C%TfPhC% TfPhC%z hPC%GD ^A(5i Tp_@<'<vj.SVjiST@4>%hmF%C T@f fftf_fehGC%TxhUC%C XA(5tET@thoC%hC%XC X%P1P 4f89HTH)T@u!F=w  txhw#q f9f4f 8=189 ȋPPԋTp_A(5t3t uhC%hM&B XT@t h]5%A X N hC%Y1H1ۃHu ˃j.RVjuj.hs!R. Php$vA XZHuu hC%\A Y ShC%NA XZ eTp\G뉅8T@;8T\\9Hv+$ ,DQu$RP@ \Y[ǻ\P9H sZPh3"hZ$@ H;\vaTHSH\Zuhw#I@ [.8utSO7 YƄ \x1A(59h2#? T@Z<t <uhC%hM&? XDžP)T@ σPtj,> XT@uWhC%yWhC%WhC%n? _XtSj,> hC%W? T@ZY98sj,Y> 8T@PhC%? I\9H7j,> hC%> _XA(58PWh#> T <x2<w><tG<T@PPhD%P $=%<{T@<w*$=%hD%Ah)D%:hRD%3h,#,hj#%PhwD%.T@t <uh#hD% ^PhD%= Y[THDhD%= T@Z<t%w uhD%<uh9E%hE%= _h$E%Ph^E%{= [^T@PPhlE%]= THrh~E%hE%hE%hE%hE%hs/%hE%hE%vhE%lhF%j.STPj7uj.hs!S) ShF%< j.STPjuj.hs!S) ShF%h.F%d< hG"Z< T@fPfZYfw2$=%hEF%hVF%hdF%h_F%hC%h~F%}9HuhF%nhF%hF%; S1ɋHL t ShE#hF%&uj.SVjhF%y; [hF%i; hG"_; T@fHfZYfw-$>%hPC%!hEF%hVF%hdF% h_F%hC% ; XA(5t2T@<n4>%hƔ! Phy#: ^_@(5 A(5uh, [g v狝t݃{)!C2t!#t1 hF%3thF%P: C YhF%8: C HC SRRPC PhG%: HD?ǃxPh(G%9 XZ h6G%9 XCPhIG%9 Y^19~gVH%?YZuVhRG%9 XZCj.RPjuj.hs!R& PVhaG%h9 F땋L 9؋33t9~B(5 ,t,93 =3PY2 hlG%+g&UWVS]u)p(5tPCYp(5t(5S/ t(5@$W;p(5Zu/ Vl(55,t;C@P;:uS tD~@tB\u JDN@uȀ:uÉ1e[^_]UWVS}EtNA<:u11] 318uFtuՀ@t&:u:tu:t9uPx@t1[^_]UE ,]USE] u:À|u%u@C8t;EvHt:t @|u1[]UWVS0}!}u_=p(5tUu Wi[^u@5t(5P9YcWP/ D3XZh|9XDžu*Etw3}jjju! Dž1ދ9@Ѐ  ]:3aV;)ډ)ށVSO=ZY.S@^t u[, jh@PE DžhQuƒ ?tuXiQ, 0S?D, 07ȉtrVDžDž\Dž  1 0‰뛋1<# u SZYF ,Džj=ht&S ƅÊt C<:uCE@PVuUǃ tN}#t u^i>[ tGuC:KDžhDžtB<:u):x:t:G))+9++++Q`:ZYu)=Xt uXÉ >)PSQX WRVJ =Yt u{_)؍P9s(PSp9Y^uS< ) Z:Ë(Sz<X1:Dže[^_]UPjujM UEUh(5tP h(5X`(5l(5d(51UWVSDž=`(5uE `(5=h(5u[hը$`(503 h(5ZYu?pbP5h(5财^_tADud(5p(5t=l(5ul(5h(5u@ @uP h(5`(5P`(5@[u 1Xhը$P<ڋ ,f\Yf:u#t =d(5t|0\Gd(5B|0\u d(5K1ɍt:uf:\\tAߍP5h(5tZYu*h(5t B @R h(5XD댁NJ|Äu :t@PFjWjM E}Í@ wwCe[^_]UVS]u \u ][^]UWVSj=u ue ojd-1^EduO% $Mu5])CdPV5ZYuV9[4uEdEx}:^uS:{{\S:JЀw1GOT9t`0vT{T JA~DJw:$L%   :E)x}tPV4XYEe[^_]UWVSVj=u u jd/[ÿdu$ =:ӿdŠBt/:t*F Ou)؉Ǎ@dPS/4XYuSb7Y')؍POtUPS4XZɋUtЋEЍe[^_]UWVSj#u u ƒth :0uB^%$,e[^]á045u d045UWVSQƉӡ`45! 45)Ɖ| })ߍ41Ƀ9t ^NAt!\ @0,3,,%H,, 45I9@,,4545454545454545ƅC h2!Qh^%P$,eF 8= 45t hi Y0,9,,},,Ɗ ,,5p45 45 45z=455|45545+ ,,I x45l45Ph45tPt45 (,d45P`45 \45‰X45< T45#=45tBT45T45)УP45=45t4DžDžDžj PhR r L45jcH45D45@45<45104545Zv45(45 45~.9s(45d45=(459v-(45#t!9v(45=(45u (45$45(45£,45u.(45 11,458t451ۉ؍e[^_]À=45u1UVS$45,454e41945v-$45,45<uO$45@15(45$45Cˋu,45[^]etuxUWVSË11Ʌt9s8xx݉JBB t FuDQ?;x ,H19qt)~ u#F @ A ʋBu9Pu+2ptFprt ;uVP@ A p1tNqpt ;uFH{t ~ e09u/VtBPVt ;u2r3Fp‰@ A A0qtNqpt ;uFA@ [^_]UWVS EӋRUuEP@u~ }tBtu;0u P}u;^u}Kt;u}9uq}u7 }yKtyt3Iu(‹C{ }tBt ;u Pu}@t z )u99Pz u> B @ HtAHJt ;u QuPP ɋZty ut{ u B t{ uCtA B YtSZYt ;u K}QJPH J @ RtB P HtAHJt ;u Quy u>A @ QtBPQt ;u J}AHt{ ugQtz uA H‰et{ u=B A YtKYZt ; u Su QP Q @ tB JtAHJt ;u Q}BPEu A [^_]UWVSË11Ʌt)x9zr9r xӉJ BBBt FuQEQ@Kuq Ktq t5I u*‹C sutB t;XuP P}}\t zE}92H9PzuBJB@HtA H J t;AuQ Q}BP PJɋZtyut{u B t{uFtABYZtS Z Y t;SuK KuQJ PHJ@RtBPJHtA H J t;AuQ Q}B yuBA@QPtB P Q t;BuJ JuAH HYt{ulQtzuAH ‰St{uBBAZYtK Y Z t;KuS S}JQ HPQ@QtBPJHtA H J t;AuQ QuBP Eu A [^_]UWVS EӋRUuEP@u~ }tBtu;0u P}u;^u}Kt;u}9uq}u7 }yKtyt3Iu(‹C{ }tBt ;u Pu}@t z )u99Pz u> B @ HtAHJt ;u QuPP ɋZty ut{ u B t{ uCtA B YtSZYt ;u K}QJPH J @ RtB P HtAHJt ;u Quy u>A @ QtBPQt ;u J}AHt{ ugQtz uA H‰et{ u=B A YtKYZt ; u Su QP Q @ tB JtAHJt ;u Q}BPEu A [^_]UWVSË11Ʌt#x9zs8xxىJBB t FuDQ?;x ,H19qt)~ u#F @ A ʋBu9Pu+2ptFprt ;uVP@ A p1tNqpt ;uFH{t ~ e09u/VtBPVt ;u2r3Fp‰@ A A0qtNqpt ;uFA@ [^_]UWVSDÉ9H459@45jS @45Z9u739u0PS_;@45u;D45)D45@45jVS 19&…;B d45JM<45MVSs ZY@u: j@}W0苢 h4!Wh~]%P$,=#45t 95d45u'…tXd45B<45e[^_]1e[^_]UWVS EЉʋ`45!Ë 45)){ MA$L>D=!45tMjRP M95T45sxu@)lj| <ˍ>;X45NsP|$u<Ӊ<ËC9v&MEډEMˉSڋE9svs{uF=!45uE@ t d45EX d45؍e[^_]e[^_]UWVSÉ։ʋ} 19t yA@ 45[^_]¡L45tH9JsuË@UWVSá`45!9t; 45)z}؋|u 9t )D@}؋]E@[^_]UWVS$E؋`45ӋE!؊ "45M9EN0uЋ 45])ÉWtu9])ËsF€}t Z}؉E)+FIu*w N%w)N%w4N%1;SsS |C@C;Fu ;u Ht FN UH9t9vztF}Fڃ$[^_]}t Z}؉ыU؋EЃ$[^_]E؉EEɸL45f}t KZ{SC 045045$[^_]UWVSS9d45t d459vzc<451tHNj_0E<45045=0459H45v1ɉÅux}u9@45va \451uÅuP=D45@u1jMNj`45!‰)Y9tPMD45Z9uō3@45t=<451tO9s?9u@84G9r8 39s1KE<45 045=045}u릉؍e[^_]UWVSÉU45EЊMES1t}9ztJrs‰Љtt¡X45EB}}1;Es9x |u(9Mw M49s;Es E9BvBCUEUrEes t C Jd45ƅt]@X45T45)NF D DC 45T45ƋUL[^_]UWVSlj94559t45vE1 @U459p45r h45!M 0,ED'~E ,,1 @|45Dkt$tytȉMËMIF1ۅtËt Fo[V Åu pFE SFƒt )у}TCCKÅu17 45!MʉXܰ="45u =45t 1ߋMZY[^_]UWVSQ`45!u1WyEtƅUu045045,BZL45="45u =45t1Z[^_]US9P45ro[][]dUVS uuu=45uÅu6=45t p h3"h3"h^%P$, 2 1ۀ=45t Eu]j EPhR 蹺 ؍e[^]UWVS0] 8Cuw2E=45Ә h3"h3"h_%Et!9\459v 9w;5P45w=`45!E!ȉE9E؉EE;]wE)ЉE؋E9P45Eԋ 45EE܋U؋EE`45!s 45!u&)9ut }܉| FE܋]+]Sf)]]})EЃEE9Et]܋EЉX]̉XE])SUЋE]+]ZދUt}܋ 45VEaX="45u=451}M=d459wEE`45u!;]w )2E)U:DžEnEu045=045yK#MuU)&)ʉM؉U܋EBUUU)ڋMt E$EGwL45k="45t }F1=45u}u5E =45t*4 h3"h3"h>_%P$,e Eu01ۀ=45t&EEEEEj EPhR z ؍e[^_]UWVS }] u=45utttj ةt19uU;5P45w#Åu(2Åt%="45u9H45wJ9@45vB1߉81=45t & h3"h3"hs_%P$,W 1ۀ=45t Eu]j EPhR o ؍e[^_]UWVS } u!=45t1ۃ}E }~EEءP459E t459U s=9UE m1 AEU1 @9Mp459E w-9Ur@9Ew;h45Ӌ 0,U !E!99Ev45U !9EtU Å="45tE9E rKE9E =45X`459Ev^E ؋u؍1ЅuM="45t9u s+M UU Z%=45E9E M )U1jE!9EE9H45w 9@45u !EEE/‰EԸL45\45PVj]!WuÃUu L45YrBL45="45tE9E s+u U ڰZ$=45E9E M )1zE Åt9`45EuE؉ߋu9E s M ߋuMETAt)=45t0 h3"h3"h_%P$,- E Åt 1]=45t"EE܋E E]j EPhR . ؍e[^_]US ]=45t$]EEj EPhR  t ؋]]UE]ø@,ø@,UU,fDP]UU,fDP]UU,fDP%]UU,fDP]UU,fDP]UU,fDP]UU,fDP]UU,fDP%]UU,fDP ]UU,fDP@]UU,fDP%]UU,fDP%]USM] 1tt1;[]UEU ]UEU ]UE]UE]UE]UE]UU1;E t <t@]1UWVSuE 81ujPVZt C9]s؍e[^_]USUE 1 t @B9Es[]ڡ,UEE]$UVSME ًpVPy;P| uE ][^]r0 [^]pUS4@O%uY ZYuC u1]UE H w DO%]1]UU1t <t@]UUM 1t't!@,1t ft@]UEt,fDBf%f]UEtt ;U t1]UWVEu U ^_]UU,DP]UU,DP]UVS]t3";t$3"a 0PVSh_%h0,e[^]UU 1}w,t:t1]U "}3t3"]US1ɋE]  Xw Zw 8u tA18H[]UU `%9T&v,]UU `%9Z&v,]øUS] uSh0,O h!StY 0PhD#h0,h0,j !XZE0,]ݻ UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UEuE ]USPEtPt +wu PEPà uE 1]UWVSQpu5,11ҋ;Ms$9D~tk y8 T CՁ~xu@ u45@45Z[^_]UWVSQUB$X011`xwG0w(XtVWh.t0tww HupW9}1M‰&tY3`txu*uσ@t39}NjEZ[^_]UQEEUEEPEPqÃxuUSӉʋ@ щ[]ÃxuP45@45UWVSSMxuRÉ֋@9Cr4P]Wp-u90-[9H:9<]<-3K,9)LC9@S9R{uC45C45S93=@{uC45C45O{uC45C45D8DzK@9U׉DR}^f.E11=,H9}"uQMpZYMt UGjE@$E@PEp  u }G W$JO$f4P{uC45C45H98:x]9w{uC45C45<]t<-u{uC45C45=ȋUC9r{uC45C45S9sH9v8=ux]u {CK9ȉurM8-uP9vx]tx-t  -f9tÃ=,f9~+{uC 45C459}-UG1=,Hf9}3f9*jE@4E@PEp0 u MA0Q4f8fpBQ4E~{uC 45C451Er UGu ox]u3-U;Cr{uC P8]u 45C45{Ex8tC @tEH1=,HfE19}#u4у9tfEfUBf}t)Ex,x4u|x$uvx<up@(ffEf}t^U܉zC P U܋pEp(Ep0Ep 1}U܍D2 9Eu'C HC M+H 0؍e[^_]@e[^_]UVS(P BteVҋ,ftQÀt, t?,ff9t00XUՉMfE]U׉PEEЉ0X([^]É([^]UWVS ]CEB2\u?;Cr{uC45C45PƁ)/[*.th(>.90D<1ɺi {C @t.U{EECE^ ]U{1ɺ(~1ɺpwS B@xz@ wML(hES9s#H9v 8\ux)t)\W wCDLpS9sH9v8\ux)u {uC45C45xЉ}<t1M8OdBM@p KC @DbE xt{uC 45C451{PsCxU|Ut K9cUP}*u]CH+MuHK+MPCH+MuX^K+M`[^9}\x{F{9sO:,uJr39v<r,Drt+M M9~{uC 45C45PUSY9s$H9v8\ux}u1LH9w 9w 8\ux}u{uC 45C45 o붃$e[^_]UWVS]H {?SB< $\%^[v\y{|;Kr{uC45C45S B@pr@ w|(h;Cs8)t~) wCDLp;Cr{uCP18)uA45C45 -11ɺ/C H @$1ɺ C H @(뽺 믉MC pt&sEECE^ ]M s1ɺ(c;Kr{uC45C45Pu1ɺ1ɺ]CxUtUsCE9jHրvL<{t SUUw&@@EjP |EZYuS<[ ]lpDžtEEU1DžxEEeEtEEHEEEEEVE(C ChCC C$C(C,C0C4C8C<C@CD1ɺlEHCEt\p9lr'tu DžtDžl45Džp45l;ps.Pll]ٹl1ɺllEPSCjP|C u l!|CtXC0C\11Džh1\d\`%=0ywC=Fw=9=w= =(9\=ppw/=Xw=H=`=hD =w =xtY=w`= H{u \hFd8‹\d`%dd`%=`txt K  =u;sZۡ,uࡨ, Y[^]Z[^]UWVSljM֋E9E SEHE%=wG=(w== =ti]=0=`=w=*=ts===>9uu14fFf9;9utF\9utF]C ЉN9wuG 9wuG9wu G 9w s9wv~ 9wts> jE@D9wvZ,E‹]fDCÀ_t f^9wu G9w s'NMEDHu}_tz u E@_f ,9wuDQu _.FfDA9wu_t f _f DA_ 89w_,DJu _F9wu G9w ,NDJ_9wu Gt6< u ]CuЋ ,DQ<_9wN,DJu/_t*ED%EEu1]C]u؉E9u`@E]%=Xuruuu uMOuL]E=Pu^GM90tL0uuu E)PMt" =HuEG]4M=8GPx u )MuMA}dnM)M9\uG PV D@EME9uuEE=pucG؋PH UM+W PP uuu uMƃGUMTL =xuuE\uuSuM@ `SUT\%=uK=huYG؋HUM+W Puuu uMƃu'GUMLb% e[^_]UWVSEUME ǾM]EM9ME@EEM %=pz=8iwL= 3w$==Lf=|=(4=05#=Xw =H=P<=@=`=h=wE=w=xA=D==fzk=tlw=t#=t1s=hfwWf98f=|MEsf7E]fyNf <f%fUB ȋU?E!! ؉ʁU! ˅UJ+UUM{! É!2tiEȋUt %܉!A5! ÁEȋU%=t! ! ED؃[^_]UWVS0ljUMȋEEEEӋG(E܋G0EԸMjPh{PM U}tEfEu9w t9wuGt u^f]uԉù}t]܉]Eu9wt6fuE fEE;Eu }tuuf} uRփuf}uGur$u~ E1f} uBu$YE1f}DG:f~u|}J(M1f}u1GuEf}u GuE}t!ˉMVPuPM UqMuf~t)f}U ,DQu9f}_t2f}tU ,DQuf}_uzf}t>,MDJuf}_u&f}tf}tMDJu f}_tyfwVPSPM U,f}t:f}tLMDJf}_ ]DZf}_ 8uF,MDJuf}_f}u*MDJuf}_tVPhwPM U%ŠM t }uF]]M9Mt2;Et-VuURPM UUUfufuP}tPEGEt?E@E6f}s1f}f} 1$Ee[^_]UWVSÉM}U;} @EE܋E4Xt}xtHu1%E#EMt %E݋E@EXw30tqwtg(t_ MHpMx h{E+C WEMjuWU+ju uM‰9EtNGjuWU RuWUljuWUju uM‰9EtNGEEjuWU tMM9tEuWMUY_juWUUEju uM‰>9EtMIˍGE@u܋0%tjVuMU 9Et+VFE@4֋%=uNVuMUbXZEE {E+C GW u}DEe[^_]UWVSljM֋E9E NEHE%=wC=(w== =teY=0t=`=w=)=tr====9uu13Ff9;9utF\9utF]C Љ9wuG 9wuG9wu G 9w s9wv~ 9wtt> kE@D9wvZ,E‹]fDCÀ_t f^9wu G9w s'NMEDHu}_tz u E@_f ,9wuDQu _.FfDA9wu_t f _f DA_ 89w`,DJu _G9wu G9w -NDJ_9wu Gt6< u ]CuЋ ,DQ<_9wN,DJu/_t*ED%EEu1]C]u؉E9ua@E]%=Xuruuu uMTuL]E=Pu^GM90tL0uuu E)PMt" =HuEG]4M=8GPx u )MuMA}doM)M9]uG PV2 E@EME9uuEE=pucG؋PH UM+W PP uuu uMƃGUMTL =xuuE\uuSuM@ aSUT\%=uK=huYG؋HUM+W Puuu uMƃu'GUMLb% e[^_]UWVSEUM܋}uE fEӉE؋M9ME@EME%=p=8wN= Bw&==fEf=|*=(F=0H_=XKw =H=PL=@=`=h=wF=w=x^=f==f}zw=txw=t(=t8=f}wdMf9M?fEf=|~E}fEfffEefEff}yJSfEff6?')f}'f}EMA UE%E)E ȉ‹EUJ+UU LE%tEtzMMсt ڍDM C LE%EMȋMI tE؊DEC [^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉fEE9C t9CuCt E@fEEE9CtffEE fEE}t!puRU UuEEf} u@Euf}uCu p$~11f} u@u11f}Cf~u|}p(Ef}uECuFEf}u CuMFt#ljEuRuRM UƒNuf~t)f}E ,DAu9f}_t2f}tE ,DAuf}_uzf}t=,MDHuf}_u&f}tf}tMDHu f}_tyfwuRPRM U[ƒ,f}tBf}tTMDHf}_ uDpf}_Ɖ 8uJ,MDHuf}_f}u.MDHu#f}_tuRhwRM Uƒu ր>t}EEHQMuRU. U9UtYtU}̋U֋M}HtuuuREPűM UD‹uufEfE}tVECE>tDE@E;f} @f}Ef} 01Ee[^_]UWVSÉM}U;} @EE܋E4Xt}xtHu1%E#EMt %E݋E@EXw30tqwtg(t_ MHpMx h{E+C WEMjuWUju uM‰9EtNGjuWU RuWUljuWU]ju uM‰G9EtNGEEjuWU! tMM9tEuWMUY_juWUEju uM‰9EtMIˍGE@u܋0%tjVuMU 9Et+VFE@4֋%=uNVuMUbXZEE {E+C GW u}DEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉fEE9C t9CuCt E@fEEE9CtfEE fEE}t!puRU UuEEf} u@Euf}uCu p$~11f} u@u11f}Cf~u|}p(Ef}uECuFEf}u CuMFt#ljEuRuRM U0ƒNuf~t)f}E ,DAu9f}_t2f}tE ,DAuf}_uzf}t=,MDHuf}_u&f}tf}tMDHu f}_tyfwuRPRM Ulƒ,f}tBf}tTMDHf}_ uDpf}_Ɖ 8uJ,MDHuf}_f}u.MDHu#f}_tuRhwRM Uƒu ր>t}EEHQMuRU? U9UtYtU}̋U֋M}HtuuuREPűM UU‹uufEfE}tVECE>tDE@E;f} @f}Ef} 01Ee[^_]UWVSÉM}U;} @EE܋E4Xt}xtHu1%E#EMt %E݋E@EXw30tqwtg(t_ MHpMx h{E+C WEMjuWUju uM‰9EtNGjuWU RuWUljuWU^ju uM‰H9EtNGEEjuWU" tMM9tEuWMUY_juWUEju uM‰9EtMIˍGE@u܋0%tjVuMU 9Et+VFE@4֋%=uNVuMUbXZEE {E+C GW u}DEe[^_]UWVSljM֋E9E NEHE%=wC=(w== =teY=0t=`=w=)=tr====9uu13Ff9;9utF\9utF]C Љ9wuG 9wuG9wu G 9w s9wv~ 9wtt> kE@D9wvZ,E‹]fDCÀ_t f^9wu G9w s'NMEDHu}_tz u E@_f ,9wuDQu _.FfDA9wu_t f _f DA_ 89w`,DJu _G9wu G9w -NDJ_9wu Gt6< u ]CuЋ ,DQ<_9wN,DJu/_t*ED%EEu1]C]u؉E9ua@E]%=Xuruuu uMTuL]E=Pu^GM90tL0uuu E)PMt" =HuEG]4M=8GPx u )MuMA}doM)M9]uG PV E@EME9uuEE=pucG؋PH UM+W PP uuu uMƃGUMTL =xuuE\uuSuM@ aSUT\%=uK=huYG؋HUM+W Puuu uMƃu'GUMLb% e[^_]UWVSdEUE8e p >E F E ЃEF@EFEF=,-tEt}E EE GEu v ZE EE E}9}l ~,N4tMF8EtCF <$z& Ĥ[^_]Ëpo uՋduq`lh p@ pE $& Ĥ[^_]D$4D$<$S> D$ AD$<$9> `4D$4D$<$> D$#AD$<$= \D$AD$t<$= \D$4D$<$= aUWVS HM t E Ut EEE2EEE썃AE䍃EED$E$^tTUtހnt1҃aw4ɋ8xo AN [^_]ùƋ}O7EtEE TE I:AEt EE  E #ADVUtEE E uGEtE} |E qU܍ AL$$: U܅uu tE M5E *uB_Et EE E H 령`3At_Mt EU 3E %Ƌ}At0utEM E E t E EE E tE EiE ^} t E uCE 5E tE }E U tE EE E t E EE T 'fffffUWVS ؽ CME} D8Exw@$| /ĸ [^_]ÉMD$ED$<$q EDžDžDžDžjDžMDžDžDžuu ωƍOWt#%3F9wۉωƍOWu݉+E;U ĸ [^_]ËE@fEEDžDžMD$ D$D$D$ |$D$E$ψ DžDžDžDžDžMME@fE@ff}WT$D$ [*D$D$<$&t$ D$D$ 4$EDžDžDžMEx@EP Ɖ( Љ s Dž ME$yD$D$<$n D$:<$U DEED$ED$$0ƃ}ĉ|$UT$E$B ƃtdE$1B ƃt'D$ED$$/1Ƀىxk UD$|$E$aB Wk UMk 8D$ED$$e/+k 8t[^_]k UWVSP z Ñ2Dž/devDž/XtyfDžXXƅD$ $0t-ƍD$D$FtH4$] 4$0D$D$ D$D$z3$I@Džp,0ƅpD$D$$%/ƃƅtXL$D$$R3uT$$V3te4$/lCJi P [^_]-i 8u+wً$0uD$D$$=.b‹/M1M utD$E$iMt#ED$D$$sEt&ED$D$gt$[ 1P [^_]1P [^_]\WDžUVS胩 Ú/ED$ED$ E D$ED$E$ƃt# ƃttEUE$-[^]ËE$-E$3[^]UVS / ;` D$D$$V tB` $藩 ǃ` $?-ǃƃ` 1 [^]f 0ǃ` $-ǃƃ` tf 0ǃ` $,ǃƃ` wf uUWVS<ԧ -uD$/4$2 D$@4$r+ƃD$T$$+e 4$,Ƅ=D$D$D$D$ D$D$ D$$F ƋtVu~8 us<[^_]À` uRg Ɖt$?D$ kD$D$4$cl= e ?똍` d vUVSH _,u@ 3D$/4$0 "t$` $:  ` D$D$$S BD$ D$D$$W !Ѓ` D$aD$$j1[^]FRD$D$%@4$(D$t$` $XY  Ɖt$?D$ kD$D$4$j=4c ?)$htƃ@ Yc 8#t'b 0gb 04$mƃb UE$؉]fffffffUWVS *E@ E։υEE y ]]U ] ED$D$ $D$rЉMʹ;MM }#UM T$L$ M $D$:Љ9rgMϋE eƉϋMڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEUWVSLĢ (D$T$|$ |$D$$VD$(H*)R)L$L$|$}<$qVteEU +D$T$D$T$ \$(K)R)ƉD$T$)iD$T$ L[^_]øUWVS< 'E؉Uȋ,8}TWK@<-R<+VESTWE@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }STW0)Ӹ9ȸdx<-t8<+E]܃}tmEȉ} <[^_]E<@tq<(u|1Ґ<)u~EAt<(uAu1<[^_]ËEPXEȉ <[^_]TWWEȉ_}ȉR}}܉}}ЃCM̃QЋ}DWu.u ;]rډMދ}Eȉ8Et)¬,U܋Mԍ|DAt;uf}am}a.m.f}pmb}p.m.8E܉$&] 1҃t)D$D$E܉$P Ut(t]UЅuЉD$E܉$ Uu؋GW ]؉SG}PE}t%EȉǍ|EЉD$E܉$i tu⍆nD$E܉$G \D$E܉$" Nuލ EĉǍẺD$E܉$ uދ}܉<$[ T:s D$E܉$ uހ}u<E}DGt.`qD$E܉$d u1ۋE܉ .u}.E}EV}t A}ċẺỦD$E܉$ Uust(}ȋEЉD$E܉$ u޸UWVS )"Ƌ'<'wwEVN)щȉMEED$$jt_FMȉFD$F$mjt:F]؉F>FDF 1[^_]ÿ'E {UWVSF Y!EEEEMM11rEEEUU1EEE}tZustU=qw 9 }u@EEU nEyEtU4q{9 nE;ErEE`PUXMčAEċEUAQ @EtEEYE M)ȋUč‹REUF3 EuuU1 ]]Etqwu<~9ErEE$#kE$kEĤ[^_]EEOME)ЉEM)ىMċ`zPU@AEċEUAQ }E&MċAQD$ D$<Y $\$щ‹E*FEĉEME)ЉE])ˉ]ċ`@tсqw 9 9EwEEPUXMčAEċEUAQ @`EH EĉEP@ I] ApAhQl,MċAQD$ D$E@$@@(ME)ЉEM)ىMċ`CMĉMYЋAԺx9ڻpQȋY;l9ѺPH<h9иUxB`4EEE݉ EEEEU E?EEEutEU9EwEn{`EPUXMčAEċEUAQ @EUĉURMAt M 1uUT$$JtFu̿[^_]UWVSws Ît:>t M1uU T$$ItFu̿[^_]UWVSs 't:>t M1uU T$$MItFu̿[^_]UWVS r E $EE%EEE4UUT$$dEtRt:>t M1uUT$$Ht.FuEEu-E$DE [^_]Ãt׉ U1ku}9t<$/ D$|$4$ EUE먃}tEEEUWVSuq Ìu Ex}u 2t)D$4$Gu+UE@ [^_]Ëd t 1[^_]Ét$,&D$$UWVSp E D$E$RH/ D$ED$4$gNjE8tB/ 8"tnxd uOt$ E D$&D$$щ[^_]. 8"u썇vx뱋d t[^_]Íw녋E D$%D$$UVSo uF$AF $A4$A[^]UWVSo uE 81҃uU$p9Ef4$NjExD$E$=MA ^EM H04EED$<$Dž?nED$=<$ HME u D$<$-Eu+E UJ UV tUN}9~t!ȉ1OUN}9~u oSEKEE ed t4}G$5@<$-@EE[^_]El|$,&D$$z <$?E$?EfffffUWVS8m ÿu, D$H&D$4$guD$:4$; DžD$ `D$4$/lF$X+ $7D$$OD$D$|$ D$D$&4$ $6)D$D$|$ D$D$4$ r|$$Hƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $  $bD$$ |$$ƅOD$E D$ ED$D$$K$xD$E$HPD$$*}$ =$/uEt$D$<$!t'D$<$pa ) 8E D$t$E$ }8[^_]ËE D$D$E$ E D$D$D$ ED$D$&$Q EE D$t$E$ }gM( E D$N&D$E$ Dž1D$ n&D$E D$E$ED$D$ED$ ED$D$E$ x E([]øUS(@g WD$ D$$?D$D$D$D$D$ D$D$D$D$ $E x D$([]øUSf ED$D$ ED$ED$&$x E[]øUSmf ÄE$&UPf kUЬt Ь]ÍpЬ]UWVSf 1}|$E D$E$W 9v [^_]h$ ?|$ t$&D$$Ь[^_]UWVSe }|$E D$E$K 9v [^_]# ?|$ t$&D$$Ь[^_]US :e QE$st []ÉE(T$$ЬEUS d E D$E$t []ÉE(T$$ЬEUVSd ýu4$.t[^]ÅtEt$/(T$$ЬEUWVSUd lu} |$4$2t[^_]ÅttE|$ t$0'T$$ЬEUVSc u t$E$2t[^]ÅtEt$I(T$$ЬEUWVSc ô}|$E D$E$ u[^_]É! 0|$ E D$X'D$$Ь[^_]UVS2c IuE D$4$q-t[^]ÉEt$f(T$$ЬE[^]USb ED$E D$E$PuEw(T$$ЬE[]USb ßED$E D$E$uEw(T$$ЬE[]UWVS,3b Ju} D$(D$EUD$T$EUD$ T$|$D$4$ щ‹D$(u Љʃ,[^_]ÉT$ L$$L L$(EUD$T$EUD$T$|$ t$|'D$$ЬT$ L$$Љʃ,[^_]UWVS,ga ~u} D$(D$EUD$T$EUD$ T$|$D$4$bщ‹D$(u Љʃ,[^_]ÉT$ L$$ L$(EUD$T$EUD$T$|$ t$'D$$ЬT$ L$$Љʃ,[^_]U` U!w (ፀ]Í}]Í]Íz]Í]Í]Í]Í]Í]Ík&]Í]Í<]]Íc&]Í]Í-]Í]Í]Í]Í]ÍT\]ÍZ&]Í]ÍU&]Í]ÍP{]Í]Í]Íb]Í*]]Íwg]Í]Í]Í]Í]Íg&]ffffUWVS\W_ rEЋE0t8x t:t:] EE\[^_]Íx@ uƋEЍmE EЍ)Eȃ}U EUD$ T$EȉD$E D$E$]$Ex;E vEEE EEEEEO‰E̅uuEEE<EEEEEG:~=u*V]6ȍx8LO‰E̅ GEGE܀F~bEUM t1҉ME;E_U +E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]"UU]EÉ]PUԍt;u s EEUE@E\[^_]t̋uEE<EE1ҋ]];E++E)Ƌ}EF;E s>;u s7SM]L$ \$EȉD$E )D$$U]!UӋMˉ]At;u s <]1ۋU WUUMM:;u sUM؈ UU  }9E+E)Ƌ}ܺF;E s>;u sBUMKEUD$ T$EȉD$E )D$M $] ]UMEÉ]tUUE<1;u s2}OM׍WO 5EE,׋E;u sD] ]1뺃}<Eԉ}܋]O ;}]11끋E] DE~EЍ)E%UzJ ;f-GEG t1ЉEӉ]EUM t1҉E!ȉEE!ЉEM E;EU+E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]UU]EÉ]PUԍt;u s E;u sBUEHEUD$ T$EȉD$E )D$ $M]MMUEƋ]ËMH;u ZEGEd}/;u s ̉ȃ}E;u sHMUEXEUD$ T$EȉD$E )D$]$]:]]MUEƋ]ÅH;u REGm}5;u s Ӊω]EEEEE<E]|ED$ ED$L$ME )D$}<$]wsE;u Mjlj}EtEM]EEE<EU]MԉEA]CS]M9M}+M)΋}F;E s E>E;u sHMUEXEUD$ T$EȉD$E )D$]$]x]]MUEƋ]ÅuLH;u EG}9;u s ӉωM]EEEE<E ]}]E9EM++E)ƋEEEF;E s E>E;u s5ExEUD$ T$EȉD$E )D$<$]^}]ދE؉EU]ԃ;u =EEE;u E=EEE]1 ]1=u8ExE]MԉNjEE9EM+E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]$UUEƋ]É]UE;u -=CEEEԃE;u s E=EED$ ED$EȉD$E )D$E$]ƋMM;u sE]E;E]98M+E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]UU]ދE؉EU]ԃ;u m#EEE,EEEE,]MԉEE,MEE}%EE}E}EE,E;u vE#EEEE,$EEEhE}EEEE<E<}EbEEEE,EEEEEE,EpEUD$EUD$ T$ED$E D$E$]fffffffUVS O #uED$ ED$E D$4$tD$ED$4$U[^]UWVS4N UEzljaED$/<$N t8|$\D$ED$ ED$ED$4$/t~4[^_]ËE udhkE|$ED$ED$D$ED$ ED$ED$4$ud 8tY4[^_]ÍEB 8uދED$|$TpD$ED$ ED$ED$4$pAED$ |$ED$ED$)D$ED$ ED$ED$4$+ 8Pt&  USL EU M]]]] ]][]USEU M]]]] ]][]UWVStL æD$L$<$ t$7D$<$1 Dt$D$$cũED$ ')D$D$$ [50E D$ED$4$0t%}̉|$E$ED$|$4$4[^_]UVS s> ÊUB8} t B8[5@:t1 [^]%B81 [^]ND$D$a5@<$AH81 [^]UE@:]UVS = [5t^ ,€,T$XT$$2[5tE$0[5$g $C[5 [^]ÍE$ u뎍L)$>$UWVS0+= BuwLjExEڋNMEE܉MM E,Eԉω4$^ƒ   UUFD$ D$FD$4$JU9Ut{E9uN=?E܅ҋEԋDPEmED$L$4$;.4$4^ƒ6X;} M8Mtt}ED$ FD$FD$4$gdD$ FD$FD$4$FdEP9FU뗋F;EED$FD$4$h-EEXUD$ ED$FD$4$cEH;EUE9FM;} D$ ED$FD$4$cEnT$UFD$4$,U:10[^_]D$ D$FD$4$DcD$ ED$L$4$$cED$FD$4$f,\FD$FD$4$bD$ FD$FD$4$bFD$FD$4$,}tE9} uD$ FD$FD$4$bFD$FD$4$+D$ ED$L$4$JbNAD$ ED$L$4$'bN)UL$MFD$4$^+UM5UD$ L$MFD$4$aUMU D$E D$E$]U 8 D$UT$[5$~]UWVS 8 üu}ED$E D$4$*tE} u [^_], [^_]UMU E~tEU M]]UWVS 8 3u[58E D$ED$<$*tEu } [^_] [^_]U 7 ֽE [5~)tD$ED$$Y]ËEUWVSl7 Ã}EEuED$E D$<$a)t'~#tuEE }[^_]E[^_]UWVS6 EEu[58E D$ED$<$(t'~#tuEE }[^_]qE[^_]UWVS(6 E}WDU[598GH%EW,OM܋M11ۋM;Orى}}}:R][<}49%yu/}O,} 9+Y<[ω<]fV% EFt$E@|$]fF9uvJVF]9ulÁ;][^ Pf~E9uwtVE@,UʉM+PÍ@‰ЉЍD$ |$E܉D$E$]MEE܋U9B~ R,1}<$]1([^_]ËGcE:U4 [5$]UVSh4 [5p 4$u N8@[^]øUVS,4 Cu4$u N8@[^]øUS$3 E UD$ D$D$D$T$T$ D$D$E$$[]US$3 ÷E UD$ D$D$D$T$T$ D$D$E$$[]UWVSB3 Y}M uUtA$M U :5tUF$U :5tBU$XU :5,048<@DHLPEtE@$W :5  $(EtE@$8 :5TX\`dhlptxE tE @$ :5|UUUUUUUUEE$tE$@$ :5U UUUUU U$U(Uċ,EȋE(tE(@$ :5ŰUЋUԋU؋U܋UU䋐U苐U싀EG@t ʋwHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉ`T|t ʉt ʉ\|Mt ʉt ʉXUUt% Щt TE̋G|GlDž|fh}$ E@,@1fB;<‹fbBz t$"uE@,@B tfB\$V PF ;uϋ;42f|2yW}$G,HfD11f|1y.ODfHD$G|$Duİ[^_]Ë$NE@,@|+d|p9ihf+fG9@)fL09@4 ȋf`Hp tv$uEP,@D 9YE@,HfAAxωt$KRO HG ;uϋxt9pe9l<}\h$Oy DžEd$*xy DžxEP$y DžEԉL$y Dž4$y Dž|+t+p}9Qp9pE@,@Dž4fF9ffF~ t$^uE@,@F rfF0X!4N HF ;0$uDž!pdE@,PЉdU/UB,@NjJHOfG93<JDfHD$B|U$[uDž5AAA AAAAA A$FFF FFFFF F$O,B0B4B 8Bǃ0 <ǃ4 ^ǃ8 vǃ@ #ǃ :ǃ 'ǃ #ǃ #ǃ$ #ǃD -ǃ< -ǃL _ǃ` |ǃx oǃ@ -ǃH -ǃd <ǃh >ǃl *ǃp !ǃt f|2E@EuTAtcҐx uEt(VT$´T$ D$D$E$1 Tl=u[^_]US( ?M1Tl =u[]UWVS,  EƍME$+FF(9u݋uD$$8CuxuD$$$3T$$ǃ@ !ǃ, +ǃh !ǃ0 ,ǃ !ǃ4 -ǃ !ǃ8 .ǃ %ǃ@ 0ǃ %ǃ `ǃ %ǃ aǃx ǃ fǃ ǃ gǃ %ǃ hǃ &ǃ$ iǃ %ǃ( jǃ@ %ǃ, kǃh %ǃ0 lǃ %ǃ4 mǃ <%ǃ8 nǃ0 %ǃD qǃ #ǃ< oǃ #ǃL sǃ %ǃP tǃ $%ǃT uǃ 4%ǃX vǃ ,%ǃ\ wǃH %ǃ` xǃ8 ǃx ~ǃ #ǃ@ pǃX #ǃH rǃp d"ǃd yǃ e"ǃh zǃ ǃl {ǃ `"ǃp |ǃ ǃt }E|2E@E Et@u(x<uD>E tAuЃ,[^_]Ëu܋E䋀t+MQT$´T$ D$D$E$El }Wl}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$>@ $<h $^| $vj $#X $:F $'4x $#" $# $# $-0 $- $_ $|H $o8 $p $rX $ynp $z\ ${J $|8 $}& ^US( C ]l JHJHJ H JHJHJHJHJ H J$H$((9u[]fUWVS8 ҄E܉U؉M[5E02EE荆4E [5MfEtE$0E$hǃ=EA 4U  4%y  444fǃ EDxfxzMf8@E f>f,4M<%y 4; 4ufǃ EDxfyEE4D$ D$D$$44 49)NjM Mԍ4T$ |$ED$E܉$|ƒD4%449 41fǃ P5f18[^_]ÿ)hfE.}؅E$kǃWE@ @OM Mt{/tE@ 4  MfA 947fǃ 8/fT 449}Pdž4υu1N$uF$`| MUtpPuE[^_]Ë}UWVSQ hw¹tIv)t1$UE vU:t :t#:u1[^_]ÿ[^_]Z[uJmt݄tރB0tqωvE;tzu봄tVUWVS0 vUu :u|2tU$EUF@fu|2ML$ MD$T$<$|2M{EPJ(N$JN 3a{)$ 5D$D$$RFT)$ D$D$$QFXF N$[5 [5VT[5VX[5|2P3B0zp12džl2E䋺M싊TMtUUdžl2ELɉMEEM܉UtrD$Eԉ$UE܋U؉$Mԉ $޿E܅tH1IH 1$菿p2džt2EtEdžt2džx2tdžx2E؃0[^_]Ë@@Dǀ@l@hǀǀǀ<HHpF$B(Ft#U܉|$E$e Uu džl2EU܉D$E$e Uu l2MU܋ED$E$e Ul2EtD$<$[e u džx2EtD$<$:e u x2ED$<$e x2t|$E$d u džt2EtD$E$d u t2E$D$E$d  t2|2@@FXFT,F@ftfL$ D$7D$<$i|2EK1"4L$듋E>džp2džt28FXadžp2džt25U= Xp[5D$E$]US ,pE[5H$ [5H [5HT [5HX [5Hh [52 l2 p2 t2 x2 |2$>[]Uv oM[5tJX[51]ø]fffUWVSLjMEE_ɉME9tBfx ft0fu9QuԀ}tEAE 9u[^_]ËAM L$M $MUkUUWVS ønƉMDPfx 4[^_]Ëf=t|fDVƒ4EftL$5E@f9uǁNF[^_]ËEFF[^_]fLVuMED$<$袶ljUU$ 蚱UtZf@f@@ f@@f@@MLMH MM;Eu)$4$ȧ,D$ D$D$)$r $菧)$$uUWVS lƉ׉M$ tDLMt5$LVp9uϋ}E$TF [^_]UWVS 0 KlEu^9t)fxf8u@$9u׋~#1E$]E9߉ $]ʷ4$· [^_]UWVS X9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS "k}fǃ $ܮ@f9uǁ2ǃ ǃ ǃ $*F|2RtK$苢 =w3D$T$$膘 2:;u[^_]Í)$$US iE E[5t+2UT$$UTE []ø []U} iUM ~*[5t2t z1]É1]ø]UWVS 3 Ji[5te3339}}<31 [^_]à D$$賱‹t!3333뱸빋33D$BD$$D 33]\331o%U W rhE[5t%2UT$$1ɋUE]ø]U $hM[5tJT[51]ø]UWVS g}<$ƃuOG @tI4 8u?[53t-[5D$[5$oǀ3[^_]UWVS V mgEU[52E[5EEtE$oE$ ǃ=E5 <%y  fǃ L~fq 1fq fKfLfEMyUU$E$HNjE@ @aimE@ t} <%y  L~f  X yt싓 9Jf y [^_]Ã}fG 9 < 9fǃ  [^_]Ë <%y  ; ?fǃ 1EuEE$NjE@ @UfB  [^_]ËEQ). 9'fǃ [^_]1Ef` [^_]Ë ,D$ D$ D$)$i $zUWVS cu[5MV8у$Jq33 ,M MEt[5:E F8V<tf11‹Ft[5X,[^_]% @B[53tZUS B[53u33@fuT$$ Z ؃[]øUS 袻 ùA[53@fuT$D$$萄؃ []USM dA[503@fuT$$cY ؃[] US Aa5@} tI|t7NT$D$$o[5ǀ3@$M 1 []ËxtNT$D$$&[5ǀ3@$M 1 []UVS E \@a5@[53tB|t1NT$D$$譽ǀ3@$%M [^]ËxtNT$D$$kǀ3@$L [^]UWVS 萹 ç?E[52tt_ [^_]a5@tǂ2NT$D$$μ@$PL [^_]a5@@ttǂ2a5@jǂ2U趸 >[52$]UUE 9B| R,]1]UWVS}U MxZG9}SxO)9E9}5O,EO(G\p;}@ ;~9Uu1[^_]É뷸UWVS}U MxZG9}SxO)9E9}5O,EO(G\p;}@ ;~9Uu1[^_]É뷸USEH~X,19t t[]1UWVS}G~tuE4EEEEE+E$̆U9UMM)π>t5UE܉D$ |$t$E؉$讄Ey8[^_]1EEԋ@t[u׋EԃEMEEEЀ4uŨ8[^_]UEԋ@u})29ǃEԃEtUt$D$ lj$dc E)uUMwMȋ}uԋ6sOtft}})UEQut$D$ }<$c E+u)auuEfUWVS,詯 5EU܅E܅ϋM93}D°,@t DB@u<$tm ?M4MMM}؉E$&Ut7)׀>t.ED$ |$t$E$pEyĸ,[^_]Ë})t$<$…t܋E܍HD@u4]Xʉ1,[^_]ø1USh 4Ew"جD$$1[]øUS% <4[5t3tUT$$[]øUS 3[5t&3tU T$UT$$k []øUS薭 í3[5t3tUT$$[]øUS R i3[5t&3tU T$UT$$ []øUS 3[5t3tUT$$[]øUSì 2U [5t*3t ML$ T$UT$$[]øUVSo Æ2[50toƆ43u'3tU$z3$y[^]Ë|2Ppt%T$$%D$|2$[^]øUS ۫ 1U[5t$3tD$T$$ []øU莫 1U[5t~;3TR4]1]USQ h1[5t3t$T[]øUS +1[5t"3t$St W[]øUWVS ˪ 0[50Ɔ43uj33~BE14uJuE;3|Ճ}tO3$'w [^_]Ë|2Ptt&T$$8D$|2$ [^_]øU 0U[5MMM ]USƩ /[5t3t$A[]øUWVS 臩 Þ/[50E E4ED$ D$MML$$}tiP$UsDžtUU UED$ UT$ML$<$R}t&E$U6Ɖ<$z [^_]þUS迨 .Et3t$zQ[]øUWVS腨 Ü.}3t$q3~#1v4$^z;3|ߋ4$Ezج3ǃجLJ3D$0$u4th|2PtD@@X~:Ƈ3$-|2@PX3@$31[^_]Ƈ31[^_]øUWVSb y-}3t$N3~#1v4$;y93ߋ4$"y[^_]UWVS]3e3WE Q3433U U׉UU+UUVU11]]9t0p9uu9u]1]39114uu;3|ى[^_]@,3WP\4u u )׉<)} t7։L|A1[^_]ǃ3UVSO f+utNFX3|2@@T%D$4$ E D$FX$1[^]øUWVS ߤ *EExD$D$<$Gzƅt.)‹M tMMtyu' [^_]ËE tsEt_utXEM`\5 u/1MfT$|$E $yE 01 [^_]f%ʸ [^_]øtUWVS *u EE}4$xEw`}E(1M19rEtfEtЪE1[^_]Ë$xHu } 9uuE$xt؉EPE 15EE1 ;ErEtfEtȪE%M`\5 tMft ȋMEMH]1  9rEPE 1u\EE1 ;ErEtfEtȪE MEB[^_]ÉЪE'Bfm뚉fm7fmȪEȪEZEEEPUVS| Ó'EU tt%B B[^]4:5XZXZX Z XZXZXZXZX Z @$B$ [^]UWVS 'utv4$'rVȉ‹9u F0$rF,$r[59pt]9p tJ9pt2t$%P$r4$~r1[^_]@u@ 9pu@9p uUF4$7r>9UtU?$9Uu~X24H90t…#ȋH90utJ$q2UWVS譟 %lj֋@X|2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$|UtB8tt<$bu 1[^_]ËGX|2W@W@@@8t ։w@и[^_]UWVSÝ #lj֋@X|2@Ttg@ tg@tg@@tg@tg@tg@tg@tg@ tg@@tg@tg@u<u@uH%ta5@@8t g@1[^_]Ãg@t<$-t<$6뮸[^_]US耜 "MU [5t*t X@t@@f%f1[]1[]ø[]U/ J"U[5M u][]U "U[5M u]]UVS՛ !] [50Eu/ځ] ډ1[^]ø[^]US} !U[5t-HX|2H@H@[[8t ʉP@1[]U/ J![5U]bU ,![5U].UVS ![50tFFX|2@Ttf@4$<4$Ma5@@8tf@U1[^]USEM Ut*t X@t@@f%f1[]1[]ø[]UEU Mu]s]UEU Mu]@]UVSuEUu0ÁE % úډ1[^]ø[^]USEU t-HX|2H@H@[[8t ʉP@1[]UEt@@]ø]UU E]UU E]zUVS> UutFFX|2@Ttf@4$4$a5@@8tf@U &1[^]Ϙ a5PT%t t t@t̀t(t t8t ttLt 1 *a5PT%t t t@t̀tt4tt t@t@t(t t8t ttLt 1봐UVS u4$"U D$t$[5$ [^]UVS 迖 u 4$T D$t$E$ [^]UWVS 膖 ÝuU [58x1u 9t <u‰T$t$<$w [^_]É4$lT UWVS % <}[50E D$ED$4$t<$(T D$|$4$ [^_]UWVS ˕ u}ED$E D$4$Ƈt<$S D$|$4$ [^_]UWVSv Í}u[5E D$ED$$Uft/Ux0u 9t<uƉt$|$$G [^_]ÉU<$9S ƋUt$|$$ UWVS ݔ u}ED$E D$E$Նt1x5u 9t <fulj|$t$E$ [^_]É4$R UVS c zu Ux2u 9t<u‰T$t$E$Z [^]É4$PR fffffffUWVSD }E0uċEG,@4E@U }4 ?E EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$BuD[^_]à E1D[^_]É$hFE@E1҅t4}$\tMTO HG ;uu֋}E  G(MJ9~R 9}ED$ D$ED$<$.RE@f=$gGE tPM E;GTMW,M M Mč@44MEEFEȅVE@$EgEyEGM+;EE W(M@9~F t$bF E@ffW@EE ЉE% GH% ȉFEfFE@Eȃv?}$ZMLO HG ;uu҉}NEčPEE~f}ωƋEW tEMȉ$aG EMȋURQWWfWfwu}G9MwT91PO(LE @ 9}GPT$ EĉD$ED$<$EEGT9tBMW,M P GG(<$1D[^_]ËE;GT*G8 r<$<$ EE 1D[^_]ËMčQMĉy19Nu)MAHFALfFuEy19E0A,4v4ADfFt$A|M$N_uEOT9tE  EEG(B9G;EM+GHFGLfFfFMPG9MGDt$G|$^u6t GH ${MMċu6W,4R49EJMȋGDfFt$G|$[^GHFGLfFMȍA9G~ f~xW(ʋE @ 9}L$ EĉD$ED$<$oEEG8 .E MG19)ȃEG8 ([58u E<$GG8 <$jEEċuϋE UW(@9*#M O(LR 9 } GD$ EĉD$ED$<$EEGT9tBMW,pM E<$EG8 5<$uUWVSY t8uE0E,EP@,Dt@ 1Dž<H4pHTDžPELED$LD$,D$ 0D$DD$E$<] )~_@D$ t$E D$4$8^ÉDž[E H @1?<[^_]U D$D$ U T$UT$[5$d]UD$D$ ED$E D$E$1]UWVS荊 äu}U } v}} utFXHX?)щMEVT9EK1ܬ 9}5D$D$ D$\$4$u˸E N@U ʁE% ЉEE$_V(E EH9~EH 9}NDȋUR t} tE fdVHMu5 UPFP9t:4$^1[^_]É%W ʉPFP9uƋEÃ} 1[^_]É4$ E  E;FTt,UV,U } 봋x1F8 4$EF8 .E vFU9)EUWVS+ BuEE}ED$E D$4$ zt&EE}EE u[^_]j[^_]UD$ED$ ED$E D$E$/]UVS茇 ã [50E D$ED$4$yt&D$D$ ED$ED$4$[^]- H [5a5@8tt J@Ëu߆   a5Rt[5`@U訆  Ua5@8ttJ@]Ëu]Uj u E a5Rt`@]) D [5PX|2R(tt H@Ëuڅ  [5@@UEPX|2R(ttH@]Ëu]UE@@]UWVS] t Ɖ׉$E4$ED$FPD$4$Cw߉|$4$#ED$ML$4$w[5;0t 1[^_]$ Gu[58uFUE@8 t ]L]U贄 ¿ E[5 A8 tu]ɉ]]US聄 EU [5 x;Q})Å~ APQT1[]øUME A8 tu]ɉ]]USME Ux9Q~)Å~ APQT1[]øۃ  a5@t 1譃  a5@t 1UWVS,z Ñ ƉE`\58}t[590FHE%Eu~}FP 9IE@)u9~U܃E؋E؉+U9EU}CIE@RωփtftE@EmEm;E|4}G,U4"E!umEm;E}̋}E܍D8E9}WEE1҉fF;yA,U4v4ADEFFfFt$A|M$1RMu,[^_]ËFTE9E؃)E9UX8ϋAmU9"9}|,u؋}GD$ D$t$<$;w}ڋE@t$^E$j1,[^_]9|E@T9E@E)9U)‰U9~xE:RE@I׉΃tftEEE;Et4}G,U4"E!uEEE;Eű}9}uFEE1 ;wG,U IODUPHfHf@D$G|$@Pu E)9EE9EB}w9uRGD$ D$t$<$29uu'E%ffa BU *Ut[5]q1]UEU t]Z1]UWVSE89tX@EO+Mw~>EP,G(UW,u4}y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UE@]UE@]UE@]UE@ ]UE@]UE@]UWVS$} }GDE[598GH%EGEw, UukOM PG44u4 9uw{fF9uvjffEF% EFt$G|$vMuƃ$[^_]ËW;U~iUEEGGD1EoGD$ ED$ED$<$<$1$[^_]E1$[^_]U| [5$]US| ˜E] @ /t+t"` A@ d 1[]1[]øUWVS]} K(1~&1 ~փ9tT,y)փ9u[^_]UWVS0{ E,E[5E@ ` E1[5EED$D$D$D$ D$T$UE$t!UB UUB(ɋU~CUMT$$Vt=9@ ~#tyڅlE)e)Uǃ@ 10[^_]UWVSz uF$EF(E~r19~(~fD,tN L$y؉D$D0$KuED,yD$ED$D0$ tT,U9~(E[^_]E{UWVS&z =}G(~"1D0$D0$"9w([^_]UWVSy u@ 1~019t% 9d uDŽ` 9uۉ[^_]ffffffUWVS {y ÒƉ׉UM$J~ }VF +B F(EEFFUVUVFT4$E ENF,UExF~c1fGM9N~EMGfGFD$LG |$F|$Hu [^_]ËExED$<$JUBEE9FbVn1 [^_]ËEED$F,$GtF,U)D$F0$FnF0VN +J N( MN,~+zR,9W O^F9~ HOF؍ 9f~dUEO$G ^V 9~ ЃG ^ ڍ9$~"U?9u1 1ɉ)1)UWVS1v LE],CKPp9~ NKP֋U 9U }u S xH 9~ QS x E9]}K} E C EC$E[591[^_]1)w1)э<C:}[5[59[59[59K9U 9U u S E[589E9E E)}u E[5] X ]X$1[^_]Ë} Eu 9"E[58;}CU 11)ȍ4#1VC E1/U Us E~M ~[59B$t ]1]ËE 9B ]UWVS s ñUE [5Ex$9}h[5P H4 9unfH$p <19} JBo[5P H4 9u80H$p <19}  S%D$E$u)[5P H< 9H$p <19} E}x$} x [5}:[5} :2u #vt@:u$cvuE$*؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )9)UWVSq ðE[5ǁ3~fU ~_;A$tRU T$$D$[5$u/E D$$,$[[^_]ËQ 9U u1[^_]fffffffUWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]øUWVSjp Á}M OGXU ;P$UWUU;P Gu )ƉuW u)։uwt]E 9F{M;NsE9F kEE;F`E GEG <$|$4$jD$<$1[^_]ÉFV EFUV 4$69uUUB8} t @B81]Ã࿉B81]UWVS Io dE} O E+H O(w0G~a1҉׋U J(B,4B]+C[,H NX^F BU D$ $]@FU 9z [^_]UWVSEPX|2uH8ˁX8p x;z t[^_]ÁuكH8Hz$P9tC9uՋMQ ztɋQuut duH8 uX8UWVS n %E׉UM$7ƅǀǀǀE$7EF,D$E$`;ljF0MF4EFXFF]^EF^ F$EFE F F8F[^_]1[^_]ËK K+M щMS+U<2USE] MEP UU PUU[]USE] MEP UU PUU[]cUSEU ME]] ]][]EHD뜋M[5)+E E ÉEE~ZM1$[^_]Ëu$[^_]D$E$] E D$E$ƋUy[5~)EDž}1딋E[5E)ЉNjE EUWVSg ][59D$D$C D$CD$ CD$CD$[5$ƅtD$$[^_]UZg uD$D$UT$UT$ U T$UT$[5$B]Ug %EU ~@~9u?9 G:uGE~G,E111҉}]tË}_+^~, t]C+F^,"щ;U|}EE̋@SPSfPSfPSfHfP$f@fuFD9FLfGfG|$F|$]n/EЋ@E]F:EE̋@VDVLfPSfPD$F|$]/tAEЋ@E]:EfEE fEEfE~SEL[^_]9=$I8@F8EAsAUWVSM^ d@[5#B@Ơa5~tD@Tt5MUNL$D$$aP5!A@U!‹MtD@t5MUNL$D$$WaP5!A@U!‹MtD@t5MUNL$D$$aP5!A@U!‹Mtc@LtTMNT$D$$``@M`\5t-QMT$$[KM`\5uӋP@#Q@tA(t7t.UND$D$ $>`H@@UtA8t7t.UND$D$ $_H@@UTt3t)UNL$D$$_H@U t8@t)UNL$D$$p_H@ Ut8@t)UNL$D$$3_H@U@t8@ t)UNL$D$$^H@@Uƀt8@t)UNL$D$$^H@Ut8@t)UNL$D$$|^H@Ut5@4t&UNL$D$$?^H@Ut5@t&UNL$D$$^H@U t5@t&UNL$D$$]H@ U@t5@t&UNL$D$$]H@@Ut5@t&UNL$D$$W]H@UuLt<@t-Lt#ND$D$$]H@[^_]Ë@@tUNL$D$$\H@UzUVS Y Ơa5Rt @u [^]$5IND$D$@$Z\ [^]UWVS X íljօ$[5@ufUGFGfFt$G $(OfNfU~(FɋVPfHf@uUf~NGuHW#d2u `\58tr$IW tu֋$Hvuut1 [^_][5Oxu f~Gtf~GvvÅt$HW u륁T$[5$E$_HW YxUEPT$ PT$P T$P$11]UWVS EM]Uuuu uu y1y1ɉ]yEUyE+U]\+U}T:Uԋx}x)׉}9~]؋X x)߉}܋U9~U܋}9}x5}9}x-uU܉UU؉U] UUU [^_] [^_]UWVS V ![5H@U7Ǡa5P zt*1`\5tM[^_]~Ǡa5NT$D$@T$YH@ŒP5# H@zND$D$a5@L$X`@ANT$UD$Ǡa5@$XP5P@#щP@~U8Ǡa5NT$D$@$2XH@„P5# H@$lB[^_]UWVSRT eƉӉM$V,4;]Mu;M t:E D$E D$ ED$L$$,5[^_]èufUWVSS E[5Eԋ3 u[5uZJp XHUE@8@u B8@3 B@ ]N|$D$a5E@@D$VEԋ@@@] D$}<$]Ig8E@xhtXEԋruju^E[58[ N,1119| Eԋr2Epg Eԋru E@| EH,BEEfEE1ۍ= }}䍇 E\\5E`\5E[5ENx[5|E<} 9MM]YH,]u^M I, 9Y|EuFD}]FHDfDED$F|$!uFL}]fD~HEԋu؅~E@,uD0[MA,u0EЋ@0;q#EЋ@ M̅E@9|HM̋Z]MR,M I M܋MЋISBuU]Z[L]ȅU]J]\R zO;uh}Eu GuE܉D$<$] ]ԋHPt$E؉$EM؉HpuEHuȅt]9]Eu092_y1ۋE49|E@EčP;U;UU܉NjMԋJuE܋M9u|:uEgMċE܉D$<$]6MGEԋuM;rtGEM9HrE9M I yB9uEԋEH1xE@EX };G}G(9~E 3tEuBuNxXuN x99fE]]؋rM;YI,^E܉D$<$]*@GƋMԋJuE;u~'}xLuȉG%9Eu)G)ƍ)Dž~ED$<$]tʉuȉ}yEE@@LE9EԋHt E@8!aMuE@8| ;} wEP z@tP WU^]̅_0+ẺED$D$ E؉D$L$Mĉ$]-U܉MD$ȉM܋M)ȉD$ }؉|$EȉD$<$]-E@M܋M؅g ẺD$$]sqx}܉|$D$$OM؉M1҉eNjE@ɋM M܉M܃Eu;pcEԋuFEBFBE0tE]D9GEP;U؉UMMȉ $] EMЉÉ؉؍][ )+E;EUw;_y1ۋE49RU܉R[Đ[^_]ËEMuFuVX@#d2M苅xD$D$Eȉ$]8NEMx ϋEԋxEP,u2 R4UT]DFfFt$D U$oD$E܉D$ ED$D$$Xt ]bD$D$ ED$E܉D$E$]1NU؉|$D$E@$]6>U؃9u1҉U|$D$E@H$]=U9uzD$D$ ED$E܉D$E$]Xt$E@$7_N|$D$$=E)ED$D$ D$D$E$]E@t$$^|$D$$#=D$E܉D$ ED$D$E؉$]0Hr }h D$D$ ED$E܉D$E$]J1NU؉|$D$E@H$]<U؃9u 1E@U|$D$$];<U9u HzHZxpvu;t#t}}O}Ћ;JZLLED$ED$$]#]N|$D$$z;D$D$ D$M܉L$M $|$D$M@@p$1;D$D$ ED$D$$M@ủt$$]m\|$D$$:EЋ@D$D$u@@0$],\|$D$$:D$D$ D$D$EQ}D7ED$D$ D$E܉D$E$]E@t MЋ ;ytẺD$$][N|$D$$9D$D$ ED$D$E؉$]AE@ẺD$$[NT$D$$l9D$E܉D$ ED$D$EDYENUЉ|$D$E@$]8UЃul pEN|$D$E@$]8u8L EЋ};x ENUЉ|$D$E@L$]K8UЃufD$D$ ED$E܉D$E$]t$E@K)|$D$E@L$]7u"u9u\fuNu5f _f1}䍿 E䋀 E@uЋrt)1upt$$]89}u܋EĉD$E܋@$]2UWVS3 #][519X‰Pt0C:ud11ɋCD$ CD$C D$C$Yu)C9u[5 Q+Sx.SQ+S xSB[^_]ËKxSt1҉S1҉SQ+S yUW2 r[5$,]UWVS82 Ku] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$t[^_]F9u[5 Y+]^y1ۉ^IM+MNy1ɉN[^_]UVS1 áut$"vu[^]UWVSW1 n}GDE[598GH%EEwG,MpGE9r?lMfF UVt$G|$twfF9uv/FVM9utс;MuN uf~xɃEE9GfD$<$zD$D$<$x"1[^_]EU60 Q[5$]ffffUUE 9 u9H9Ju1Jf3Hu$R @ tuR@tt9 t1]Å]UWVS/ ̵U} w to1t6~RutF$u1[^_]ÉU$@t8U F@RuDžtÉv$8uG 멃UEU  HJHfJHfJ@ E]UVS. utv$u[^]UWVS . øEP~`EE@,MpE@~1E~ t$luEEU9BփEEM9A [^_]US] t.UӋE ȉt %1ȃ9u[]ËE[]UWVS]E 111 ȉt %1ȃu1Lȉt %1ȃuڋK t.1<ǁt %1uۋIu҃9u m[^_]1[^_]US'- >E@ t$D$ $ox)D 1[]É$M1[]øUWVS4, U@ D T E苃P Ea5EHApEЅ[5EE싳L tbyFEԉЉUy E܋EE9u9}yU)E܉+EE%9uu})}9mx}ԉE܋H U)y+}Uԋ}94}ԅ}ЅH[5}}܍|9,~ EԅLD$D$EЉ$ /ǃT E̋P EEEH1ҋL }u[5E8P ;H )EԋA}܃;}9P E;H BW[5EEU苳L }d%Ey EyFEE[5E8=\5-)EԋA?P E;H E܃9E9@ D$ $k)D LT$D$$\-E@pP ǃT 9H OuJ \5lLT$D$$,D E8uuE@@l8 P ;H MJP Alu@ 2D$ <$j…yD )ЉD m@ t}艻T M䉋P 4[^_]ǃT P ;H iT L 9 ǍL"t$D$$+T ;L ~aD jT E@@xu@ \D$<$iy)D T ;L P EЍLU?P t$D$E@$4+D P ;H T u؀>L u)ʃ[5E܍ EԍLEgșǍry );uE@M؉L$D$${*T L EE܋89~1$ D M$QE܉EP [5u܋R,r@LE؍ E.@ D D M쉋T `9L E܋P,P 4v4~}}uE@}؉|$D$$Y)T D {;ELD$D$EЉ$")ǃP ǃT UN;H@uRFuLf~-$XT D$P D$F $yVD fPT E@$ 5T D @ tD$ Eԉ$f…yD )ЉD 늋@lLT$D$$(P P E9H UUԉE?$ i=@ t'D$ Eԉ$ey)D $ 4ǃD @ D$ $ey)D D E)ȃ9E@LD$D$$&T 9L  ǍL"t$D$$&T ;L ~bT E@@xuƋ@ t2D$<$dy)D $ /$됉ƋP @ t*D$ $Wdy)D $ L 1EUWVS " !E苃L [5U29|H L T P 9H [5EǠa59H 9XL \5u@@hqUMEQML EU9kNEu)$ Eu ǃT E98.@@ltˋM t‹ML$D$$$뵉H P pFh9}dL L$T$$EƅtDE;T t4$U ND$D$4$ $uU1H P L T [^_]ÍGEP T Ǡa5P :U\5NMuML$D$$#tMUt'@@ML$D$$S#@@lu$ uP ǃT [5EH 9p))ʉH P 9:H \5$ 넋H 'ǃL U UL UH U T UP 11]U ʤUL UH U T UP Ej1]ffUWVSw ‚%[52E[5E[5EE09u9uN~sF,EEE]F~JCH1 9F~59uuS9~S 9}͉9F˃EE9FE@E^[^_]ËuF~݋^]v,EEU~&XC]с9u9u9uuɋE@E  $a5BH8~NHD~GBlthtËuu拐tt 1 a5@ xUWVS(v ƉEYka5EBH8sˁ'}[5u@D=u[5džX [5Y\A`Bt%]ND$D$ $pEBt8]ND$D$ $A[5l2!P@EBlxhjǁh2ǁd2BxT|2@@Tt ǁd2t d2t d2t d2t d2 t d2 @t d2@t d2t d2EA\~fǁnǁp ~fǁzǁ|~fǁǁ~fǁǁ~fǁǁ~fǁǁti~fǁǁtL~fǁǁ~/Rnff@f@@ 9uǁl"ǁp"~&l"l"ff@@9u}䋇X %ȋl"p"LJ` LJ\ 2E[5E[5EE@EE8E98tE98t܋E䋘X _HG~MOw,EE}؉ϋ~HQM% ؉9u9uuԋ}D$<$]bE@Ei1([^_]ø[5ˋtǁh2[5Ћtǁh2^tttǁh29UWVSz ÑEU MfUfMf{[5;7jf [59N9C[5h2tsp"уt:]f9l"p"fl"}fn"U1[^_]Ép"ufl"ufn"1[^_]f:ftlfufEf*ftCfRfEGfufEf/fE$1[^_]fEfE}f9n"Cp"fn" fEfE_/UVS EM ]f[5;B`Lt f1Dfh2t1[^]ftU4ftifufftL(ft;fvuf1fuffuf1ff1f1f뛸nUWVS$ U} uEEEƉEljEf[5;B\ @ fnfpufra5 I ytX|2RtE}|$}|$ ut$D$$y9NT$D$$1$[^_]øU Efx?[5;B\}1@nU f pUf rEf1]ø] ƙ[5 ǀǀ[5t%X ǂl"ǂp"` u1U勀X %1]UWVS' B}M [5h2t^ffǀ[5 t)X fl"fn"ǂp"` ug1[^_]f3fthfufto'ftVfmcfuؾfLBX %1[^_]þ뜻닻 #[5d2US  [5h2tu=a5@t(NT$D$$NP5M!A@ []UWVS} Ô[5\ tM 3H@ȩt?u f[5h2t Q@E % ЉA@[^_]LL f8f|,UL$|2@$ 6NL$D$$dUTfrT$|2@tLL ff|UL$|2@l$5NL$D$$UTfT$|2@h$?5NT$D$$U$UL fxZU$UL fUWVS äE[5rNQVy ;V|"< tJ4$荢[^_]Ét$$UWVS' >Eu NQVy ;V|"< tJ4$/[^_]Ét$$RUWVS [5x|$E$(Ɖ<$ݡ[^_]UWVS Þ} |$E$Ɖ<$裡[^_]UWVSI dMU [5xLxHX9Ap9}:x}x,;u!<79u7PH1[^_]Ëu4&ԸUWVSEM UxLxHX9|Ap9~:x}x,;u!<79u7PH1[^_]Ëu4&ԸUWVS UJtvB Ez]Zq uBy))xDx@qu96Y9}/quq,;]~ ]#4;UuQAAʅu [^_]UWVS< } E E ElG$EE@EE@E؋G ]m8 t&ut[5E}}+E)9L$ED$E$ ؃<[^_]Es uE@1<[^_]ËE@,M؋EȋPMU܍։UЋUDEE̋E@‹M);UeUȃ uN(R9 ~ FM܍tE )B$f9Uw)MЋBFBFB F BF9vڋMA GEԉ%AEfAGE܃v;}ЉM $M TW PG 9uuϋEЃMQ}~,MMzuԉ0)fp@ fH9u݋EPBMI(L }ȋW 9 D$ ẺD$E؉D$E$UE$U1<[^_]ÉMy1ɋEH1<[^_]ËE$)EM9HTu@8 E$%1|$E$4 E@ETUȉE E96Uԉ} 6E@Dt$E@|$t8E@HFfF;uv+~ tÉ$buF 멸Uԋ} U 6UT$[5$]UWVS  u}ED$E D$4$t} u [^_] [^_]UWVS  ôu[58E D$ED$<$tu } [^_]v [^_]ffffUWVSĀ; RƉUM$E~$EUUFEȋFEEċE@MyMM[5M ta%4 fT$ yE‹EĉU}E)MMĉMċt& uE9FTu F8 Eȋuڋ~FE+};}EEċFEȋE}E[5U}MMEW tx $ yE‹EĉU}E)MEȉEME Et W uU}ċF,EMȉM BEUBLyύ EEH F(R;}EȉEV}9eME@|E )B$f{9Uw)MBGBGB G BG9vڋEȉEEEċEE}ẺEEĉEEȉEEEEEȋO,EEEG@ED$ED$ED$ ED$ED$<$pmuEMEEEăEċG$y)E$ymEU] urEEEEEEăEămyE}G$)Uy)EE9E>E3$yO}mEE}zMEj E9qU&FHGGfGfG;}FD|$F|$(uEE$E[^_]EfNMVUEĉFEȉF4$跄MNUVE9FTtHEȃE}U}<$y4$M1[^_]E34$o}봋E$FQU 5Ut[5]1]U  UM t[5]1]UWVS  ۇ}[50E D$ED$4$tt [^_]61 [^_]UWVSg ~}MM[50E D$ED$4$WttM[^_]1[^_]UWVS  u}ED$E D$4$tt [^_]}1 [^_]UWVS ņu}MMED$E D$4$ttM[^_]!1[^_]UEU t ]1]UEU Mt]1]ÐUWVS# 2ÉUM,ljEDWp1҉]]3 VTJ>v]D{u܋]4.tF<*t*Ѓ}‰ DOu녉1uUWVS(# :EUM؋ufUވM݋U1ɋU EEԋ},Et$$UEx}P$u܀G$VUt}EMU E3M Mt~MލQf sS /DžPE݉Et$E$Uu2Eu1([^_]À}. I}ԅ~Mȃf wC /Dž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVS UE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ $t$D$$G[^]ûu111[^]UB ]d f D$ ED$E D$E$]U d f D$ $D$D$E$]UWVS ƁU:GEG<\5<^tKЍtǰ,}Z%}2t}<,P{44GuGPҋ1~9%ð,%Z<\w<:{8LZ{f؍[)f )ډ׍ۉ)ډ֍^0E(MMTSu<.t<*u QUAщMԄ=1RC=}u-EPU%EPUpEPU}W0EPU%M܀dtEPUEPUdEEC=AE%p0%@p0%{@2}%*f@ %-EMHEHEEEC=E%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+EMHEHEEECC=}hEPU%EPUpEPU}W0EHM%EHMc\EEsC =}EPU%EPUpEPU}W0UE0\;EHM%EHM+EHM%EHMcӋEEE%p0%@p0%?EMHEHEUMU܉ȉMNjE%>%tEU܋M\; U%+%;EËEE161D<\{C=EPU\\UVS zƠa5tp t~9t $Ip EED$D$E $uIp tG@t  d\5 l @xh [^]É댋E[^]Ép @uUWVS( 7yUEtBEEa5E}<$UT$ D$D$<$01M辵N))7U܉e)‹u)7uܺg݉ҍ)ƍ43DD$<$kEtTH tCp$1҉}܉ 9t-~fuUE܉D$$XkUuF([^_]1([^_]ËP 3D([^_]UWVS( wUEtBEEa5E܋}<$˯UT$ D$D$<$/ukLЍB)6UeЍBM)6M>Љ)43CD$<$EjE܋tRH t>p$1҉}܉ 9t(~nuME܉D$$jMuՋFy([^_]Ë3C@x([^_]UWVS(| ÓvUEtBEEa5E܋}<$wUT$ D$D$}<$.u-?L) RЍ)Ѝ`0)43CD$E$c2EOMEu4$蘨UĉT$ D$D$4$(-?LeċE) @E)ЋUBEeȋE) @E)ЋU BM*SRЍ)`7UD$4$bUti}tu~cu ~u_GZEE3D$:E13C$J;d7$.<뜃}t EE$#fffffffUWVS oE1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUUƍp@Hπw09}맋E D똉UUUWVS( 7n84z4y@04G4<11 $rD$ \$$(‰0,1ҋ(tC,1,}Q90t<u90u狕,P)1B t[8ư,(׀%#Nj4P4H0@,Z9t`J4K4Gu4V,F4F,[^_]EO81[^_]Ë8t 4m0$8:4t t@0@400$84G,rG00 wW%uI%选L$0$8莴%4C,0K0S4ƅ`%( Dž,aDžDž$10:~Jwɋ8(Fʋ DOu80,B<]38Fዽ0ʍ|YЉ0'V`)ك?w:QJ fɋ8 H狽$V-.,uy0Dž0Dž,xDž$i0lHP,90Ha1B<]]:CEPEC0EP&Vҋ8HEEP, s G04P4H0@,\:9g,|$ `L$0|$Љ$8謨K4G4510O0PD]}}P!n~uЃOPD}cA<vRŤŠEOp~PTENEPUT$089ϋ0sȍx4K4[0D924@,T$ `T$|$ȉ$8-4G4EEPkN1.V?;epPF%tʉEEPu4P4H0@,Z9J4K41%V? ; pP}F%tӉA<A<4T8EOsPDEF~EOBPDENO<'u}5D$$ <D$t$$iE$/Ut`uE[^_]ÍE$~zƅVEE[^_]Ë}ut$KD$$xEuKD$$wM$\-@ x tAMut$VKD$$w$vEx tU*E=ED$D$ht@E$蘊tEftUft IA(QuEtxE17$(yt!D$D$$;RB(=$xtD$D$$:RB1rKD$$v}KD$$uvHKD$$_vt$kKD$$EvUVS ô]EtD$ E D$ED$E$ƋEt$+[^]fffffUWVS; R]ƉEωD$$iPte4$Eƀ?uT)9tXzztED$|<$a…uۉ<$9u#t$ED$<$h[^_]1[^_]ÉUt$ED$<$8Uu[^_]UWVS w Ɔ\uEUt]t]Ɣ [^_]É΋ %1ji˃1҉9rExtftEx(1fWFu~9Ft"FD$<$] ljFFutftuFPVD  ЋuXuËuVf;o{CftKWҍTRӉEf}]}^ Qu F 8v;Mu܋E}f8Pf}w} H u yf}uHD$$%]}G ExD$$!]荡‹EPu!f8tGPft>}w}  ft(XHuu҃f8pxE;x L@$X|$D$$]Ex tpE@$E11EV HnsefwrRPMu v@@@ 9wND$$]:}G 11fCvuF F$t$]>F$uyf fE@$$]Ex D$<$]脟]C$i$ffsuVT@@rRt5p @}t6JrHUsMu,@ lJrǪ7f9@ @'UfWUWVS, VE׉MT$ )LD$D$ E$O=v(8,[^_]D$E$ ƅtʋE$gUU܉T$}|$ D$ED$4$ t6Mt/U:t+E$Ejǃt<4$ ,[^_]1E܉D$ |$BD$4$ uދMU믋EPEGǃuE䉃 D$|$E$ÃE=D$E$ ƅUWVS։Dž)t Hv8s<:ut<:t؃u)u΋[^_]É׃rtftƄE$t ɋuDžfDž{UWVS = TT։ǃ 1L$n48/$B0…tSDžD$$Nj$؟tOi\<$ $CL$sfJH΋BD96t$B@U$@UtB@rDJH]fBHxzHz@utftEBHJ@XZHun&sOf.BL[^_]ËB@u1[^_]ËED$B@D$$UuE(E tȋED$ D$kpJH΋BD9vE$tJH΋BD9v1z tFJH΋BD9`U4$+UED$ D$kD$E($BHB@z tzu0BHJ@BHXZH]J@BHu$f4BHxzHE$z@u stftE$BHuhuOыM~fBHJfEfE$UWVS JE 04$EE @E$EE @E܅$сEE @(} GW8DGH}EE$ZEE @ fyQU׃?UMf BEut%ˉǃEEMfUz}u܅tȃuduWEEE PE] S u V0] S@EM+[^_]äQfGft懶t&^fSU뷨uhu,u8ECEAyEffzEDf<Jz]>UWVS: UGUM M,82uDG@ƉكD_@uut+H8]t \t'^t]XtȍH8]u E[^_]Xtp}:tYuE[^_]ÀEu2>t؀xtEE[^_]ÉZUWVSE \FuNE|F9vSt_|$$tC~NU fFF}t7]fFF [^_]Ëu1[^_]É<$诉륋}<FUWVS<褿 ûEE@ EE@ 0t$$iU4$zE@E܋uFI1D$|<$ Jt~HM|$E@ $$EB}ExDED$E@$UttMA 0ωփsztft$Ԑu}n|$E@ $$E|Ǎ@ED>D$E@$MUu;$EE<[^_]"eMAOMփEtfEtǤ$E܉$ E@ Eu~,F F(F$F, uuFSPpx3My ɍL L$ T$D$E$6t}uPpEE$oEx@}܋@LEuF@FHFDFLuefx{111D$ T$L$t$D$ED$ ED$D$E$tYmtZ7GED7MntsuHP|1둃}t>px111zx@11jEE܉$sE<[^_]px111;frEu/u;Mk$lE r}fm볍k$0E0ECUWVS藻 îAUJEtB9vwt$U$9Ut]rJ] fBB ]fBxzE:us>u.u'EBB [^_]Ëu1[^_]äftЍt&u%u0t׉4$豄UYEfUWVS舺 ß@uVzF9vHtT|$$5t8~VM f FHNMLF [^_]Ëu1[^_]É<$UWVSl @ED$,E$ D$|$]~xD$|4$]DHM4$]w=t<$]w=F Et$]w=D$$P]ÉE\@ t$$rUt E mt E :D$,E$E{ EEE荈lMlM~lMǰ,}ЍflMHl},lEEE u<.tjDy@u뼉EĉU܋ED$ ẺD$ED$E $U܋Ex}]9sD$ED$4$]RËE8^E qEx fPpڍwJЀv<ҋMЋ DQEċED$ ẺD$ED$E $'Eă\9uuME1҃U]E1҃<$}U} |$ D$D$D$D$D$ fED$D$E$D^u xumU bUWU LUAu 6M +fEx DD$ \$|$E $g,EĉU܋ED$ ẺD$ED$E $U܋Eă.$} |$ D$E؉D$D$D$D$ s4$tf]p|$t$E$^f1$E)ύ)ȍD$4$\&u [^_]ÿU 3E=w t]1]UWVS ʬ 2u4$jUT$ D$D$4$}-?L) RЍ)ЍmGEeM) RЍE) GM*S)ύɍtD$4$K%u [^_]ÿUWVS4 1ufF(}ȉ|$$Jt4[^_]É<$;11t`9ufF(4[^_]UWVSx Ï1u  f\5fV Ed\5 4$:V(EfD$FD$ $U[_=UwDE |)ʉM싆t7T$UD$E$_U9vUJM|M))‹FtIT$UD$u4$^U9w4[^_]1$d\5[^_]ËUыU|UVS. E0utnF$,|F$!|F$|F $ |F$$|F,${4${9 t 1[^]ǃ 1[^]ø裩 / @蟩 ª/ @tÍfffffffUWVS[ r/lj$UgD$$ =Et$UT$U$c+9UuED$$ <1[^_]ÉUED$$ < $x-UD$i-UDgUWVSd耨 ×.-6EU1ҍEEƍ EE> ;uD$t$M$+Mtɋ$,$,MDŽifU}+:!d[^_]Euu 't< tPvcFuM$+$+MDŽ\UWVS<藦 î,Ɖ-68}11ɍ tuduπ@t:H@u~D$@D$/$8ZV:tP:uwUBu2$W $\WΉ$)D$)D$D$ BD$D$o4$jAQ;ȋu+7h<[^_]Éƅ/$(Ή$,Ή$(D$($(D$+ω$(D$m(XQ$0R[Q$s)$EDƅD$/4$[h/t[D$AT$/T$ \T$ |$D$4$t$ƄD$$AD$AT$ |$D$4$ɯ뷉kEUWVS転 (EED$:E$s-tpt!ED$E D$E$=&[^_]ËU Et考[^_]UWVS5 L(D$:E$,tptE D$E$An[^_]U 'Ewt ]1]à ]UWVSh薡 í'E} -6MU1ҍp UED$ քD$D$@U$UfUUU9~EE ω )|$t$ʉUM$W$MUӉ΋ʉU$]%}D$N%UD_E$  ut$|$$#EE}+8uEh[^_]EUWVS` 3&EM -6U1ҍpUMED$ ܄D$D$@U$UeUCtSD$$ h3EED$ML$ED$!;EUT$$ u>03M+u}`[^_]à Wut$L$${!2 U$#ED$#UEDb]|UWVS`轞 $EU-6L$\1ɍxwbtNT$E UD$ T$D$D$@T$$T$)dT$t>$ uT$ U MT$L$$PL$\+u`[^_]øUWVS $Exw|Mt_BVƃtA#ƍ U$R"ED$C"UED [^_]à u$"Ɖ [^_]UWVSlA X#EU -6M9}1uHM$}m:m8@X}k6E81nXE-} )|$t$E‰U$U֋}$ uD$ UDZ t$T$$M}M+l[^_]êEf:FD$D$ $BD$D$@u4$Wa}tPf>~$E~LVF9u1`f7AY,US !EPw&u tRY-$"[]US詚 EPw&u tY-U T$$8[]UWVSO f D$:E$ %tptE D$E$[^_]|X-[^_]UWVS ٙ D$:E$$tpt"E D$D$E$` [^_]ËE D$D$E$ [^_]US S jEMPw&u tW-L$U T$$] []US EPwt1[]à u$/6[]UWVS諘 D$:E$i#tptE D$E$j[^_]V-[^_]fffffUWVS/ B}E1E xtC1Utt ƒu@u[^_]UWVS|誗 E|-6x8}1  > E|EE. 6 Eƒx  EB A E;uuˋE%@ ED "EP ExE}Wuwuw EEEJ΃ 9MuEЉ̉ эuEE@tuEщ ʉ ʍ  ʉ  ʋMxEEEEEtE@EQǃ  1)UWVS\ uE EM-6E]11ȉ܉ %Ev㪪UUUU UUUUM% ؉E1EE EEEƃ4x  EF A Eu1E1EE܉}ԉMԋEƃ4x  NjF A E؃uƉ}ċEMEEE@ EE4uȉEEE܋E؋uu؉EEċuuĉEE}]1#Eu܋113^1݉]ԉMuEȉ} }3 3 }3 }3 3 3 }3 1EċE }3 3 }3 ]3 3 3 }3 1E؋}؋Eĉ1#MMԋu܋M3]1ËD1M1EƉu 3 3EE䋼 3 3}E3 3 3 3 3 3 3 3 3 3 3 E3 }mBuumEME% ME%MɁ ȉE1E1 EME0Ãx  NjC A EuƋE8upEu+0u)1\[^_]ЉEE E4sUWVSP譍 Eԋ}] ]-6EЋ0u1;$]܍u 9u$EE<_tuX< P<:fF]S7 l:c]ĸEE]ԍ ]]$(#?8D$ D$\$$ 09u몍uEEESD$ D$$$Ű]0"thU9tD$ )ЉD$T$4$f}2at^}sha1 f}1}argo}argo}argoEԍ]Ћu+3P[^_]À}uE؉D$<$>uыE<*uE؀x0uEԍ볋]MԈ ȍ  ME Ẻu Ȁ`QŃ?u49uE ЉE;}uɋuȅEjX]PE]ԍ ]ȋ]ԍ ]]u2NŃ?}t}<9uȈ ˃r2u`ƀ@~NN҃?뺀@6Q<ًuEẺËED$ L$t$Eԍ $`EfM ȃ?u1 K?1 K ?1 K0 EfM ȃ?1 K?1 K ?1 K0 CEf?1 K ?1 K 0 CC EwQ҃?}n2id<~2E؉D$<$l}n2d+݀}E؉D$<$ ?E؉D$<$+}n2i뜋]UWVS軈 E-6E8}1EXEEƍ}S1J 9uZ9uE$}u+7u[^_]Ë]UWVS,? ZE؋}}-6E0u1_EE}ƍS1J 9uZ9u} D$ D$ED$$uJ]܃8uE܋}Cу9uF9t܋}܋Eu+0u,[^_]ÿ]'UWVSDj y E E}-6:}1DžDžDžvP88}+81D[^_]D$D$D$ D$D$$@D$$ P@D $9ʉsÁ tщD$@BD$ $ |$ $?2 9ȸU?!~9ȸP?J9ȸK1?߲9ʉG?+59ʉE?x}9EDž\DžXD$$^D$$B(D$$XP4R 9ȉ )ڋ09<19D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$y$D$$W(,48 1؋ 1 0<9911҃DžbDž@SDž DDž5Dž&DžUWVS  Eu -6U1D$D$6 $5DžDž4$8$u cD$$_o$@DžD$$o8vuUx=uOT$$|D$$n Dž|DžDž DžDž4t$<$dnptLtm$JSDžu+0sİ[^_]ËT$$[t$<$moD$$mDžDžxDž_<Hv2Fpꋽ0~Nz) ЍN!ȹZ) ! ȍ~й9) у! у+у>׃/׃? ȉփA! =ЅD$$'lt$D$ \D$D$p$D$Q4$=||$0|$,D$(T$$D$ T$|$xT$D$t$ D$D$$X@D$ D$$萳D$D$4$rD$D$x$TD$D$p$6T$$y6T$$vxۋuDžЃDž| $%D$D$,$F$N|UUVS| ëuv$蘎‰)Ѓ[^]øh`UWVS4R| i]荻}u u4D$ ED$E $!lEE8$E $] h`)‰UE E h`9t$u+E E܋E$]9NjED$ut$u t$u܉t$ D$D$b9 E$'A8 t$|$ ML$D$E$}v/lj|$t$ ED$D$<$9]uىE D$E܉D$ED$ED$ ]荃$D$D$b}<$@U^D$O O ȉD$$EPU9uD$]8 8  8 ȉD$$EPU@D$D$4$螯E4[^_]14[^_]+M MXELffffffUWVSˉU 3]3։3 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 13<43 13@43 13DE] [^_]UWVSEfM荰uHE1ɺ1f9M ؀u1;uuEE}u]܉EEEC;]uE䍐UEE荘EEEC9]uEE9EuɃ[^_]ÉTUWVS nu ÅUɍ4 u9  >0UZ9]MUQz  H? >H9Uv` ˃0]]9]vDZM  >Htu虂>u}$2a$E؉D$ /D$D$G$K9G1MԋU+u[4[^_]Eru؃aA11UWVS$r -6E1ED$ D$D$ U$U8UT$D$9 $-1t؋M+u$[^_]É/UWVSvr @EHE -642u1EOrphEeanBEeholEderSEcryDEoubtx2,P$=axƅ;a$G$@‰,<w4$/@?G2W`UȉDы@Fxltct^f Ј;`tFFx>$u ~1QH t $t9u+p @4$5 |$$D$4$JD$aD$4$0L$T$(4$u4$҉|$$D$4$L$T$4$щ|$$D$4$軉t$0,$%C(~T$,D$<$k׋,@@@ Ƌ(,D$<$!t&D$uڋ$D$<$uڋfǃ@: $1ƃB: $D$D$C: <$:D$xcD$G$(D$,$ 1 D$$D$4$gʉʉʍWUUUUʍ׉ʍځ$I$(tsD$,D$4$t$,$g4$蝇(:D$,D$4$裇7 D$$D$4$肇뉋 D$$D$4$dDD$D$4$C@:  : D$06 < ȉD$$ :  : D$17 = ȉD$$a :  : D$28 > ȉD$$ :  : D$39 ? ȉD$$ :  : D$4: 5 ȉD$$ :  : D$;T$$k : P : @D$D$,$%}+8uu[^_]À~$Dž0Dž4Dž8Dž<:DžDž DžUWVS f (MMu-6U1҃}@2Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\EU҉t\61T22;Er䋅$~D$@|$<$/~E D$D$<$~|$$<$}D$@t$<$}D$t$<$}|$4$EM+[^_]Éu4$Q}ED$L$4$p}t$4$~Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\ETfffUWVSa utJD$ED$4$QNjE9t=8u86 8"tE 81[^_]ÃuE 1[^_]UVSua |EU ]~Íу? H9u[^]UVS6a =EU ]~Íу? H9u[^]ffffUWVS8` ƉUċP,x0 9s1V8UEV(UȉMԉEE܉}F4EMĉM9s}t$}ȉ<$t8[^_]É<$uEĉ|$4$Eă8[^_]U=` HEt t&t1]ËM t6*]ËE t2]ËE t!]Í]Í]Í]UWVS_ u} 4$uw[^_][^_]UWVSd{_ Òu}$}(E($I)EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$*…uA}4)U4…u'tE(usQuAu:M,ftE0uZUE(D$}<$<$0UЃd[^_]äftt&uqtӉUE4D$ ED$E0D$E,$;UxE(D$}<$ E0D$E,$p <$/bf{vE(].U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$,]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$S]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$z]UVSZ u4$4u1҉[^][^]UVSZ u4$ u[^][^]UVSZ Öu4$ u[^]o[^]UWVSCZ Z}u <$ Eu<}wAU/Eu%Ot12 ׃9uyE[^_]EEUWVSXY U$ljEE$#ƉE<$z#EE EEEED$UT$}<$W5t.1EU$U+U$J+4$B+EX[^_]ËuE$#EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVSQX h}u <$ Eu51҉DEu%Ot12 ׃9uy E[^_]EUWVSW }u <$ Eu8Eu%Ot12 ׃9uy E[^_]EUWVSjW Á}u <$ Eu8ZEu%Ot12 ׃9uy E[^_]EUW E##+ፂ7]Í]Í]Í]ÍM]Í]ÍϜ]Í]Í]Í]Í]Í]Í]Í$]ÍH]Íp]Í]Ía]Ít]Í]Í]Í]͛]Íߛ]Í]Í]Í"]Í9]ÍP]Íi]Í]Í]ÍP]Í]Í]Í%]Í:]UWVS U üEwjE$+9NjE $9ƋE$9E|7E$8E}E$8}$8 [^_]Ãu$L|ffUS T U T$D$U$X []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVSUu 13ƋL3L‰L=u[^]UWVSS u M]مt2u#E@UWVS$J MU -68}1ZA@yDD$ HL$D$4$JZ 1ƋLÉL=u苍A@D$ HL$D$4$JZ 1ƋLÉL=u苍9z(@tD$$}+8u $[^_]ËDUEU Mt t]b]UWVS\fI }uU -6E8}1V(F Bу+?Ѓ/ [^]UWVS É։MM<}R)Ѓt u }E9usytgMM11EE@ƃ?'كCwU9UuljMt)?UZE [^_]EE [^_]UWVSEUEEEEU<}EHv(UB]9}}EMڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/׃? ȉӃA! ="}w"ЅEuE}8[^_]1[^_]UWVSE0 w+׉1ƒ0 w!w ҉9s1ɉȃ[^_]9t}0t ȃ[^_]Ã9u׉UWVS # u} FEFED$E$?$ulGE$UljD$UT$E$u=}F8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=ustUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSX" /}EE-6uU1D$E$ƋẺ$,Ef} Tf$OME Eĉ4$9E/PMMȃ>MU)ƒ$v=AMEruE̋@8D$ EĉD$ D$D$E҉ljEȉ$<$C9ƋM@}uȃUGMыE)Ѓb$m=QMUx}E̋@,D$EĉD$ D$D$uȉ4$4$9NjM @}uȃvMыE)Ѓ,t=QMUx}E̋@(D$EĉD$ D$D$uȉ4$u4$-9NjM@}uȃ`dMыE)ЃL,p=QMUpuE̋@0D$EĉD$ D$D$}ȉ<$<$9ƋM@}uȃEЋM)уf$xqE̋H@$)ʃf$}̋O $ZcE}+8-EX[^_]Ë}Ȥ6}f}ȃ%fv)fffvfE}}o \kE%)E}f}ȃWWUȃAyuӉ fAyuӉf AyuӉfAyuӉf?~UMR)уtu]UVSU ṽщcw[^]ffUWVS ,$$ lj4$$XF$\F$`F $dF$hF$lF$pF$tF $xF$$|F($F,$F0$F4$F8$F<$V@т歉$`VDRQ$dVHl>+$PvLh$TPPkA$HpTك$LPXy!~$@\5[$$X$\D$pT$t$x$|$`$dt$h|$l$$$x$|$h$l$8$<$$$p$t$p$tt$P|$T$$$$t$<t$D$D$ D$ D$ D$ D$ D$ D$$D$(D$,D$0D$4D$8D$@DŽ$XD$X6_D$\:OD$`+D$drn<;ʄgDŽ$@ɼDŽ$Dg jt$H|$Luw$Xwt$@w t$8wt$4wt$0wt$,wt$(w t$$w$t$ w(t$w,t$w0t$w4t$w8t$ w0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$4$_p 1D$ ED$,D$$, FT FP,u,D$$袳1(u+1uN[^_]D$4$xtFXF\FPFT문heUSEU MtttXT XPu []?1[]øUWVS\o ÆED$} -6L$T$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TƋE9FT FP1F@VDF@VD1FHVL t$FPFT)ȍT`D$D$$5V`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$s2!D$0 "D$0+ !D$06# آ"D$0y躢!D$0[ 蜢!D$0= ~!D$06 `!D$06B!D$06d $!D$0m!D$0 "D$0ʡ!D$0kP 謡!D$0M莡"D$0/p!D$0R!D$04!D$0!D$0r"D$0ڠ!D$0{ 輠!D$0]6<螠!D$0?耠!D$0!b!D$0D!D$0&!D$0P!D$0!D$0̟"D$0m.讟!D$0O萟!D$01 D$OD$^"D$0J"D$06"D$0""D$0"D$0"D$0"D$0Ҟ"D$0s辞"D$0_語"D$0K薞"D$07z )ك\$0ك,ك\z ك\$0݃ps,t$D$$Lt$ D$D$$k8,D$ D$D$n$j,D$ D$D$*$j.,D$ D$D$D$zj,D$ D$D$$Hj,D$ D$D$$jќ!D$0r,D$ D$D$$i),D$ D$D$b$iC,D$ D$D$ۣ$qi=,D$ D$D$<$?i,t$D$$Jt$ D$D$$h,D$ D$D$$h,D$ D$D$<$h,D$ D$ D$$fh,D$ D$D$$4h,D$ D$D$+$hH,D$ D$D$Y$g~,t$D$$VIt$ D$D$$gK,D$ D$D$s$[g!D$0,D$ D$D$$g,D$ D$D$$f,D$ D$D$*$fa,D$ D$D$Ƥ$f,D$ D$D$N$Mf9,t$D$$Gt$ D$D$$ f,D$ D$D$$ej,D$ D$D$$e,D$ D$D$$te~,D$ D$D$$Be,t$D$$Ft$ D$D$$d,t$D$$Ft$ D$D$$d,D$ D$D$O$dfffffD$1ffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09vvK4)ȉU9vEEϋu)փUtftЋu))։‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C01[^_]ÉMD$K(t$H( $P ljC8U뿋EC4C4S,9tcC09vEC01[^_]1[^_]äC4C,C01Mf7C4u0u\ u5ufEffZP;US]|‹C@ CCCH u`@4?@@@@@$@<@@4HpHTHPǀǀ[]ÃK0똺UEtH tP$t Pt;t]ËJ4?wB,B0B4]UWVS }] tWxt/ui1ۋB8t9Z(tUD$G($W$UB8r Z(u8G@,@0@4} [^_]g| ۍCv [^_]UVS Z]E81}8CC twS(s$tbD$D$$ЉƅtpC@8@4?E D$$tEt$S($S$CE[^].K$C C(1uиɸUED$ E D$D$E$]UVSEM tWX tPP$tIPtB;u>B-4?w1x6(r@1 w#EB?EEE@>D$D$$]|]CUB0C??E Ex6E܉m؃E܋E@N?EX څQ}wIu]Uԋu}؋MBǃvUԋUu}؉M܋uȉ+E̋}G}G OtBU)U_ۉD$T$ $]4uEHUJ0P E@D}؉ЉЉ9EЍɪUBE@Q?ẺE^XEt]Ѝ`uFPFX FTF\FG?}  mmUԋE@H?UgḾu]^ N]ԉV}U؉WߋuԃZtftE@t E@ | )UUԋExD})щHD3E@UBDB:?)uV$tB]CDC;?}w@EUԋ]u؋MBƃvUԉ]u؋E@$tu؉pE@t @  E@7?EE$E@~E@,}wC]7Uԋ]u؋MBƃvUԉ]u؉M܋uE؉F<]EЍħUBFQ?E@D?mmUԃ} wC}Uԋ]u؋MBƃ vUԉ]u؉M܋]؉ڃ}WdGh w`]؃mw  EЍUBE@Q?Uԉ]u؉M܋M+M} ]ԉu}؉M܋M+MwmMcMt1ҋ]9UtlL}G$t p$utwD;p(sGD} 7<u‹E@u)։ u}6E@??XE@ E@  ED$EԉD$uF$]4fFEM+M̉}]1ҋ]9UtL}G$t putwD;p sGD} 7<u‹E@u)r u}yuԉ]}؉M܋M+ML}W4w8])9)W,ƋEPD9vȋ]9v)E)‹}WD}9u}ExD@1>E9]sBEUԋu}؋MBǃ9rUԉu}؉MܸЋu!UBDBDu)]>f.ẺEEEE@O?DUu̅E]CDuCH?  )uNˉMMYluftYtu9uU}؉E܋UzQ?ft EЍ}GBQ?[EE MM ЉE#E؉EPfU@0;Uv|]}}ԋ]U܉uuGƃE!MEMMHfM@M9w}ԉ]]܉u؉U܋um؋})}܋U]ԉU}؉M܋M+MfEǀPPHXӋE!؍4F9EsR]]ԉUU}؋MtCǃE!u4FE9wՉ]ԉUU}؉MMvm)E܋]sDE@M?UUu)ƋE@DzEǀPPHXӋE!؍4F9Esu'q}ExHXL@K?1o9]sBM>Uԋu}؋M^Bǃ9rUԉu}؉MܸЋU!ЋuFHU)]\m)E܋UrD REǀ@??}L}wCM]ԋu}؋MCǃv]ԉu}؉M܋Et }@$t@0E؉B))9E؃EЍħ}GE@Q?EPD@B?} EEEEЍUBE@Q?A@ EЍyUBE@Q?E8EЍuFE@Q?mmU^]9s:]ԉEuNs9r]ԉȋuY])1au]؋]M܃w'EXM]fDQt9uE@l}荇4GpGPGXD$GXD$GpD$ D$GtD$$]5UBGQ?}ԉ]u؉U܋M+MU}؉E܋M+MT$UEԉD$uF$]]FUZEԉu]؉M܋M+M|EE؉ED$ED$uF$]]FEЍUBE@Q?} ։u]! ; yf}q<;}vsM}UU܉EEX]؋]؃#]M]u4NfMvM9wEԉ}ωU܋EU؉M)ȉU)E܋U艺EBDEXL@I?cE@l@E?13^]9v:,]ԉEuks9r]ԉȋu)M)]utsrY]nE@R?EM{U-E@G?} JM+MEMEP$t EEt E@ xE@6?EE7EfED$ED$uF$]'[FFEE]C rT$EԉD$UB$]ZUBuB}{M+ME}E[fevPFEԉ}U܋M+M E@l@F?1`]C T$EԉD$]C$]Z]CuC}EUP }̉xUԉ]XE}؉xuuEtB0M[^_]äftt&ftt&u-uYu5urfM yf떻UUWVS E \6}u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$0[ML$M L$$[9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS,H [5}̋EE-6}Ћ]1ۉuEԅwu܋GE^@E܁xS?h@S?ك@H t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃB 1]UEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]UWVS2 M-E}M|11 rtE xfDU9u|fh]]ZM)fJutu@]Xf@htuEu01Č[^_]UWVSLx (E̋EX߉]؋0u@DEEp u@+U UE܋C,EC0EC4EċC8E[~l^`FpEV8T:NXFH1#VTVHNDQEF4!N@fAEf8^xEFdF`t;s)ыF,-9'v 9^`FhF8D8ZZZf9FlFtX^tx18[^_]FhGFlFtX^tVtE t_~l^`FpE^xFdF`F\Vl)…F8D$ T$D$4$]WVFlF\;.~l^xt+Fp=F`~FtDE]f+FdPy YfZ]Ӌ}ff=vff}f E苆E~x}Ft)ÉFtWVxFlE܉U]؉Fl;Ew2^8\ NX~H1#NTNH^D K~4!Nj^@f{fm}~xu]FhF`E}܍D8FlU9UV\)ЅxeV8D$ D$T$4$]TFlF\|@^t[F`^x~l11뚋NhteV8FlDZZZfFhFlƒwg} tlV\)ЅV8D$ D$T$4$]SFlF\v@8[^_]ú} uV\)ЅxRV8D$ D$T$4$]8SFlF\x8[^_]ø8[^_]1W1UWVSP E}@,&u@-&Ewt,GlW8TOXwH1#WTWHOD Qw4!Ƌ_@fsft)Ӌw,9W`YPf+Gpqfq ҋ]ff=vffuf EԋEЋG`E܋wt)Ɖwt_l]؋_8]_X]_T];w QUU؉WlG`]GHTM1#UWH]9]G\Wl)…G8D$ T$D$<$]3QGlG\HD1P[^_]ËW8ZZfGtpwtGl9EWt] `Glv‰G`GlX_`GDE̋G@EȋG4EċGHM؍Q]uWlMuL1#EGHu̍Fu!֋Mȉ]fq]fmuw`uuUU؉Wl\1tƒwg} tlW\)ЅW8D$ D$T$<$]vOGlG\Z@P[^_]ú} uW\)ЅxKW8D$ D$T$<$]OGlG\xP[^_]øP[^_]11SUWVS$ɋ EEP @,ru9vEECEЉE9vME9E} 1;UEED$ D$D$E$],KEP@]و\EP@|EP@шLEP@ӈ|EEEsEEEP*K97)ыE@l}+G\Ǎ0E ;UE} u9v}J _\_8‰ωރtftuC )CCF\)EE.S uEs )sssEEu)ƉuteuV,~8;Udž3)փd9*EP,PlEP\Eu)ƉuuEPlE9sEaEHE E;P\Ep,E;vEH*E@ E)=}O\)ʉ99G9} D$ t$EH8L$$]HEp\~E$[^_]Ëuvtftt&1[^_]ÍHw5@u[^_]1[^_]u/u=yf XUWVSO f}EGGGG,wFFFFy؉Ft@F*D$D$$-+G0F(4$>E[^_]F9D$D$$j$EUWVS { Òu4$ Džt [^_]ËvF,F}U )u׉[^_]ÿ[^_]ÿUS]tDS t=C$t6…u)CM MMMH|[]ú[]UWVS }U \É ÍBEtƉ ƉU u\OAtWЃy0IPt9s؃ [^_]Ãu ]Ѓ [^_]9rgC [^_]ËAEtjxtm@E}t )ǃ|u}$t )ǃ|u},_WC땃yl ?5UWVS4{ E܋EE؅} E@EEP 'PE@=u~QuN(} ~(v=* EPB@qEX EM  @M L$M $MP<t%} }  EZE@u E@(E؃4[^_]ËE@D+@MAEЋ] ۃ} u ~ 9=EHEXEHtU mx} VEPEH0uFXF^EH0VFX^,EH2VFX^ EH3VFX^ EHVFX^ EHVFX^,EH VFX^ EH VFX^ EMA~؉AEX1EeuF0E 7E@lt B))ЃuNVZ^$NVZ^FlD$D$$]w#MA0uFqFE@9D$D$$]MA0uVFHNVFHNVFHNF0‹x,tXtHtx$tuNFX^FHVFX^ FHVFX^,FHVFX^ FHVFX^    }OGX_GH WGX_ Wrt*JWGX_ GHWGX_,WZ,{ E@ @E}  E9EXۋE@-} #E@D+@MAEVFHNVFHNVFHNVFHNVFHN ) 9 }OGX_WGHOGqEVGGEdEPr]{}K B)ȉ‰E[ ]9iUmtftB BJI,t ;E EB UEUBmM+MM]z }JqJ 9EE])ZE߉΃v|\UEa E@0NVZ^NVZ^EP0NFX^4NFX^M)ȉD$BȉUԉD$E@0$]MA0UE]ڋE}x΃htft}MOOWB,0E@ E@IBuN&ZV z~ ^x~t4FV9F uՋz,t9EFV1묋EPZ,t @9OE@ E@[B$uN*Z$V z~ ^x~FV9F uыz,t9rrE\FV1묋MAE D$E$K)ȉD$NL$E@0$]MA0)ȉD$NL$E@0$]MA0e]C@,S9dMAgtp]CP;S vEC.MI0uVX^ EH0VFX^,D$D$$]MA0}GqEw8B,XfEnIu EP[;gE@@,1ϋGtG`W8GlZZZfGtGtOlQWl9pGt^E Eǀ} ETMA\Yl])…sA8D$ T$D$}<$]2GlG\PG\)…x9G8t$ T$D$<$]^2GlG\B@1;M썶E)L$GD$E@0$]MA0WE@,&M@-&UB`Jlr8utut]:^E XXX fjtBl9ZBt=QЉU(UBt=6M CB`Jlr8u4@ED$ D$D$E$]-} EEp()ȉD$}OL$E@0$]3MA0W)ʉT$KL$E@0$]MA0G@,k:^e:^\u썴uUԉEU؋]L:P':P :P:Pf:P::P:9E:PtUԉƋEЉ]+]Z`9B`ÉكXXX Mff B`)BtBlB`9B\Jl)B8D$ L$D$$U].UBlB\U@U)&u^VFX^ EP0NFX^4NFX^NO tE}GD$GD$E@0$]MA0WU1Eǀ} .MEPE*E$],ɀ@\ϋYl])D$ T$A8D$ $]-GlG\HE@AE@D+@FE|}GDWLfDPTT$D$$]Gt*GlG\LJ @\Yl])…xoA8D$ T$D$}.1E@D$}fEP1됋UԉƋEЉ]UUԉƋEЉ]BUԉƋEЉ]/UԉƋEЉ]UԉƋEЉ] UԉƋEЉ]UԉƋEЉ]UWVS_h v} EEMEp 5}+M9~(u\9tDJBBF|EE[^_]D$E$E@FtFl9F\`^tiFDVLfDPTT$D$$%dž% @9E5E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS f .EuE EM}EEEEE U$n81e8\GFF ^$}uEEG} }UD$D$F($V ÅF0@*UP@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]O?|A11u3 cE.F$EF F( [^_]øCE@D+@F4$~̸U ED$ED$D$D$D$ D$E D$E$]UWVS] .EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@CL{DMqD%C {uvugu`CMQ+QS $ | 0 E[^_]ävflfftt&mft&_0f&t&fu5Ifa{@f3f+0f(-f%*$ E/E#E^ UWVS<^ EU O]Ӄ}E U2X3 ˃uE UEEEċE EEEEEEuދE30u؋M3HM܋}3x}ԋ]3X ]ЋM3HM̃Eȉ4E܋EEËEE]] E34}Nj<1}}Nj<1}}Nj<1}}ȋ1EE]umuEU E U 1غ3 ȃuM U3Q1к3 ȃuM U3Q1к3 ȃuM U3Q 1к3 ȃuM U3Q1‰Ӻ3ÃuE }.U EMщ232B32Z32B32Z32B32Z32B3)ЃwMEu DE t&M EE 2X39uЃ<[^_]ÉE Ủe)EUEEEE&1<[^_]ËMoyUWVS[ .uUtbE@E}EtBtEu41ۺt 1ÍJtt5 tߋu1ɸt 1Pt t t1PuE 1ȃ[^_]UWVSNZ iuUtbE@E}EtBtEu41ۺt 1ÍJtt5 tߋu1ɸt 1Pt t t1PuE 1ȃ[^_]UWVSY }t\E@EEtBtE]1t 1ƍJtt5 t߉[^_]UWVSY }t\E@EEtBtE]1t 1ƍJtt5 t߉[^_]UVSE]1t 1ƍJtt5 t1ƍJuE 1[^]UWVS<}M E}]}pE}EPEEm}EF]؉F}F‰MFUЉF]؉F}F‰MFUЉF lj]F }~ E^ N VFЉEEEEEEEEEEEEUUE9)}q ))Ǹq] ))É]E}EE <[^_]ËUtUʋEY9uEvqE )ЋU)‰ <[^_]ǁvE=t-j}]EEȉE8A]؉AƉ}A‰uAUЉA]qEYQA <}A }A }A }A }A}yENjEEEEEEEEEEEEE;M/E]Dt]T؋MX9uMq ))NjE ))E <[^_]ËE-uXUWVSMuq ))ƉE E)ыE  ))֍11}t9Ov=v=w  ȃ[^_]-=vѸ[^_]UWVSMuq ))ƉE E)ыE  ))֍11}t9Ov=v=w  ȃ[^_]-=vѸ[^_]S *ߧøUUS +E@]USR EE $[]USR E $$[]fffffffUWVSljU䍱\ ]ɋPE9fEE苄\ ]fU9M~Q` }Xwĉ]f9]sċEƋE܉D [^_]Ë}X8>Xv֋MD ;M~E܉D [^_]f}E^UWVSLÉЉUċU@0uЋx ǃPǃT=1ɾ1!P\ ƄXƃ9tf<ufD9uu|Ẻȉ}ȋ}M6u11҉` fƄXuЅt T)uŃ uΉ빉}}ȋM1t1U̍DPEċUP}Љuu}ЋPuu=B;Xfyf~GƉ` ỦhP` ֍PP\ ` Ủ*` EЋTX JTT uȋE̍֋UЍ ffUXEX872TFT` EX EċUPŰ@UPUPU@Eȍ< E 1UЃ1 9rE6E$EUfD<\ PEE]<)ߋ]<6Ƌ]EtD9U: ]4 D D]9}EfF9}|‹]fC< ]9{11uK: fNuEtBu|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]Ћ}tEȍpuč4C: fEĉC< ftfC< fK< f< Uȅ#=uS< }ȅt>\ 9M|<}L9t)ϋM }fWmu‹}ĉ}랋MȋE]A=)"ȪfEE1ȪEqfmdUWVS ÉJEfDrDE1E?;Ut f| f t_9u:ME19ut:9}9t;E}f| t!UE19uuƃ [^_]ÉUE1룃  f xf kUWVSljRUۃҁpuD E1uEE}?}EE9}9}9ǜ}KNY^^ FHNN)fD8mt>E|T f )f9mu‹EMEEE9E [^_]Ë}fE9t{~ | )9E fVJNNFPVV T)}؋EE  E ȹ)9fVJNNFPVV T)]ۉ߉ f~VJN~FPV )fUWU9U&MEEE9ET[^_]Ã}  ] +M9щ fVJN^FPVV U؍T) } fNVZ^VFX^ )f ډi]ۉ f ] ø+E9OfVFHNVFX^ ]؍T) }  fVFHNVFX^ )f MEf MډEEEE U؉ ;]ۉ fME  f(U؉UWVS(E ä]ƉUMԋfE싆E@EЍ@ẺE|Ef ]f])9~fNVZ^]VJNN)ы]f]fL:E9iExDE:É]F‰E܋}UU؉f ])9fVJNNVJNN|:)ы]M̋ MtqUM+‰ ù+E9YfFx~~Fx~~}|8)ËEE=M@MDEE؉ f]+Ef9vFx~~Fx~~)]f]f}L8}䋄EE+@ f]+Uf9#VFHNVFHN)f]f}L8E9ϋEE ù)f9Fx~~Fx~~)}fD([^_]ωMEM@/fM艎}쉾]([^_]UVS~CHPrpHPrpfǀǀ[^]Å~UVS@ ] $ |, | 0 h8 fǃǃ f9uЍ f9u f9ufǃǃǃǃǃ[^]UWVSE]uf f HyxxPzxx )f KHPrpHPrp<xPrpш pHQPftxxu s/u!uX[^_]Ã낤X[^_]ftuutSfUVSEt.~%HPrpf[^]HPrpHPrpfǀǀ[^]UWVSEf f pHyxpPzx )fJ󉈼 ~xHPrpHPrpfǀOt=~%HPrpf[^_]ÃuHPrpHPrpfǀǀ[^_]Ã#UWVS,< E]} uEE싓Ex,E- +$  U= E䋋( ‰%0  E@f~ u޹ DH  9F9 >}w} fsKy{sCx{ p󉳼)}( E E܃ -E؉ fsKy{sCx{ p)EE E؉ fsKy{sCx{ p)EǍB  E؉ fsKy{sCx{ )EN􉋼}@4:u]KqssCpss )f 9}t<W~ f 9}uċM܋uaM}Rt f849ufu-fu#fu 9f8tMA,iFM荋 MV9ED$ t$|$$E荓 f9uE䍓 f9u| f9ufǃǃǃǃǃEu,[^_]É؃,[^_]LR 9E fE@\E fsCHKSCps )щf } Ǎq N ǃEf- ǃ+1 55UWVS7 )EyU yU 4qUU u#]f9[^_]Ã} Wu3@fv@f @UWVS56 LƉ׉M$U=yaratA=tcidu-4$ƅt874$1GE01[^_]øV[^_]É4$茧ĸ UVS5 ϻMU Eaƅu [^]0[^]UVSr5 ÉMU Eƅu [^]00[^]UVS+5 BMU Eƅu [^]0[^]UVS4 MU Eƅu [^]?080[^]UWVS4 ôM}EDƅt0[^_]É|$ED$E $1tE$`[^_]0E$DtxUWVS 4 ,}Gt<D$UyƋGD$U$htE 0 [^_]F1 [^_]UWVS 3 ý}Gt9D$U ƋGD$U$htE 01 [^_] [^_]UWVS 53 L}Gt<D$UƋGD$U$gtE 0 [^_]f1 [^_]UWVS 2 ݸ}Gt9D$U諁ƋGD$U$7gtE 01 [^_] [^_]UWVSU2 lED$E D$E$ tSEt4}D<$蠤ƋED$<$ftE01[^_]s[^_][[^_]UWVS1 طED$E D$E$ytSEt4}D<$荀ƋED$<$ftE01[^_][^_][^_]UWVS-1 DM}Eƅug|$ED$E $twE$EtKUD$UNjED$U$det E8[^_]'0[^_][^_]8E$z[^_]UVSL0 cE D$E$uƉ$O=tciduE0[^]1[^]UVS/ E D$E$wuƉ$IO=loobt 1[^]É4$юU[^]UVS/ ûE$t.ƉD$E D$E$uE4$+KE[^]1[^]USK/ bE D$E$tUT$$X[]US/ )E D$E$tUT$$Y[]US. E D$E$TtUT$$bY[]US. ÷E D$E$tUT$$Y[]USg. ~E D$E$sUT$$Y[]US.. EE D$E$sUT$$Y[]US- E D$E$psUT$$Z[]US- ӳE D$E$7sUT$$uZ[]US- ÚE D$E$rUT$$Z[]USJ- aE D$E$rUT$$ [[]US- (E D$E$rUT$$[[]US, E D$E$SrUT$$"[[]US, öE D$E$rUT$$/[[]USf, }E D$E$qUT$$/[[]US-, DE D$E$qUT$$/[[]US+ E D$E$oqUT$$M[[]US+ ұE D$E$6qUT$$M[[]US+ ÙE D$E$pUT$$Y[[]USI+ `E D$E$pUT$$f[[]US+ 'E D$E$pUT$$f[[]UVS* E$D$Qt.ƉD$E D$E$pE4$VFE[^]1[^]UVSu* ÌE$D$uQt.ƉD$E D$E$pE4$EE[^]1[^]UVS* +E$D$Qt.ƉD$E D$E$"pE4$EE[^]1[^]UVS) ˯E$D$Pt.ƉD$E D$E$oE4$5EE[^]1[^]UVST) kEU$T$UPt.ƉD$E D$E$boE4$DE[^]1[^]UVS( E$D$Ot.ƉD$E D$E$oE4$uDE[^]1[^]UVS( ëE$D$Ot.ƉD$E D$E$nE4$DE[^]1[^]UVS3( JE$D$3Ot.ƉD$E D$E$@nE4$CE[^]1[^]UVS' E$D$Nt.ƉD$E D$E$mE4$SCE[^]1[^]UVSr' ÉEU$T$sNt.ƉD$E D$E$mE4$BE[^]1[^]UVS' )E$D$[Nt.ƉD$E D$E$mE4$BE[^]1[^]UVS& ǬE$D$Mt.ƉD$E D$E$lE4$/BE[^]1[^]UVSN& eE$D$Mt.ƉD$E D$E$[lE4$AE[^]1[^]UVS% E$D$7Mt.ƉD$E D$E$kE4$mAE[^]1[^]UVS% ãEU$T$Lt.ƉD$E D$E$kE4$ AE[^]1[^]UVS,% CE$D$vLt.ƉD$E D$E$9kE4$@E[^]1[^]UVS$ E$D$Lt.ƉD$E D$E$jE4$J@E[^]1[^]UVSi$ ÀE$D$Kt.ƉD$E D$E$ujE4$?E[^]1[^]UVS$ E$D$QKt.ƉD$E D$E$jE4$?E[^]1[^]UVS# ýEU$T$Jt.ƉD$E D$E$iE4$'?E[^]1[^]UVSF# ]E D$E$hƉ$B=gntst 1[^]É4$c&tU[^]UVS" E$$t.ƉD$E D$E$hE4$r>E[^]1[^]UVS" èE$b$t.ƉD$E D$E$hE4$>E[^]1[^]UVS8" OE D$E$gƉ$A=atadt 1[^]É4$ztUEt4$zM[^]ø[^]UVS! ӧED$E$xt.ƉD$E D$E$gE4$==E[^]1[^]UVS\! sED$E$Jyt.ƉD$E D$E$jgE4$<E[^]1[^]UWVS E D$E$vfƉ$H@=gntst 1[^_]É4$#P$UDžtڋUT$D$4$0$t U:[^_]ÈE<$E[^_]UVSd {E D$E$eƉ$?=gntst 1[^]É4$#tU[^]UVS E$!t.ƉD$E D$E$fE4$;E[^]1[^]UVS ƥE$!t.ƉD$E D$E$eE4$7;E[^]1[^]UVSV mut,t$E D$E$ueE4$:E[^]1[^]UVS E D$E$ZƉ$T>=loobt 1[^]É4$}U[^]UVS ƤE$|t.ƉD$E D$E$}E4$6:E[^]1[^]UVS U lE $|t'ƉD$E$3E4$9E [^]1 [^]US E D$E$VUT$$`G[]US E D$E$UT$$G[]US èE D$E$UT$$H[]USX oE D$E$請UT$$TH[]US 6E D$E$rUT$$H[]US E D$E$9UT$$H[]US ĢE D$E$UT$$H[]USt ËE D$E$NJUT$$-I[]US; RE D$E$莊UT$$I[]US E D$E$UUT$$I[]US E D$E$UT$$I[]US çE D$E$UT$$I[]USW nE D$E$誉UT$$I[]US 5E D$E$qUT$$I[]US E D$E$8UT$$I[]US àE D$E$UT$$J[]USs ÊE D$E$ƈUT$$J[]US: QE D$E$荈UT$$J[]US E D$E$TUT$$J[]US ߟE D$E$UT$$J[]UVS åE$D$@t.ƉD$E D$E$UE4$5E[^]1[^]UVS - DE $D$-@t'ƉD$E$E4$4E [^]1 [^]UVS E$D$?t.ƉD$E D$E$蚇E4$S4E[^]1[^]UVS r ÉE $D$r?t'ƉD$E$IE4$3E [^]1 [^]UVS /E$D$?t.ƉD$E D$E$E4$3E[^]1[^]UVS  ϝE $D$>t'ƉD$E$萇E4$@3E [^]1 [^]UVS_ vE$D$`>t.ƉD$E D$E$'E4$2E[^]1[^]UVS  E $D$>t'ƉD$E$׆E4$2E [^]1 [^]UVS ýEU$T$=t.ƉD$E D$E$nE4$'2E[^]1[^]UVS F ]E U$T$G=t'ƉD$E$E4$1E [^]1 [^]UVS E$D$<t.ƉD$E D$E$资E4$n1E[^]1[^]UVS  äE $D$<t'ƉD$E$eE4$1E [^]1 [^]UVS4 KE$D$4<t.ƉD$E D$E$E4$0E[^]1[^]UVS  E $D$;t'ƉD$E$誄E4$Z0E [^]1 [^]UVSy ÐE$D$y;t.ƉD$E D$E$@E4$/E[^]1[^]UVS  /E $D$;t'ƉD$E$E4$/E [^]1 [^]UVS ՙE$D$:t.ƉD$E D$E$膂E4$?/E[^]1[^]UVS ^ uE $D$_:t'ƉD$E$6E4$.E [^]1 [^]UVS EU$T$:t.ƉD$E D$E$́E4$.E[^]1[^]UVS  üE U$T$9t'ƉD$E$}E4$-.E [^]1 [^]UVSL cE$D$9t.ƉD$E D$E$E4$-E[^]1[^]UVS  E $D$39t'ƉD$E$E4$p-E [^]1 [^]UVS æE$D$8t.ƉD$E D$E$UE4$-E[^]1[^]UVS - DE $D$v8t'ƉD$E$E4$,E [^]1 [^]UVS E$D$8t.ƉD$E D$E$E4$R,E[^]1[^]UVS q ÈE $D$7t'ƉD$E$HE4$+E [^]1 [^]UVS .E$D$a7t.ƉD$E D$E$~E4$+E[^]1[^]UVS  ͕E $D$7t'ƉD$E$E4$=+E [^]1 [^]UVS\ sEU$T$6t.ƉD$E D$E$$~E4$*E[^]1[^]UVS  E U$T$G6t'ƉD$E$~E4$*E [^]1 [^]UVS úE$D$5t.ƉD$E D$E$j}E4$#*E[^]1[^]UVS B YE $D$5t'ƉD$E$~E4$)E [^]1 [^]UVS E$D$15t.ƉD$E D$E$|E4$g)E[^]1[^]UVS ÝE $D$4t'ƉD$E$\}E4$ )E [^]1 [^]UVS+ BE$D$t4t.ƉD$E D$E${E4$(E[^]1[^]UVS E $D$4t'ƉD$E$|E4$O(E [^]1 [^]UVSn ÅE$D$3t.ƉD$E D$E$5{E4$'E[^]1[^]UVS $E $D$W3t'ƉD$E${E4$'E [^]1 [^]UVS ʑEU$T$2t.ƉD$E D$E${zE4$4'E[^]1[^]UVS S jE U$T$2t'ƉD$E$+{E4$&E [^]1 [^]UVS E D$E$MyƉ$G*=gntst 1[^]É4$tU[^]UVS õE$F t.ƉD$E D$E$myE4$&&E[^]1[^]UVS E \E $ t'ƉD$E$$zE4$%E [^]1 [^]UVS E$ t.ƉD$E D$E$xE4${%E[^]1[^]UVS ñE $k t'ƉD$E$yyE4$)%E [^]1 [^]UVSH _E D$E$wƉ$(=atadt 1[^]É4$ btUEt4$aM[^]ø[^]UVS ED$E$`t.ƉD$E D$E$wE4$M$E[^]1[^]UVSl ÃED$E$Z`t.ƉD$E D$E$4wE4$#E[^]1[^]UVS  #ED$E $@_t'ƉD$E$wE4$#E [^]1 [^]UVS  ʍED$E $_t'ƉD$E$wE4$;#E [^]1 [^]UWVSY pE D$E$uƉ$&=gntst 1[^_]É4$M P$UDžtڋUT$D$4$ t U:[^_]ÈE<$E[^_]UVS ٌE D$E$uƉ$&=gntst 1[^]É4$ tU[^]UVSf }E$t.ƉD$E D$E$5uE4$!E[^]1[^]UVS  $E $t'ƉD$E$uE4$!E [^]1 [^]UVS ҋE$t.ƉD$E D$E$tE4$C!E[^]1[^]UVS b yE $3t'ƉD$E$AuE4$ E [^]1 [^]UVS  'u t%t$E$tE4$ E [^]1 [^]UVS ߊut,t$E D$E$sE4$Z E[^]1[^]ffffffUWVSk ÂE 0Ft%uFt$\4$T1[^_]Í: <$葎Ft<$肎1[^_]Ét$: $M<$^FUS D$: $D$: $^1[]US ñEU 9t8J 9H u(Rt<@t-T$$|[]1[]ø[]ÍˍUWVS) @u F tPV|$E$u 1[^_]ËFD$E$ t|$E$[^_]ÍVD$E${[^_]US ÷E @tUT$${[]ÍD$ D$D$o$OUSE \E @tURtUWVS Etw} |$ ED$D$$TƅxEH $M…t1|$ ED$ML$$UU1[^_]1[^_]ÍD$ D$D$E$EU8SUT$\$]UVS(ut4$3[^]_UWVS uth9u^FtFN AM$DžtAFMtAMD$<$_M [^_]4$ [^_]1 [^_]ÍUWVS @WutP9uFN AM$Džt/FMt/MD$<$мM [^_]Z1 [^_]ÍUEt 9t1]Ë@ ]UEt9uP@tt ]1҉]Í]US]tEt 9t1[]ËU tH Q;Uw@tD$E $[]ÍUEt 9t1]Ë@]UWVS߁}t;9u1G $ƅtGt"D$4$a[^_]1[^_]ÍUp{Et9u @t]1]Í]UWVS*Aut 9t 1[^_]ËU tM 9uFtA F EP$UDžtŋE HɋUtYFtJL$D$ ZjD$T$<$rF~}~ t$si뮍UWVS\sut 9t 1[^_]ËE FtE $VF EH $M…tFMtS} |$D$ ZjD$L$$U裿FUV}~ t$oe륍D$ D$D$+$tUSjÁEt 9t1[]ËM tM 9uL$$US#:Et 9t1[]Ë@tU T$$5r[]ÍUS~Et 9t1[]Ë@tU T$$q[]ÍUS{Ò~EU tG9u=t99 u5Rt@tT$$q[]Í@uፃٸfUS(~Et.9u$@tU T$$+q[]ÍfUWVS }u~$Ft  [^_]D$ED$ D$D$4$" tȋUBU$MDžtFD$ED$ UT$|$4$tE9EtX<$9w$ ƅt'D$4$aFF FE 0 [^_]D$VD$4$mtM1M fUEU @]UWVSzǍ|uM ^t|F9rItX^ [^_]ÉMD$$…FFM빍(D$ D$D$$WD$ D$D$$?D$ D$D$$1u֋Ey& tЉD$$>u1 [^_]ËU~ tD$$uϋEt&qD$$u럸 [^_]UWVSu} F t*19^ vD$ 4$u1[^_]D$<4$|u1[^_]ÉD$4$btȃuE >u[^_]>UVSu] D$<4$ u 1[^]D$/4$ttD$4$t̃uD$>4$tE u[^]UWVSu} F t*19^ vD$ 4$u1[^_]D$<4$etu tD$4$BuD$/4$,tD$>4$tE u[^_]UWVS|Ƌx]@< tD$$u1[^_]ÍD$$tD$ $[^_]USx]D$$$tD$$N[]UVSw$蜻ƅt'$芻tFFF [^]É4$1US_vwE$d[]UWVS:Qw]u}E E $LEF t|Jvt/ut!1[^_]ÍBFrEPF(F ǀ u( t&/t&t>tt tJwՉ)‰VM t%]9u\$D$E $]e?/F$<>"G9tHv~ u#) t$=t&t tJw׉)Vx"xPVHЀ"u"uxzF(F(`F$>RFFFF ~%]D$ D$D$$w1[)щN x>FUWVS}E@tJ1u t 9v8u t(<&upatluAxt1[^_]pmpuxou߀xsuـx;uӃ'놀guxtux;u>hquxuuxouxtux;u"t7։>t/uE$EE[^_]ÍPEP0V(EPUSòoE$蠻[]UWVSsÊoUEy:$UzUD9uH9/t9wY/u9t 9t8/t)Ѓ=;փ.ƄfDž.U$ϦH UU/.pl@istX@XXXXf@ X<$pƃED$E D$4$j9E謦84$l$ 菦81[^_]{?1[^_]c1[^_]äƄfH1[^_]É4$kF$萕lj$膕ׁ|$4$n4$kUT$$UWVS0/Fj$W}BFtD$D$ D$ED$$X@}PtҋpG$uML$ $PDžtօl$ˏtPuDžLL$$PtЉ<$ftoƋPtҋ@~<$#ttЋ $P0[^_]Åu΍D$ D$D$$DD$ D$D$$D$ D$D$ $D$ D$D$E$D$ D$D$;$D$ D$D$ $rUWVSn}gE$uD$ED$$t{$u Ct2{t1$![^_]Á8versufxiouڀxnuD$E D$$t$DžtD$ED$$cu<$_1[^_]UEt]1]UWVSDlÃf$SUtEDžDžEU 9 u @|$t$ D$ED$$vTEU t$t$|$ t$T$$Quu EM L$$RD$D$ t$ED$<$Su1D[^_]ÃD$D$ E D$ED$$RtBEU DžDž; 넸D[^_]ËE%ELD$ D$D$$jU D$E D$E$]UE]UE@]UVS,;d]C$$[^]fffUSEU 9t6HZ1˃t"X@xJx3Z3B []1[]ø[]USøcxD$$k: $g[]USczc: $g[]UWVS4;RcM AQAD$ T$tjD$D$ uԉ4$͢|$E$u 14[^_]Ét$E$Qt|$E$4[^_]Í3xUVSöbE 0t$; $ԋ4$萮1[^]USe|bD$: $zfD$; $1[]UWVS2bƉ莚D$ED$F$WEU;MErgEF[^_],8"u1UWVSêaljD$ED$G$|V!ЃtNEG[^_]辙8"u1UVSM UBAt%tOYA R9ˉr39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS`ƍxD$$h: <$dt$; E$@t $E<$dUЃ[^_]ÉE<$d$ "Ut֍ D$ $M|MAFAFA<$ddt$E$輅Mt+$ED<$;dM $۫UЃ[^_]ÉL$ME$M9uE<$cUЃ[^_]Í D$ DD$D$@$[UVSM UBAt&tQYAJR9ˉr49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS>U^ut 9u4$[^]1[^]UE@]UWVS ^Et 9t1[^_]ËHX@t5P@wz1ɻ9Ӊru9[^_]Éȉw?ȉ19ljr.9[^_]ø@` VU4?]Et 9t11]ËP@]U]Et 9t11]ËP@]U\Et 9t11]ËP@]U¸\Et 9t11]ËP@]UVS{†\Et 9t 1[^]@t'P@9ѹrۋE [^]ËHXȉEU;uErE [^]UVS[Et 9t 1[^]@t(P@9ѹrۋE f[^]ËHXȉEU;uErE f[^]USS^[Et 9t1[]@t#P@9ѹrߋE []ËP@Ӂw] []USZEt 9t1[]@t#P@9ѹrߋE []ËP@Ӂw] []UnyZEt 9t1]ËHP@txE P]US+6ZEt 9t1[]@t#P@9ѹrߋE []ËP@Ӂw] []UVS¿YEt 9t 1[^]@t'P@9ѹrۋE [^]ËHXȉEU;uErE [^]UVS*YEt 9t 1[^]@t(P@9ѹrۋE f[^]ËHXȉEU;uErE f[^]US—XEt 9t1[]@t#P@9ѹrߋE []ËP@Ӂw] []U%XEt 9t1]ËHP@txE P]UWEt 9t1]ËP@9ѹrE ]UžWEt 9t1]ËP@9ѹrE f]UMXWEt 9t1]ËP@uE ]UWEt 9t1]ËP@uE ]UVEt 9t1]@uP@xM A]ËP@M Q]UVEt 9t1]ËP@uE ]UKVVEt 9t1]ËP@9ѹrE ]UVEt 9t1]ËP@9ѹrE f]UUEt 9t1]ËP@uE ]U’UEt 9t1]@uP@xM A]ËP@M Q]US 7UEt 9t1[]ËM tM 9uL$${USTEM Ut 9t1[]ËX@txx3H3P []USéTEM Ut 9t1[]ËX@txx3H3P []UVSS^TE] Mt 9t1[^]ËpP@uxx11 [^]UVSTE] Mt 9t1[^]ËpP@uxx11 [^]UWVSƾS]EEECt [^_]À{$u}S<-t_<0uzxtF&t9D$D$$teU [^_]Éhu끉uoffffUE 9E]UWVSRƅuj$@衖DžED$<$D$G$}XEG,w0G4G8G<[^_]ÍD$$EEt#$@DžMy $(1USR; $WV[]USQAD$$9Y; $V[]USóQD$; $U@D$,; $w1[]USTkQED$E $D[]US'>QED$E $PD[]USQE$WE $W[]UWVS(PUM܋p4@,EEGEt@E<E tbMUD$E$CUMtօuE܅t!81ɉȃ([^_]ËE܅t8ȃ([^_]1ɉȃ([^_]1ȍWD$ D$D$z8$USOPt:9 u0H 9JD$ D$D$8$ԧUVSɿEE 0t$,; $nF,v }FMu0u&Ɖ[^_]Åu2[^_]1[^_]äftt鍃D$ 8D$D$H$uD$ 8D$D$H$KUQ\+Et9u@]1]US0+Et 9t1[]ËM tM 9uL$$tUS Ҥ*Et 9t1 []ËM9H uU tL$M L$@$5 []UWVSuÌ*u~$u7Ft=D$ #T$VT$$-t V [^_]ËFD$U$11YtՋEH $MmDžtFVT$U$M$E9ED$D$4$]uE$rmT$$EͬE@xp U aD$ED$F$8Et|UF F9:"D$ D$D$H$ي<$t[^_]É<$t$lT1( a8"ft_E<$tE%1U|‡(Et 9t1]ËM tM 9u9]UVS0G(t$H; $yƃP; t$<; $`ƃD; 1[^]USݡ'E xu^D$E$耮[]Í UVS螡õ'uD$$.u<; 4$ռ[^]ÍH; UVSKb'ut9u4$蘼[^]1[^]U)'Et 9t1]@]U'Et 9t1]@]US輠&Et 9t1[]ËM tM 9uL$$UVStË&uFt [^]À~$tD$  D$FD$F $u_D$ ^D$FD$F $tWD$$g-<; 4$HE 0[^]ÍD$$0-H; ǍD$ 8D$D$$ffffUWVSkÂ%ƅur$@BiDžED$E<$蔨ED$G$+EG,w0G4G8G<[^_]ÍD$$lEEt#$@hDžMq $p1US虞ð$E$*E $*[]USe|$Pt:9 u0H 9JЃ[^_]úrD$ D$D$$荄wD$ D$D$$cUWVSWn"E 0F4N09V,tdtd|ED$D$ D$t$E$tDn4E 8[^_]Åt\D$ D$D$e$裃[^_]É$mF$'4$m1[^_]Åt?E 8[^_]ÍD$ D$D$d$,D$ D$D$u$UWVS !ljEp,uUD$$htYUtt 9t%$$ [^_]ÉUMGE$F!UNjE$/!Ut$裰ME [^_]D$ D$D$$$|1%UE]UWVS脔Û}9GE$ G4tMG4t=1M<B,U8$E茯MQ,E:UB49rɉ׉A4G8A8ME$) Mȃ[^_]1ɉȃ[^_]UE$2t`8]UWVS誓ut 9t 1[^_]Í~<$v0<$[^_]UWVSYput 9t 1[^_]Í~<$fv4<$[[^_]UWVSut 9t 1[^_]Í~<$E 9F0r<$[^_]ɉUWVS蠒÷u~<$t_9UuRD$$1`t:HE4$賭EpU9u%@V

17UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1M9|$vFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$u{9r92)|$ȉ뗅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ щL$D$\$T$ L$t$Ӊd$D$$9rAt;+t$$L$ D$L$L$ L$ډD$9sy+D$T$$D$1fffUWVSM]u D$ \$y كۉ\$ˋ}D$u9v2։1 M9t$v:ȉL$ t؃ڃ[^_]Åu 1t$É1뷋T$ƒD$u,9r9w)t$]U ] u D$ O T$)ЉD$ыT$L$ щL$D$$T$ L$t$$$9r't!)L$L$ 9s+$T$։UWVSM]u D$ څy T$ كۉډˋED$u9vJ19v11L$ t؃ڃ[^_]uR9r ;L$ȅu 11҉NjD$]U ] u D$ U )T$ډL$ щL$$T$ ֋ $t$щ9rt13T$9s11UWVS8_vEu Mt Mtxt|xHUPT$0PT$,P T$(P T$$P T$ P T$P T$@D$|$L$ ED$pD$4$§t8[^_]E11{EtۋE8[^_]USM] CfACfACAC A 1T T u[]US]M CfACfACAC A 1T T u[]USM] ȉCffACffACAC A 1T T u[]US]M ȉCffACffACAC A 1T T u[]UWVS4g~}u ?Mt E<$i=$t4[^_]À-uFD$0FD$,F D$(F D$$F D$ F D$F D$FD$FD$FD$ t$D$<$N uFx,EtEtED$4$24[^_]Ƀtʃ ?iIh;  @tL:u DŽh; ?x#`> @] `; \U1[]Ã҅~h; 1  9t:u뚸#[]UrE@M `; 1]UrE@`; ]UrµE@DŽd; 1]US]Cu U C1[]US Zrqd5u#ED$E D$E$u []$!0 []øUSq[]USq$-[]USq$>2USqñd5u1[]$|1[]UE 9E]1USLqcE EED$D$vtE$"[]USq+ED$D$wt@E$"xEu[]øffffffUSpE t tKt="/[]EED$D$tE$E"[]EEUS JpaD$D$^t E$" []UEU P(P$1]UEU P(1]UEU P$1]UE `` gPP]UE@(]UE@$]ffffffSL$D$ t9tEA&v€tuuuu˃t@Au D$E D$E$84 []fffffffUVSEM )z@&H`b҃⻃rQq҃ⶃwQÁ@QMK@v%Ax Ƀểr rɃᶃwJÁJwu Bxƒ҃⻃rYƒ҃ⶃwQ%==uYAxf [^]ÁujBs뒁@uUAs+ cuwuml{'ASvA-YATf [^]B-BSYA-f [^]ÍYAtf [^]?pstAdta-UWVS5lLD$E$^ED$ED$E$aǃƜ;6u E $[GEEtuEMED$UT$4$Mu E<=tH4EE4u;}5)D$D$$9c1[^_]É4$봸׸)UWVSjE&{hlptDžxLEEEEEE|(D$ut$$ƒE$D$t$$#Dž<Dž@DžDDž8H|$8D$$DžXDž\Dž`Džd|t DžX}tXuĉ4$XD$4$I|$4$aD$04$;6D$hD$t$ D$*D$0$,64$,4o'8D$t$0$߫tD$(D$$.D$$D$$D$|$$(4Ё[^_]D$*$41҅‰Ё[^_]Dž4`&,Dž4D,D$(D$$l,o,D$(D$$=D$$D$$,"ffUWVS@gǒ|$(D$T$L$,tȃ"|$FD$8UT$$\$(#u܉L$8ƀ-5+uD$D$,{L$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$=D$L$811҉D$8T$ uǃp> E ;M!8-pxt> -D$-E$ǃt> --|$E$^tAx:ǃl> >u[^_]Írt> :u>ut2E8:t*迭|$ D$D$,$?[^_]ÀxF_>t%l> [^_]Àx:tV9M:E8:tCb|$ D$3E l> ǃl> v:US I(D$ D$E$讫 []USHD$E$$]]fUSHE$1[]UWVSHD$}Et|tAt wG W9w2G 1҃[^_]É]E G wW9vߋwMx_);M E|jE G W9v멋E E t\$ D$ DD$D$$/E Uy\$/H\$T/\$D$ DD$D$$T/UWVSHG_EH 1ҋu1׉u}9}EE}E@U29w|)ȉ‹E9wI<u sKu.u&]K K [UR9w [^_]ÉftЉ<u ru^uf뜍GD$4$CƅtYE@)ǍD|$D$$?E0]ECK 7Pf뉃JUWVS EuE D$$‰$Dž0E GGG 01D$D$U1D$ 2D$D$<$t7D$$E4UЃ [^_]1҉Ѓ [^_]ÉEM<$$rMUc8$L81US DE D$ED$,X$Lk []USDØED$ E D$ED$,X$qk[]USCDZU ML$ D$T$E$c[]USDD$ D$D$E$([]USCU D$ D$T$E$[]UVSCãuD$D$ D$D$4$Dt [^]1[^]US7CNED$ D$ E D$E$[]UWVSBuE D$4$~7F0u D$4$[^_]tJF0uҿ1F0fffUUM EyEM EB]UWVS u] }u6)t2yD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVSAE0x$tu[^_]1[^_]UWVSAõ} tE}t+fp f@UPx$MH,UP(UPDUP [^_]þEu1UWVS #A:}u$ ‹EE Bzr EBt7tpE tZp7E 7EUUtnMfH f@PM H$x,p(@D8P [^_]Í7E뭋M tp7E E딉UU$P1 [^_]1UWVS@5UB0~4r,txM q J$tE D$ E 0xt$|$$l[^_]US ?îED$E D$E$u []USf?}ED$ ED$E D$E$t[]ÐUWVS$+?BuED$E $E5F fJfF D$ED$E$Dž;EEF FFFFFF0tN@9t $xF0ǀǀ @$FF0ǀǀEt9tD$<$WEfF f~vRF$F,XF(ȃF E$[^_]èHV Ff"UED$ED$E$<DžUUEU9}F$V F F$/qD$ D$D$4$S$[^_]EPEt=8t,38t"v&Ec<$I}F$V D$ED$E$>됅yF$l4$4$1<$1pfF M1YUVS; uf~ tzD$4${F0tN@9t $ F0ǀǀ FFF t1FD$4$H1[^]ËF UWVSJ;aUB0~4r,t} p J$t} Lj $ M Q!Ѓ[^_]UWVS:uD$4$]nx$P8D$4$f[^_]É4${US t:ËED$E D$E$  []USC:ZED$ ED$E D$E$[]UWVS, : Et8uj}ԉ;k$F4jFF )t$|$$̻,[^_]ÉEԉ$E؍hEEu}[wS끋uUJ9UEx9k]Ë]ÍS]UWVST9}E uu-6uM tV9utRD$2@D$}<$<$PEt;UED$|$E$Uuqx<$PEuŋEu+0ЃT[^_]Ë@E >tSFML$$Cu|$ L$ D$D$2}<$<$PliH\ZffffffUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UE@)@3U u@ @]1]USEU ]xuQwLHtCu?HH LZYZYR Q X SP ҍ1[]øUExuxw1U ]ø]UExu@ u<.w]ø]UUM zuB u<.w~ 9| D ]1]UExu@ u <.w ;E ]ø]UEu E D]1]UWVS 95PuU }Euu0[^_]ø]YUUzuBu :Br]ø]UUM zu#Bu:Brx9s D ]1]fffffffUS -3Dtu []JHT$D$$ []UE ]UEUJσw@)P U 1]ø]UWVS]M4{ }}9+E1|!})1׉;>EE 8th@‹Mϋu sftftu+EP)‰׉;>+US 1[^_]ø[^_]ø‹Mϋu ruu&넍s*yPfUWVS]M}w~4{ 9t~)1UD!ЋU+U1UU֋E M )Q)ʉUEUE)C [^_]1[^_]ÍsuUVSU] z)uGB1w<v5J q 9r#L t18tP9r P9s[^]ú9rB9v$8tP9rP9[^]UVSM] y)uGAPσw<v5Q r 9r#T t18tH9r H9s[^]ù9rA9s+0;ut)tH9rH9rع묉1UUE ttuB]ø]ø]UWVS/)EEEuM<ٸ9E|0)ߋU t;} whEtfEEtlt5PKHKL$MD$$U]XUM MPU [^_]ÿ[^_]1vUWSE]~OSt<);U www؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSU E]tvuqUt6E9vt0u0H9r HD9s[^_]ËEŃp9rxD89rЋU U:3+E[^_]øUWVSU EutoujUt=E9s t7H9rxM9s1E[^_]ËE뾹M9rω8t E렸˃U:uE+EUWVS] UЋ}uރstft[^_]uuBfUST+kD$D$ED$ ED$E D$E$u[]fffffffUWVST*Ɖ-6M1ƅD$D$D$D$ D$T$4$dt,DžM+T[^_]Í11  rFDžDžD$ T$iHD$<$.#stjƅD$D$D$D$ t$GD$G$ut$$tu<$e"$R"DžUWVSTS)jƉ-6M1ƃ> ƅD$D$D$D$ > D$T$4$D$D$D$D$ D$|$4$t;DžDžDžDžDžVDžDžDžT$ D$iHD$$3!tjƅD$D$D$D$ t$GD$G$ut$$thuGtLD$ D$D$$$? 1U+u)T[^_]Ë묋$ ܈UWVS'.EE EE-6M1ɅD$D$ D$D$$+eWD$ D$D$$`t6D$ D$D$$(dƅ3$袪D$$D$$l$ZD$4$F2$ $t&tw$r$t$̩D$D$4$hU+BĈ[^_]Í @$F- 5u,D$$JD$/$6pt(D$D$$kPD$D$T$D$ \D$t$$D$D$0$$@D$D$ $߂$萸$D$$观$X@$8u *D$/$D$|$ T$D$$ɿD$D$T$D$ \D$ D$t$$~D$D$T$D$ \D$ 볋D$D$$wD$$PD$$.YD$$$踶UWVSp!ÇEh-6E1p ׉lfDžpD$D$$xKfDžrlT$$wx1rfhE+u=Ę[^_]ÿAl<$f,lJUWVS ÜEhU-6E1pl } t.} tn/E+Ę[^_]ƅpt BtE qD$D$E $譂Džy2ƅptËBxB |BEBEfDžrlD$<$xrfh=l<$lU D$E D$E$]UWVS'ƉtE|E xE-6E1zDžDžDžDžL$D$$&ǃSDžDžDž,D$FD$$vDžD$D$<$?FD$FD$<$i^<$y?8018=~4$FtDž.8#tf<$|v D$D$$͟U+pĜ[^_]Ã0$M똋F?BƅD$D$D$D$ |$FD$F$A|$I${vƅD$D$D$D$ |$FD$F$u!|$eD$$D$D$<$+D$D$<$A+$ZD$ @D$pZD$,$_8D$FD$$DžD$$MD$ D$D$$$D$D$<$$9fDžfDžD$D$$ D$L$4$4$ҋk<<4$D$t$<$ |4$D$t$<$x4$D$t$<$˛D$D$<$D$D$$ݛD$D$D$D$ D$D$ $u(4$Y=4$Y=$t$H<$@PD$D$<$Džxs$w4$뗋%D$t$$_ PD$t$<$~t2P$Iw4$~1tD$\$"wp$ ^?y$vDžUWVSl`w}EEEEEEEE-6E1E fD$ 9 D$D$ UЉ$UEEEEEEM MEEML$ D$UT$$ukEPt%D$T$B $UUEML$ML$M $M;NjE$)E+u1l[^_]É$D$D$s$ wUD$ED$ED$ED$ ED$E D$E$h]UWVSlۛuEEEEEEEE-6E1E fD$ 9 D$D$ UЉ$U3EEEEEEM MEEML$ D$UT$$*E@t"D$D$C $U>UYD$$ tM 9Ht?ED$ED$E$MEwƋE$e E+uhl[^_]Í$#D$ ED$ED$E$ME 뭉$ D$D$s$ uUD$ED$ED$ED$ ED$E D$E$ ]UWVSݙEdE TEPEX-6@]1D$pH$¢DžLDžDph,`,\dD$ D$D$h$4D$ h4$Sp< `\ l4< t4nЍLDSt l< F< uȍV< t< tщ< u Xvt < u;h>uPp<+<-pq<@[LDH\$ D$D$r$؉DžL<+tr<-:lt$X$Њl@81FF<@lFD$zqS<@0LDH\$ D$D$r$DžLhUTd J4$褾 u6F<@f lFD$X$}؋llHD$ XD$D$F$4lltbqUTqUT؉E@M+ [^_]DžL1lHD$ XD$D$F$Y؋lUTDUTDƅpypUWVS˔E,E(E<-6E1ǃ> U@D$D$ D$DD$<$ְ@D$@ D$4$fD$D$4$豈R84@@ $p@P T$$Gc@@$(HD$4$0t$D$4$pB0|%=> $Ӽ8$襼4$跼E+{[^_]þōHD$$0…tG(D$ *D$0$L$$[0x+t7@;At,> > |t> (D$yZ]}3}3}3}lj]1Ӊ!1׉u]yZE|3tu13uƉ]3]!3u|yZ։U3p3U3U‰ӋU1!3UxEyZډډUt3Xh13]É؉11t‹En؋Up3P]13|‰13]p nˉӋUX3M3M3xM11MM9nMP3}3}3tlj}11߉}}7n}u3u3u3pƉu11Ήuunu։U3U3U3U‰U11UUnU‰E3h3|3EE11EEnE؉]3]3x3]É]11Ӊ]] n]ˉh3M3t3MM11hM9nh}3}3p3}lj}11߉h}7nhu3u3u3uƉu11Ήhunh։U3U3U3U‰U11hUnh‰E3|3E3EE11hEnh؉]3x3]3]É]11Ӊh] nhˉ|3t3M3M|11h|9nhx3p3}3}ljx11߉hx7nht3u3u3uƉt11Ήhtnhp3U3U3|‰p11hpnh‰E3E3E3xE11hEnh؉]3]3]3tÉP11։h nM3M3M3pM ӋP!ى! ˋM9ܼˉ}3}3}3}lj} ȉ!׉X!ȉ }Pܼ}3}3|3hlj} #X! }ܼ։׋]3]3x3]É] ӉP!É! ڋ]XܼډډM3M3t3ME ؉!! ȉEEPܼEȉM3M3p3MM !މX! u>ܼ׋U3U3U3U‰U #X! uܼE3E3h3EE !! ؉EEXܼE؉؉M3|3M3MM !X! ً];ܼى׋U3x3U3U‰U X!Ӊ! ڋ]3ܼډ|3t3E3EE !! ؉|EXܼ|؉ˋx3p3M3M| !X! ً|;ܼى׋t3U3U3U‰x X!Ӊ! ڋx3ܼډp3h3E3Et !! ؉ptXܼp؉ˋM3M3M3|M !X! ً];ܼى׋h3]3]3x‰p X!Ӊ! ڋp3ܼډE3E3E3tƉuΉ މ!Ήh!Ɖ ؋uXܼ؉΋M3M3M3MM ֋h!! ً];ܼى<X}3}3}3plj} щωP!!щ }h7ܼX]3]3|3]M !׉! MP9ܼߋX]3]3x3]É]11h]bhU3U3t3U‰U11hUbhU3U3U3U‰U11ډhU bʋhʉM3M3p3MM11hM1bʋhhE3E3E3EEh1މ1Ћu>bU3|3U3UƋh11ʉubډXU3x3U3U‰։11‰Phb]ډދ|3t3E3EX1E1؉h9bNj]]x3E3E3E]11ЉxˋX bȉȉt3p3U3P‰ӋU11t3b|U3U3U3h‰Ӊ11‰X};bډډUӋp3E3E3xNj|1ډ1pbȋU<}E3E3E3t‰1E1ȉH|:bMȋMM}3}3}3XljM1}1ωUbˋ}}}3}3P3pljU3U1ljM1bNjE3E3h3H‹E11؉UM bЉE3E3x3E11EMȋMbʋEȉE3E3t3Ebʉ11E3E3X3Ebʉ11؉ME3E3p3Edbu11ƉƋE0`X\xMlH LPT-6}+8u Ĵ[^_]ËTGUE#Eg@@ܺ@ vT2@@@]UWVS EPEЋMAs EA?JEЃ?v|@)ЉËu<u uyUEHL$$U);Mu} T$4$qڃ@;Ur)]] Eu<u sCtft [^_]äfzuZuAUuLuT] EDE|fE pCfUWVS$gjE}}] -6E܋8}11u1҃‰уTuD$}䍇D$$ C%=t)D$|$$C%=uD$t$$Ut#1у4 uߋE܋}+8u$[^_]Ë])EffffffUWVS(WriE؋}u -6Eԋ]1ۅtX|$}܉<$]i1 F TFuF(}ԋu+7u([^_]$)]ƅt둋]vDUWVShuE E}-6M1ɍ $sD$@4$3fE ES1;1;EEE=TD$|$$eD$|$ $;uE})EUE Eu-0$Rf0D$ $U+[^_]øGџ0$e輟0t1D$ D$|$$$e1sD$$~t΋ptEUyRBeBUD$D$D$D$ E D$E$]UWVStg~fUUEE-6E1u4$DM L$UT$4$ED$4$M+ut[^_]AfffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8XpuH MPUHMpuPUH Mp$uP(Up,uH0MP4Up8u@<|E\EHp@ URl1p1‰x\ l‰T ωh11׉tp߉` 11Eh d11Eh  11؋UPd 11U 11} 11u  11]  11E  11M 11U 11} 11u 11]  11| d1lj!3d}9yZЉX 1!1}:yZd X1!1ڋ}8yZX 1ljd!1NjtyZ  d1ʉ!1΋UyZ Ƌd 1!1Ӊd]yZd  1!؉X1|9yZ d1!1}:yZX 1!1ڋ}>yZd ljȉ1!׉X1xdyZ d 1!1΋EyZX d1!1ӋEyZ ˋd 1!؉d1}9yZ  1!1}:yZd 1ىʉX!1ڋMdyZ  X1!1NjMyZ ߋX 1Ήdu3nd  1Ӊd]nd ˉd Ӌd 1]n dӉ 1]nd 1ډdUnd dЉ 3d|n  X1΋M n dΉ L1ËtnX d d1UnL d 1Und 1ډdxnd  1ljd}>nd 1Ήdu3nd 1Ӊd]nd  1dEnd 1dM nd 1!1‰dtܼd  1׉d!1ω}>ܼ<0  1!1֋Eܼd 1!1d]ܼd 1؉X!1x9ܼ d1!1ً}:ܼX 1!1‹}>ܼ d Ɖ1ЉljX!1ϋEdܼ 1!1֋Eܼ X 1!1d]ܼd 1!1dEܼd 1!1ىd| ܼd 1!1‰dUܼd 1!1ȉdEܼd ։d1!1֋Eܼ d1!1ËEܼ ˋd X 1ߋENS  d 1xNSX 1ʋENSd X׉ 1‹}d>NS <d 1};NSXӉ ׋d 1؋}:NSȋd d 1‹}9NS  1ʋ}>NS d X։ 1Ћu7NS ։ 1t3NS X d 1ËuX2NS ˉ Ӊ 1֋]NSd щX 1]dNS X L 1ʋ]NS߉ H ʉd1|NSL@ DpҋT ы`1ً\}>拢Plыh 1ϋu2拢P p׋PЉ 1E拢P h 1ډh‹x拢Ph  X׉ 1֋}8拢P  1}9拢PX h 1}X:拢Pى щ 1׋M 拢Ph щˉX 1Mh 拢PX 1ډhU拢Ph މh1֋|拢P XЋh 1]拢P  P 1t拢PXh Ӊ 1ϋUX拢PP h1U拢P h Xщ 1ڋM拢P 1щ!1ދM$M\ X h1!1ЋMX $M\  1!щ1M$M\h 1ΉX!1Njuh3$M\ h1!1ˋx2$M\ X 1މ!1u0$M\h 1׉X!1ދ}h8$M\  1!1Ћ}9$M\ X 1h!1}X:$M\ 1!1Nj|$M\h 1!1ˉh]$M\h  1!1hU$M\h 1!1މhu0$M\h 1!1ЉhE$M\h 1h!1t$M\  1!1NjU$M\ h h1Ë|>pm  Љ 1ʋE>pmh ׉ ։X1Ƌth8>pm 1؋}9>pm X 8 h 1Ћ}X:>pm؉ Љ 1E>pmh X 1ˉ؋]h>pmX hЉ 3hЋU>pm0 Љ 1E>pm h 1ىhM>pmh h ыh 1ЋM>pm hщ 1M >pm׋h X1ˋM >pm  hщ 1‹x>pm X 1M>pmh ؉Ӊ X1]h>pm 1!1ЉËEvmz;X 1h!1Evmz h1!1ˋEvmzh 1!ډX1‹tvmz  h1!1EvmzX 1!1ًEvmzh ׉1!ȉX1|hvmz؉h 1!1xvmzX h1!1ˋUvmzh 1!1‰hUvmzh  1!1hu1vmzh  1!h1ً]vmz  1Ӊ!1Ћ]vmz h 1!1h};vmzh 1!1ˉh]vmzh 1!1‰hUvmzh 11MΉ4 11| 11}  11]  11t  11E 11M 11} 11u 11]  11E 11M 11x 11} 7 11u މu d T}wpDw13E] lHىO D d@1ًLu0NS\HuO `ډĴ[^_]UWVS]CSƒ?@)ЋM41s{s{9w[uf}?v/1@} D$$#v@9us1;Es/)EE E|u sltft[^_]1;Erу[^_]ÉE|u sfEuTEuKEUCD$$U)9uEr} `uTu;xfEtfuKu1MEtffmM qHMUWVSL]} -6EM1ɋGWEU?@)ƒw)ƒT$D$<$ D$ED$<$t(OSSs9uݺ\1u.u4tftEM+u[^_]ê[tfʼnj'UE]UU f%f=t1]ÁE ]ffL$$Yai qyD$A(tQS[dKRjjG [1Í&t&T$D$ Zbj rz $z(t RPS[KjRjG [Xt@fffD$$X`h px1Ít&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[JRjjG [1Í&T$D$ Zbj rz $RPS[:JjRjF [Xt@US JED$E D$E$, []USID$ D$ED$$F[]USåID$ E D$ED$$Mq[]USTkID$ E D$ED$$q[]UWVS,/IEEED$D$}|$ ED$D$u4$#6EE ED$D$|$ ED$D$4$5\EEED$D$|$ ED$D$4$5EEEED$D$|$ T$UD$4$55UEt>MMMEM <wE)Ѓ9uEEED$D$|$ ED$D$4$4؃,[^_]8 uEƀUGUWVShG8E ut$$8E @B1NjEEE1EUME1ȋ}Gt$$xx8E @B1Ƌ}E1UBME1ȋuF D$E$`5u(8E ]ٸ@B1E1؃h[^_]øh[^_]$'+8E UWVSۿED$hD$E$guEǰ,@t&tD$E$u܉[^_]D$@D$E$Ggt 1[^_]ËEpD$DCD$4$gE@<-u?EP,DPtEPD$ ED$$U!MU9p9g^My+th)ƍF߃1BD$D$4$ifE@t<+ !M?!UALDE?w°,t u]Ë u@u1]U DEP>w °,]1]UWVS(½Cu}܉|$D$4$)SxFNE uD>wg86EظыE! MD$|$4$R([^_]Ã>w086EظE e{{UWVSCu D$ to"D$D$`E <$蕂y)@E ,t@@E [^_]ÍU T$ t$)‰T$$ 뵍\D$D$`E <$&fffffffUS=vNotvcuu<ɐtg Ƀ шH@}+tr}-tr}=tr[]Ã+t-ut(#MH[]ÃXtguԈu@] X밋M #MH-u P+뮉H딀H뎀HUWVSEu I@Mgt&=-XuUt pguډ%+t[^_]ÀouuPӃt>Mt }#x!t }#x!t }#x!rt #X t #X ރI#H ΃?lP!փ&EjUWVS`F]@u>(EEEE}|$EԉD$$<$h$EhD$|$$EBf~uU)E4$jUtsuփWQuRN>w2MϋMM}R tUUw~1҅ډЃ[^_]É)Uu$^rЃ[^_]ËE$jEUMt>MUt$D$E$RMUk^v J}B FۋrUWVS訟ÿ%DdhpE\} uElEX-6<M1f]9r9f>*uf~*u1f~*@DFP;\XD$lD$ PD$|$\$phdrhfDžHdf8D$D D$T$Rl@ @T $P ``l@ @DfTt4p8`$TЅ$lS t%XYLYL x .& h;pHfKfu9pH@u5l4d#6|%= P\hS;8sfC/fXD$lD$4$pddhfDžPDž@DžHdf8tldIu|%=@tn1ɋ<}+8ȁ[^_];PXf?D$lD$QG$phddf5TэUF9t3狅T$D<``?lpt=1dATDYD$T$օul@ @T@`x .Vxfx.Apf8` p`$@lPpl@ 4Y\f9.k@k\hCSXD$lD$<$pdlP @pDbXpND p+lP 1G=6vDXh/lP DUWVS>U`։ϋUE dE\-6pM1fhl1 fy9v7fFftYf/uڅtQfF/f/u%9wp}+9İ[^_]ftLhl맅t:\D$dD$ lD$T$$h`|ftld‹`u{dP t"\HhHht$f~/t|%=@=t)d@\‹`%11ɍX`JfhhuNX@tSlL$$dP(u|%=@q9v/^uNlL$$udU/.UWVSD轖׉-6]1pf~ fb"f*ff ftFf?f[uZىX!Gf>Vf[ fuffW uAO f?TW рO N;t fx*4f*΃!B f7f/-B9uݸ2\$|$$]+.D[^_]Írfzuf[VpV f f]uf[!u Xf@!Zf]tIډˍKf%f2f-uBf]ifC-Kf%fCrZf]u։ځO Af]mD$D$ D$D$$F6P f9sQfPfu98t6P9fx*P9fx*W ; T$ D$)L$GO$ $3…?D$D$ D$D$$@5nGu^ f[!)Z-efP94NUWVS9։)ӉσXPft:1ff}tMCftf[tHf{uCfuM u1[^_]Å~릍sCf]fu돍ZJf]8t$Q D$\|$4$Dt8t$Q D$Q D$4$-4D$\D$$Cƅ8tщ$7uċPtP >t|$$VuቻQ ?xuxu U+8[^_]ÍDD$\|$4$B.8t߉Q 8#kD$\|$4$Bt8t㉃Q D$\|$4$B8t߉Q 8xuxxu x Q 8sxwx}Q D$\|$4$2BtM8t$Q D$\|$4$Bt"8t$ոQ Q ueQ D$D$($lQǃQ B[T1mǃQ ǃQ T$$puUVS w*Q tutQ [^]ǃQ HD$ޏ4$"AQ uEt$f($&EUWVS vðuǃQ Q t1$ot$Q $tMu [^_]ÍHD$ޏ<$@Q u͉E|$f($E뼍Q [^_]UWVS u uǃQ Q t1$Xot$Q $tM(u [^_]ÍHD$ޏ<$?Q u͉E|$f($E뼍Q [^_]UVSNueǃQ Q t$nЃ[^]ÍHD$ޏ4$]?Q uЉt$f($_1UStQ t$d$ǃQ []ffUWVSDtƲuĉUMЋ}0,E,Eԉ΃UƍFE܅ÍTMDAtEEE? *iVЍL]DS<*u,U܋utȍ\ DNtE<*t݉U].X$d>}+8 4[^_]É4$6t$ D$ED$E$C$5E[1Dž;~2D$$c:T$D$ |$ML$M $D$D$ |$ED$E $9t0;1D$ D$D1D$<$oƄD$D$ |$ED$E$@ƒDž(8-؉DžDžDžDžDžDžUWVS<jEu -6>}1D$ D$}|$$uRDžDž$;$;u+0<[^_]É<$53|$ D$ED$$B$2NX1Dž;~2D$$7T$D$ |$ML$ $D$D$ |$ED$$9t0;1D$ D$D1D$<$lƄD$D$ |$ED$$6ƒDž &8-؉DžDžDžDžDžDžUWVS<g0Eu -6>}1D$ D$}|$$uRDžDž$8$8u+0<[^_]É<$K0|$ D$ED$$8$0NX1Dž;~2D$$4T$D$ |$ML$ $D$D$ |$ED$$9t0;1D$ D$D1D$<$iƄD$D$ |$ED$$,ƒDž (#8-؉DžDžDžDž DžDžUWVS 2dI}H"D$E D$<$$ututЍv [^_]UWVS c}H"D$E D$<$utu6tf [^_]UWVS qcÈ}H"D$E D$<$ututf [^_]US c*;6D$E D$E$f []UWVSbEEM -6E1EUt^Ǻu )ԍT$ MJtJx9uT$E$ o}+>ue[^_]úUWVSEbTEEM -6E8}1UEtoӸ{u )čD$MHtMXʋy;uT$D$E$j}]+ue[^_]ø롉KUSaâED$ ED$E D$E$ΣUS YapED$E D$E$;US .aEED$E D$E$N;fffUWVS `ƉUt- t D$4$!u+E [^_],DPu 1 [^_]É4$蹡 [^_]U` Et8t l1]ø]UWVSXX`o-6EM1ɋED$lD$Ẻ$_R }e1󫍃R EЋM̍R |t:tEЃ9s EЄuR t$TD$Ẻ$&dFD$FD$Ẻ$ dEЉED$D$Ẻ$cx/Eй 2€XR $X1D$:ߙD$Ẻ$`StXR EԉEȉD$D$Ẻ$gvEԉ(R EȉD$SSD$Ẻ$ft Eԉ0R EȉD$0\D$Ẻ$ft Eԉ,R EȉD$KD$Ẻ$ft Eԉ4R ED$K t$Ẻ$bE0fR EЉ$=0EȉD$D$Ẻ$+fXEԉ8R EȉD$ D$Ẻ$eFEԉts4$xD9u n9tg8/t9spz/t9u)ЍpvD$ t$T$W <$ZƄW [^_]þ À8/u 7뱉¾USM ^]>%BU؅7%M EM$U(ED$t$U$M$UED$t$U$1uE t Ex E@MA]؅xM 0< jFE0M]F0< }uJȉɸ)9ȉ|FM]EE0< E؉EE@0Ɖ9ȸ }}1M E]؅MԉL$ ML$D$4$ƉEuM EU$ CƉEEMAEPM1M U$5ƉEM U$c1ɉƉEM EP$ EE؃My uAM U$c1ɉƉEM̅?EHQ)ȍEEMAMEHM M؅PEM $=1ɋU ƉEE M E؅EYE؅EM EP$;1뤉M EMM ElU$'1ɉ}ƉEE-lMAEMiM E?M E؅ZM EE؅CEM E؅)M EnM EU$c1ɉƉEE ME̅t+EXQ)Ѝ)ىMEHE8M EP$1ɉ`ƉEEyMZM U$/ƉEM躓$I)))EHEtE܃  }EE@EE@El‹E)ЍH$I )))ыuȍDU)D+EЋMAME܃ULZDSM؄tE0DV@)ˋE@ @$MH(1EusuEPuuE؅uEPuuU؅{EHQ)),i)\P(\= ף@MAQ @DAME܃z1EDdEsu{M]S3lʋEDH@YEDH@DP@SDP@St DP@uD$$MM)iuV$V(EËM UMEЉAME[Eu؍NM>TVEDP@NM~CV}1ɀ}zEU}z]M 1(NN dJ|EEڋEP$@(E؉EW~}ED$E$0Å9Mu EPtJЃEM؉M}]EMDA} Q)ʍ)M;))ȍOE]DA@CÉEDQ@u1fA1ڀvVM)ٍ)ҍJEMMʋEDH@IK뮋]D$$ME t,MA M)iuV$D$$MEoMuN u6u؉ڋuV$UU 7&,D$ ED$E D$E$]fffffUVS<6U E-6M1tHMȋHM̋HMЋH MԋHM؋HM܋HMHMH MH$M@(EMEȃt'tTt7U+uR<[^]ÉD$D$t,E$ىD$D$t,E$D$D$t,E$蛗UVSu] 1t  9t)ʉ[^]UWVS5ȻE0uto4$xuEpEt';Uu"|$t$F$譗V9UtމuE tH9utFE]E[^_]EUWVS 5%uU Mt;A t+ ÃutF\$D$$ [^_]ffffffUWVS4òD$E$EU JND$}|$E$ƃlE $fELǜ;60t6Eu01[^_]ÉL$M$U#UM $ tE $WEMʉNjusStftM|=Eu stf`Zu@u'ӨuEuP똋E|fE밸xUf`UVS 2ɸE UtuD$E$` [^]ÉT$D$E$ƅt$Tt01 [^] 1뼋E [^]UWVS,2CE 0E,}-64M1Ɂ}D$D$E$-H@hDžDžD$$蹻D$h8$膼hǀPǀTǀX84$8Dž@fDžDUfFHDžLTDž\dDž`DžX|$ ,D$0D$4$WDžx 4$u4M+u8[^_]ÿ UF0aUT$ U T$,D$E$]US 0)ED$E D$E$E []US/ED$ ED$E D$E$-D[]UWVS/þu}}t}D$4$4$'F0tN@9t $iF0ǀǀ FFV Ш\}UED$ED$4$HU …tIME 19tуM}tIfV M N~MtP~IU}<$E U 1ʀ뢃fV M N~UFEH+6^ D$4$E[^_]ÉUF$2U\}1EfV FVCVFD$4$E[^_]F߉~eMU<$E UMt19tU $MvE MUui4σUWVSN-eMD$ $MQ( $MؿMA uoD$ D$D$A$MQ(Ɖ!ЃMt!A t?A)׋A0tA<)D$ $}[^_]ËqPyTut֋t+AD$ $CUVSO,fuD$4$V(4$߾F D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$EUw0E[^]ËVPNTUMutt+FEUTD$4$D$4$UWVS+*E8ep >EFt$V tQFtB1ɉωMT:0$V T:($V D: $M9NV w$F,t${F4t -$gF8t$X4$P[^_]UVS%*<x4$|[ D$E$U4$_[^]UVS)x4$7[ $U4$![^]UWVS)øx<$[ D$$YƉ<$ٳ[^_]fffffUWVS K)buED$@$bED$E $vcEt9t$}$Mt$u ǃtt$$)uEPut$mEE [^_]UVS(ü4$\ D$E$b4$߲[^]UVS`(w4$跲\ $+b4$衲[^]UWVS!(8<$x\ D$$PbƉ<$Y[^_]fffffUWVS$'E°,:}؍]]Љ]0E E1Hڋut^}u 8}|;ЉEuEԍ]9tiwa.EԉxA0kPу߀Xt_EEU}ufuE܅u$[^_] f҃a)߉OPEt ‹uDF@tEԉ8HU)уwt%1 ؃9u뉍u9ux11rUWVS ,&CD$"D$ƀ,<$E tED$E D$<$LD$$ E$YUS%̫,UT$ U T$D$E$gfUWVS %EEt-\u [^_]à tF [^_]U U^E} ?U  ЋuE [^_]E T,Eg} ;U ,DPEDBE u'} B} 8U ,DPyE 0uE EE 0<MEu DЋuEE} #E11ۀ} ;c}}} dڅt<|7;}3;]uЀ}N} -.} ^tEEE T,NE 0u ЈE } z=3 huE EQEEu } \Et } %Et } &Et } =uE E T,ZE 0uE U ,DPuE $0E 0<Eu DЋuE7u VnwKEuڍEuE °,u DrSuM uE 0uEEuunuuZuuFu\u2EEEu uu uu uu uu uu uEc"dhEe[d8؃7t&E 07Fn,WIuu,W7E E1"EEnE [UWVS,Ƶ} EEEX]]UU؍MM܉ىEˋE)؉EED$ E؉D$|$E܉$Pwqً]EE@tn륉ً]CUÃЉEcUЃ,[^_];]tdECb5Ѓ,[^_]É߉EC~EtEt +]덉v tUED$ E D$D$E$t]UD$ E D$D$E$H]UD$ ED$E D$E$]UWVS΢M@\ />3)Ѝ)Ѝ4>~ 9O$#H\  $MMt0O$wD$ D$4$[^_]Åt1O$wL$ D$D$ 4$M t1[^_]ËĮM$ЃH\ MWH\ u$ĮM$ЃH\ MM$(dljM $M>0[^_]Ë] t OwǃH\ 0\ *MD$$=Ɖ@\ MGǃ0\ ǃH\ EUWVSҠM<\ ))Љ)4>~ 9O$#D\  $MȮMt0O$wD$ D$4$[^_]Åt1O$wL$ D$D$ 4$M t1[^_]ËԮM$ЃD\ MWD\ u$ԮM$ЃD\ MM$(gljM $ȮM>0[^_]Ë] t OwǃD\ ,\ *MD$$Ɖ<\ MFǃ,\ ǃD\ EUWVS՞uE$ƅ8\ ^uE1ɃP9u/>3)Ѝ)<7>V~2T$UE$xUu;V$] [^_]ËH\ uĮǃH\ D$ ED$$4E$@F$] 1[^_]ËH\ uĮ$ЃH\ $(dƉE$ts@] 1[^_]ÉU$ЃH\ U=(\ uV~2T$UE$pUu;V$] [^_]ËD\ uԮǃD\ D$ ED$$,E$̮@F$] 1[^_]ËD\ uԮ$ЃD\ $(\ƉE$̮ts@] 1[^_]ÉU$ЃD\ U=$\ uf.11~fUWVS }<$ `\ $E쉃\\ ǃX\ Et{,wE}UWU}:uKxpu<\u$JDK@tÃtDK@tB<:uEЀ}:t}uPE1 [^_]Ë\\ t$ǃ\\ ǃ`\ 1 [^_]^ px8UVSE] :tu1҉[^] 8u4u u݃}:t@1;UuЍPx@tΉ[^]Ã8t̄u@t}:ǘt:fu‰[^]U3 NUخ]UWVS}u 8u u|t3:t.t*9vv :t|tu[^_]1UWVSh ːU -68}1}!0Mu$\\ tT$4$,f$"Dž9DžUD$ ]D$D$4$D$D$ D$D$@4$D$D$@$=EjDžDžƉ19vhpȀ W:Dž\1҃ t t DžO;>9wD$D$E$-'؉؍pȀ Q X@<#D$<$خbDžD$=D$<$Åu<:BuED$D$E$ C:{DžYI@E<$Džj:ߍO;))|$$./ljeDž<:tu)>|>:t:)ȉ)‰+99)؉D$\$$g|$t$ $g$zzO11cC_)Љ)Ћ))ÉT$$‰‰ÉtE$+)P9rX8U+h[^_]D$ D$D$E$D$<$<늋`\ $Džst$$nDخuƋ90<$D0DžNju*$E$與ËE$uhƋ<$$D$ \$|$4$V tWu$Dž4$VDžPu#Dž묉$H $DžtxL$T$$c4$Vx-18 0<$nտ0Dž4$V賿 Dž<$uzu $u)$4 <$E$Hċ8bE$*pUUD$ED$$M E]US4KT\ t$ïǃT\ ǃL\ ǃX\ ǃP\ 1[]UWVS,EE -6M1DžL\ T\ ǰ,H\\ tX\ D$T\ $8D0Dq@:#P\ ux|\u ǃP\ ύ:\tWut$T\ $7lDҀ|\tǃP\ ǃP\ T\ $wƋT\ $ǭǃT\ L\ PL\ @L$$AT\ dǃL\ ǃX\ ǃP\ f:wʄt <:tBt<|uD$L$$~ƍ@M+,,[^_]ËT\ $=ubT\ $蓬ǃT\ +L\ T\ 6HD$L\ $T\ SYT\ t$ ǃT\ ǃL\ ǃX\ ǃP\ ǃX\ ]S$ΫǃT\ <ǃL\ ǃX\ ǃP\ ]UWVSu} T\ t$kǃT\ ǃL\ ǃX\ ǃP\ } u[^_]UWVS|Ó]D$=E D$E$$d2ƅ:Ed\t0:tY^tU^uW:tGtCuЋM)ˉލCdD$ $]cƉEd:u^u)ڍ{EM[^_]WU:t̄tȍOMJЀvMB2wTɋ}싔dW0UWUU W0ҍ ʈM} } } } }}:}}1T$4$]eE4$]}QE$]d]辷 UWVS5]D$=E D$E$6$dƅ<:d <:tCZt{u)Cd]D$4$]kU‰ƹd<:uЉƍX)Ӎ{t<։\$4$])…u%4$]YЉ)Ӎ{uċE[^_]1뫿4$]ы]o UVS D$#E D$E$0<0tP 1F<w1F9~ƒ1F< w9E1 [^]ÍF<wFqs;u/uƄƄft|뤍L/>:@O 1ƒ ue[^_]øTfffffffUSMdxD$$,` D$ _$&I` []UWVSLxuu؋} }ԋEE-6EЋM1ɍD$$8` u}MfMUT$U܉T$ D$ ut$$R.u} v M܋9c} u ` tM؉%9` t1EЋu+0ЃL[^_]Á} u ` uD$D$ $VƅtEĉ4$ZBfxHuPP}3z$M3J u֋M3JʀuɋPD$EĉD$$U賢DžuED$UȃT$Ẻ$趤9Ev % ЉD$D$ D$ED$Ẻ$;E҃"A9FAf9F1҉UȍQ Mčwt$D$U$薅OMU|:9I9ur?M̉ωփs6tf[UU؉4$WU="3MuuA q EfPUS 'uD$\ \$ ED$EU $T$u؃[]1[]UVS<tUE uEEEHMM@Et7EȉD$ED$$uẺFEȉE܃F1<[^]D$ED$$贃<[^]Åt"EȉD$D$$蒃t<[^]D$D$$oUS,sEEEEE܍ED$E܉D$$VpuE,[]US,ÝsEEEEE܍ED$E܉D$$puE,[]US2IsEEEEEE$o[]fff=̀rS[s[ḽ̀rS[r[̀rS[r[(̀rS[àr[L$S[Ær,[t'L$̀rS[]r,[ 5US "9rD$E D$E$^ []US rD$E D$E$l []USqD$ ED$E D$E$>^[]1UWVS}Ôq}E 4M0M(-62u1,hEED$E$JuD$h8$vhdžPdžTdžXfDžD8H<$D$$D$(*AD$4GGPt$89t$4PD$( L$L|$Lvt$H$D$,D$lt$\|$L|$d QՀMwEҋ0|$D ~0d$\?PT$lGGD$ll$Lut$\ƀ$Pу߀XuD$lD$dD$$8D$lueD$hD$ D$DD$D$D$,$o ы|$<|$<{@{D$TD$l+D$,D$`D$@OT$0t$DrT$DT$\&ҋt$,T9 d$\D$DT$\@փ濁t$\T$0t$DrT$Dt$DuL$\D$DT$\b?T$\[<$ht$\D$ljqXGGkP;t$8 @‰T$$L$4ƋD$hD$4$IL$4T$$D$LD$ D$$mq-q-GGQP;t$8 PL$Lt$L|$$mL$ T$4L$hL$4$躖T$4L$ DqWBG P;t$8^ PL$LD$$D$(q+Gqx1t$Lt$\|$dD$L)Љ<$荊x G9w݉t$L)ȋ|$dGʉt$`D$h$3D$$D$8$D$,<$&';t$8D$Lt$LIqGG@ P;t$8 @‰L$LD$(D$LD$ L$\<$誉 L$\;L$8 L$4)D$<L$HD$<1D$4D$tD$,D$hD$D$d$Z…(D$LT$8D$h$9T$8T$(T$dNL$84j|$t t$4D$hD$D$,D$ L$8L$$t$D$H$ǪT$("N D$HD$hD$$蹫u>L$8L$`l$LL$\ D$HD$8D$dPt$8t$,D$8t!ƋD$dD$F$ 9t$,uD$\D$HD$TL$\<$) L$\;L$8 L$4ЃL$Lt$L$D$LD$ D$(ʀ|$$ @D$TL$L<$蝅L$LT$89T$4D$(rL$4<$hL$4;L$8D$ D$LTGIP;t$8 P^D$tx< t< tED$<$>p<$MAE @(MAE1ҍEEtD< tH< tDE @H9tS}BE4ED$4$H>tpUuE4 먋E4E([^_]ÉU<E xED$|$E$}M蝂}E xExUZ<$MAE pt:EpvHD$@$M +1([^_]ËE @ D$D$ E $ }uE @MAEˁ0E t$rE E @t$1E @@E @t$E @E @a01&UVSHE$ ML$ M L$ML$@$Ru E[^]É0E[^]UVSf}H,$ ML$ M L$ML$@$Ru E[^]É蛀0E[^]UVSHE$ ML$ML$ M L$ML$@$R$u E[^]É10E[^]UVSíG,$ ML$ML$ M L$ML$@$R$u E[^]É0E[^]UVS)@GE$ ML$ML$ M L$ML$@$R(u E[^]ÉZ0E[^]UVSF,$ ML$ML$ M L$ML$@$R(u E[^]É~0E[^]UVSRiFE$ ML$ML$ M L$ML$@$R4u E[^]É~0E[^]UVSE,$ ML$ML$ M L$ML$@$R4u E[^]É~0E[^]UWVS$~ǑE]ESt u $ ut$T$UD$ D$D$@$QU싀$ t$T$UT$UT$ U T$]\$$QHƅuE$[^_]Íu븉A}0E$[^_]Ë$ 1ҍuU薾D,D$ED$ED$ ED$E D$E$]UVSSjDE$ ML$ M L$ML$@$R8u E[^]É|0E[^]UVSD,$ ML$ M L$ML$@$R8u E[^]É%|0E[^]UWVS艽àC!D$"D$ƀ,<$JEt8ED$ED$<$|$ D$D$h$HE $͓D$wD$$E$}US߼BD$ ED$E D$E$/?[]ffffUWVS<藼BÉEȋ}u t$E$c/EąE,Euu}EEEE t>  t1 E] U}#]#} t]!É]܋E!ЉEE܋U t1҉EЉUԉNjU̅tEvw E`E@iEЃUBftEЃ0<Eąu tEtJM\EЉ0҉Q0A0y AE؃E؃<[^_]E@Uǀt MǃU؉<$]谍U؍JM؅^@zE@uJ4$]蝍uM tHFv@E %Fv. #M؍Q\aE,DptGE؉7E؃<[^_]ËE\@tEE\@bEE\@nEE\@vEU\B0E0<UE\@aEgE\@sELE\@fE1E\@rE-z<$]E@0@ 0EB?E\xEUWVS۸>}U EEuEE tu$UUtT t! tT$U$q+Ut==GG W[^_]ÍB߃]wʃ=uËEEuEEU }[^_]|UWVS.>}u EEEEEE4$muF_tAN߃ w ?u.%$GG W[^_]ËEEEEEEu }[^_]UWVSrÉ=ʋEE-60u1}}fEuD$$̈́D$<$规|DžE %@ 1)tnu䋅D$ v D$T$<$蒉x9G hu1DžO+;uvu$sD$$R.p 1󫋅t$< 9uE t?*HHE t`'`HE t E t E t E t "E @u \E LE @ L$L$ U T$OL$$Ѕur$$$$ԅ}+8~Ĉ[^_]Ë$览\ 1󫋍Dž,򋽬);\$D$$肆…lj99ߋtft@Dž1Dž tr1 t1 !! tߋ;!ȉ!؉ t1ҋ;Dž9D$ <D$D$$ޘ$~…j9(떸~D$ D$D$$~ <$u2t0,1,ыWыWD$<$}{ .Dž^tt$$$$/qP+f#1{9m hD$ <D$D$${D$ <D$D$$QDžDžAqUVS%44EE-6EE EEEMED$ UT$UT$$1MxEM+ u [^]1dUWVS読ƹ3EE-6EEEEEMU ED$ }|$}|$$xEU+u [^_]1UVS&=3u t44$HkD$ UT$UT$$1ҍEi[^]1UVSԬ2ut54$jU D$ ML$ML$$E[^]1UD$ ED$ED$E$M 1ҍE]UU D$ ED$ED$E$ME]UU E D$ ED$ED$E$MEu]UVS1EE-6EE EEEMED$ T$UT$$1xEM+u [^]1- UWVSkÂ1EE-6EEEEEMU ED$ |$}|$$xEU+u [^_]1 UVS1u t74$iD$ T$UT$$1ҍE.[^]1UVS虪ð0ut84$hU D$ L$ML$$E[^]1UWVSBY0}u t74$[hD$ T$UT$$1҉z[^_]1U/D$ D$ED$E$M 1ҍE2]U袩/U D$ D$ED$E$ME]Ua|/U ML$ D$ED$E$ME]US $;/EEEEED$E$,E []UWVS$ި.DžE = t>gЁ$[^_]ÍƍrD$D$ t$|$$` 1ɉ 9FD$E$D!u؉G} t9;4$yЁ$[^_]Éf8 uf;t<$y$UqDžeWPUE D$E$]ffffffUWVS-ƃ ‰ ‰ ‰ ‰ z|$F$utF~1[^_]øUWVS胦Ú,9H rt~t PRuF$D$ D$L$M<$!^M΃t ljډE:BGuETB[^_]ÉUy(MvdED$|$F$n_MRdUu ~ MFЃ[^_]UWVS补ø+ljօxlxD$$CtU3W4E3G0 u|3Wi1[^_]Ë@$$bG$ t$G$<$h[^_]ÉdSU0G${<$ht5U0UWVS蜖ó}71G(%VLfFLNHfu.$`hVDFLf"97DvuȋPU$"hUzDWMA(AD=G( My fAHΉ[^_]ÍQfSfu@t\V8N<3O3W tLFJGt uƉv$guuGfFH O(1[^_]ËWt+tEG(u։v$>guuGGGG)t루N2nwG'G(fuG$sEF,F(NTD$ML$G$D$/M $VYt;9EP$UR@MD$UT$E$}MN,GFFF8VtxG MQ T$$tˉ}ӋMEAA$KMA E@@eEtG>uuE$vSE@ EjE $D$@E$ E EMH ?^?QUWVS }G $Rwt6$RuG[^_]US谀E D$E $[]UVS8{Òut&z== =XUT$U܉T$U؉T$ D$E D$E$V=t3w <Ef>@fFE܋UVtfNȃ8[^]FfFt׸E@EÿE?EEEJ1ոfFFfFt{FfFeZffffff̀rS[0[UWVSljEЉΉMމuEtME9UEs7lj։u\$4$U~  HS9u+}9ur͋Umu[^_]UWVST|~Eu }Z E EE̋}}G$]/HEąMEЃ~)֋]ދ}߉}E$MučDMEED$E$U1ɅM9}EEu؋EEE؉E܋]]]9]?]ԋ} ]9]vE؉D$$ׅ;Etډߋ]ԃE؉E9q}ԋ}؋u}؋uUUE;E]+EE\$$UU9tʉ+EEĉE؍G~}u؉M HZ;EuuE9oEɋE$MEEЋMEĉEEEċE9EE$]sN1T[^_]Ëu؉} 9]vIEËE]V+uuĉ2}uڋ}lj]XJ9u]9]wu؃uM9MDEЋU;EEEUBEMċ}9EMȉUM܋Eȃ+UUU;EzEȋE+EEE؋UԋM99U]\$u4$UuE؉EE}Ѕ}\$E$U;E~~9]wދU9UM̅U܋E 9wMA9EE܋U܋EM9uU܉EM9MU9UE̅}܋uEԤ9wUBM9)E܋UE؉EM9M>E؉Es}؉u}tFEM9rD$+E$UE؃M+UUĉU؉M}uً}}EuƉM HZ;EuM}M9{Uʋuދ}9u\މۍ9EvljD$E$U;E܉߉19}E9}s0u9us<3|$E$U;E}9uruU9Uu̅U܋E 9wUB9EE܋U܋EM9uU܉EM9MM9M3U̅gU܋E]؋ 9wE؃+EU܍DEEE]EԉEE}܋u9wMA9r@)]]܋uEߤ9uu]]X]+]9w ]E뻸\$E$U;E΋EE9wÉEE;]v)1uE<|$E$U;E͉Ӌ}܋u9wMA9r%)]]܋uEߤ9uu]]ָc-EE}܋uEؤ9uE+EEEEEM9^EċMMĉEU܋E]ԋ 9wMAU9r Ѓ)C9/EԉEE؃Un1T[^_]ËED$}ĉ|$E$]y}EĉEEE4UWVS uEuFEt,~^tH1ًP1 uV9P u [^_]$]?t"N^HXVP }8F [^_]ÃUWVSbuyud5u [^_]HF$$4$5NjF$$[^_]UWVS u }E wut6tn9ƍvuVFO9N uO1MO1 MtGD$ T$D$$&GWG1D$<$#tG9F [^_]fffffffUWVS[tru2EF9FvF FD$ D$D$$&FVFD$F D$$Ft|yjfV21EtKV uzN)9FJ u M Pz u F @Ѓ[^_]F BF1]11UWVSLsc}d5t2G$$D$<$ƋG$$z[^_]D$<$Ɖ[^_]UWVS rR1EH1d50E@$$ D$E$&ƅP } fFE@$$0tlEM 1 [^_]D$E$ƅt[P } uduMJ0u?0}8눋E@$$%0uL0}8E1 [^_]ä/Bftf / fRE x0fE xfff̀rS[[ḃ̀rS[[UWVS$pòEEE E.8D$D$ED$ ED$D$E$t 1$[^_]É.8 u.81$[^_]UWVS@p"}ljӉMЋMM̋u MUUȋE-6EԋU1ҸQ)‰U܍)lj}ظQlj)<)]؋U܍<Q))Ӊ]}u}u|EԋM+@[^_]Åu E܅1M؉D$]ӞD$ EȉD$D$ }<$5M9r 똃9tPu}t]܅M܉\$]ӞD$ EȉD$D$ }<$4M9@ 91Pu}܅tcd}܃}~Wd]܃}9sQ-Em9t@u<}u}t&}uM؋]ۉ\$]ӞD$ EȉD$D$ E$3M؉C]>UWVSymÐEMME EEEEE-6u>}1Etuxu,u;}tX֍VFtC<%uEDž|1ɉx}rBu h[^_]莨+̀ffffj̀rS[[ÒrS[ð[UWVS{FÒ}u t$<$u 1[^_]D$FD$<$耈tۍFD$<$€tȍF D$<$诀tD$D$D$ FD$t$<$zfffffffUWVSE]}E 0|$E$蚀t?;}vE8th1[^_]ÉepuWUD$$]ƋE 0u(]썃 D$ $螤1뚅titn1ۉ}߉ut\$E$]9}wUZEE $]E E6tu#EUWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVSBDYu -6E1Vt(.E+pЁĸ[^_]DždDžhF\DžTDžX)V\f8DžllD$`D$ TD$XL$U$$…QD$dD$ TD$XL$E$…hL$t$E$‹\f8\dP\p9\hD$t$E$f\P\wDždDžhF\DžTDžXDžhhD$pt$E$eƒq\D$ hD$D$4$"\D$`D$ TD$XD$E$A\6*ffh̀rS[À[UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS ?u}F9r+)F|$E D$F $~  [^_]1 [^_]UWVS ?ùu}F9r+)F|$F D$E $軡~  [^_]1 [^_]USa?hEU ]uHPP UP[]Í@fUWVS ?"}u t$<$~t t&t 1[^_]Ãt$<$~[^_]ÍFD$<$zt̃t$<$z[^_]UWVS>â}u t$<$.~u 1[^_]D$ FD$FD$<$~tԍF D$<$}tF t6u$FD$<$Zztt$<$Gz듸[^_]ËFE }F[^_]UWVS=}u t$<$s}u[^_]D$ FD$t$<$}[^_]US z=ÑD$E D$E$}} []UWVSF=]}u t$<$syu 1[^_]ÍFD$<$|t~uD$D$ F D$t$<$~UWVS<}u FFt 1[^_]Ét$<$xtFD$<$A|tӍFD$<$xtF D$<$xtt$<$xUSB<YUE JttH[]ËJuL[]ËJ t't@H[]RP[]JHRP[]ÃwJ JHR P[] | q f[@HFfffffffìrS[`[v̀rS[@[VWST$L$1t8uЄt`B͉ t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^UWVSMu tSY99t=PutC{tP9utCE[^_]É1Eu1E1[^_]ffffffUWVS$9lj-60u1D$ t$T$$@c 4$@;EwDUT$t$$Gu%1M+$[^_]øE @O)D$ 9 D$D$4$<L;Mwσtft%D81= 3D$ 9 D$D$4$BwO 7t$$* tG$b,u?u&9O 뗋GfuUWVS7ǽƉЉU -6M1ɅtA~t7/u+0Ĉ[^_]ÿۿDž9 EFfEfD$ 9 D$D$<${<$;E@ED$|$$Nu5F~uN uF=tu ~tME}}0D$ t$T$$\_P4$;EwdED$t$$811Fȉ<32$`<]<fDžEYT$ L$D$$/8<$;E=ED$|$$$_D$D$D$D$ D$؍ DD$$PtQ0I% ED$E$F <etNtu:Euۃt?ED$ D$T$$ ] ED$E$BvUWVS8&3=uU EEEE܋}EE؋E E-6ME1w^~wXN@ vDt E؅tFu f~(VN'}U+8[^_]ËEM+EԉEE؉E} E܉EM8[^_]yvt E؅*Mt U܅ 1댅t E؅FfVT$D$ [*D$E܉D$E$Džxi9}vdFutF ftV ff҉T$D$ - D$E)D$E8$U@Ux_9EvX1EtE܅uMD$  D$E)D$U$UUx 9}SEtUEE܃iviD$t$E$-1FT DD$ 9 D$E܉D$E$dx9Ev1t&FD$  ƀD}pEԍ& M؍yxMЉu EЉT$D$ E؉D$t$ $MM9)9}u1fэ~ȋE<Ήuԋu& M؍yxMЉu"9M)ƃ;}tGUЉD$T$ E؉D$t$ $M/yVFD$ 9 D$D$EEԉ$Eԉ$^9EE؉D$EԉD$<$aD$T$ [*D$E܉D$E$?膐UWVS<.شljE-6M1ɋG ֨uI<$Ytpt$<$Zt㋅9Fu؋tD$F $茧u6ffd$L@=v1M+ P<[^_]ÍAƅffD$ L$D$$R2D$D$ D$T$G$0jA;)ff9t<B9L$D$B$ D$ T$t$<$FtVuM%M]\$ ]\$D$$7t@M땸-V룸 1뵍YUWVSƉ׉MJD$A M$…tKX MH FBF B FBFBZJBB!G_ ߋus%uu Ѓ[^_]äЃ[^_]ftuu fUWVS &&8<ʋEE$-6 0u111  r} !} t } 0<xf@fPffЋ<ȉHQ PD$ T$ LPT$D$ $'cL8@ u+D$L0ЅLDPDP} t!} t} t@Dž6$L=L(Љ@ύALQP9H?DžDDžE, ;P1LLdP9HRJ,@)lj|$D$ PD$HD$<$aƅ8@ u@$0ЅP4$4df(F$"df4F$dN Pf4(4} } } 9U "Bvq'tlH $xNjE $x$y|$t$D$D$  D$D$$%4P1ZQc1 }+8 &[^_]Ã7D$t$ PD$HD$<$_…xH8@ u44$0Ѕ4t!P4$P9| } 19Dt0d@pT4~ HPL@@@11LrDXDž\Dž`LTtDžxDž|$8$4u+D$PtpDP;GDfǃ~ HfPt(ЉfHtuϋHfPu؉x~P`N04(ff!cfT(@D$$(=H 󥋅@D$D$ D$D$$%@D$$=y4N PWP @<$$VV VVVVD@` 9uP‹A@u4P'1Dx?$^H+$$xF}(@D$$(4P14P <@ff]01$FF FFFFf(@4$D$NN NNNN(@@k$FF FFFFP4|$t$@4$4Љ@1\鲤P$\f4F $[f(F$[fFPD$t$ D$HD$<$XDž(8@ P4$=$Dž44((D$t$G$4 (Dt9 u7t t*DD14$X5HDu (0…t+49 ut t؉:11[tUWVSlíƉ-6M1ɋ$N%$411 rFFtH@FENRYX1ɀ.уu;P1.d9.6<$1ҋND$F D$F$Ƌ@ut0HT$‹@ D$B$tF$$}+8Vl[^_]ËqD$ D$D$<$"(dPGGDWDDžDžDžDž<$O<8=t_WG t HW$S$EDžG GDWDDžDžI<1$@<E6d9ZDž<$1ҋ3HVG GDWDE%1oY<$1ҋbW<$1ҋCUGtGDWDE+hU8VU $\8UDžUnUWVS Ehp@`t%=mDžthE11҉ rMd11҉`d r`VtA<$]TRTt[^_]ËhMEEdUMEE$Ju\11 rU؅t d<$E؅PU[^_]ËhMEE끋hMEEe`F:Xl}\1Md1҉ rGTdHpPkL9F\D$ PD$D$`$'"hL$P T$ D$LD$l$l1xSE11҉ rlUEE!$Xl$6;T-XduDX$#E4 \i |‹dC뭋HA‹@uH_UWVS@ ÖƉU܉M؋EEЋM MȋMM-6Uԋ:}1 $U؉$uxNtq`} tB9u}܋UML$Mċ}܉|$$/MċUt#1EЉ81}ԋu+7q@[^_]1F;tBDž;Ẻ$1ɋU؉r@u둉UML$MċE܉$)MċUhMUčvD$}܉<$.,<CFU;MtDžẺ$1ɋU؉uu`@uWEVwt$<$uEEȉ$i‰GE뻋Eȉ$i‰GuiUQ\Ew ]Í]UWVS/uvGt$<$ u[^_]UWVSEhE tExEl-6pM1ɍ1󫍵1҉ r`11 rhxPu x3Dž| $U1t vGt$<$ulpM+/|[^_]ËtbDž|DžDžDžttu7Dž$t`|Tljd\ t1҃tTtP9t GtFuBG9tGt/tu'W9Gt bh* Dž|T`\Xdt# t1҃i9]F9V@N9tu tDž$t`e|9tL$`D$hD$\D$XD$ QYD$D$$sfzDž|tEdTΉvWt$<$udT GtDžuxtxFF1҉@уu􉍜xKD$$-DžD$D$|$ D$D$4$ tx$Ft$$+lDž|muu tu th$t`` 9udr@D$%h$[Xlh $a‰HXh)D$L$4$t`|dpXLD v~u~XxMG<a$_+DžDžtPG t7Gt1H11 ⋍ ։?u$)1H$Dž|BDž|hdTƋt0fǃ~ $1ɉvxFtuËF@fu뾋FbDž|$ D$D$|$ D$D$4$kȉQH9wO$PAxrHH9s$pDžP|0@BƜ9]GGPHH HH H@FF|t <DžDžDž 1D$ D$D$<$z$1ɋ|~D$ D$$1Y…D$D$$z~D$|$$)F|HF<<tFDžt19vDh9K2Bt⋵ht9s 9r.$zyAOD$ D$xD$<$tp)0J9uB$t/0PtV2$0Pu$FDžDžFdT|l1hVDžtuH1׉tD$ D$D$$tT$D$Ii $袥i\NxS$IUVP2$^0Pu݉UWVShTkyE֍U11  r1UEEED$ E$}HMED$E$l3Pt+< < ED$$qluȋFE؋FE܋F EFEFEFEFEEED$ EԉD$D$E$tt8EEEESkE Utȉ։vt t$U>TFUvu׋EtMA‹@uUEz}Љh[^_]ÅuUWVSpõwuE$&E~u11 rGtfEEEEE$ML$ML$D$ ED$D$E$&t}EЅUp[^_]ËE$%MML$UUT$D$ ED$D$E$&t>E$Sp[^_]ÉE-tFE$bEԋGE؋GE܋G EGEGEGEGEEUԋEyEЉƋ@uh8UWVS\ v-6U1ҋSD$ D$ D$ $ƅ8#3D$4$iD$4$hxDž< < D$4$hxt$$t띋BBB BBBBDžD$ D$D$4$X~#|$$?u@HD$LY$11M+uy\ [^_]Ët܋vtHt$OFu܋vGt$t<$luzNUWVS4+FsEȋEE0xU11  rŰ]ȍHD$LY$?EЋỦӍEЉẺEtCË@uEuEЅt $]CEU4[^_]UVStËruD$F $"tP PH p[^]UWVSD(?rU-6U1ҋ@ ut$Yt$$dtӋD$$dtD$F $du[$蚩=w;$t@=wЉ=H1M+ yD[^_]Ë~D$<$dtu狵11҉D$ |$D$$Ѝ|>rtftD$D$ GD$D$@$&9pt89T$T$$6i<T09TN 9- |9;u׋D$D$$uL$ D$D$$S)uurvBf;JUVS zÑnut$F $uE $MUF t [^]ÉE4$LE [^]ÐUVSÉ1   lLLLL9w[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1ӉU1ًU䍔2L*!3u ދUȍB91UԋM q11 ‹M"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1E u_MOUW T[^_]UE@@#Eg@@ܺ@ vT2]UWVSEP?ΉM} 1ÉPHʉP@)N9rcڍ<u usukPE+U9UEƋ} ؃@;Er)]] U<u sHtft[^_]äftt&u^uE_uOuW] }u|7}wfu SfUWVS æeEE} -6E0u1Wu5G?7w}8)‰T$ D$<$D$t$<$EX1u7u=tftEu+0u& [^_]úx)끪Wtfd@UWVS(ǹd}Ћ]E E-6E؋0u1°,:}DWuủu<051 I1҉}KMHɋ} Otp}UTyċ}toE+E̍H_(EԅtFʋEԉ=}uOtJ fɃa) yHȀ_1E؋}+8([^_]<.cEu9tԁw̃u܈VEXPЋ}DWt<0Cƒ߀Xt>1҃o}DG@YC1s:E  EE M EM ]>U ED$E$u ]ËE]fff ̀rS[ b[UWVS4bEċuűU -6E1Ju5  t8t+E̋u+74[^_]ÍuЉu11ۈEËEȉ4 rEËuč`JۃDЃuEu 'tɃL " u+Ep1i]<UWVS`E4M 0u,}-6U1ҍhEED$E$dD$h8$ehǀPǀTǀXDžDB$#8HDž@DžL|$ ,|$0L$8$蛸ǃt>8GD$H$薨t4E+u=[^_]ËHt$襫4 ;U]x_UT$ U T$,D$E$@]UED$ ED$E D$E$]U_UT$ U T$,D$E$]UWVS$^u4$uE荓4jUEEEEED$,xX<$uE؉D$<$eD$<$"u $[^_]UWVS.E^EX-6TM1D$D$$:ƍ`$1D$XD$$PPT$D$i4$q4$t'D\pTU+İ[^_]\\$xh\Pt_6tU~ tu틅XD$F$_PuGXP$xXg1^P$ST1>t8UVS\Ƌ@0$趨F0F($褨F(F,F$苨FFN D$h$Ft N 1[^]ÍHD$}$xt N 1[^]øUUB t B 1]É](UVS[uF uu,F [^]ËF$FF F tԋ$8F F [^]UVSkÂ[uF ujtfF0$bF0F u>D$D$ D$D$$F0؃[^]Ë$f 벸US] C t1ҋM ЉC []ÉC UVSZu4$F$訦FFF0$菦F0F($}F(F,[^]UWVSD[ZE@0VU UT$$M4p< t< t򍃎XD$4$MPU4$fU BЋUP ExE xED$$UMt_p1tG< t_< t[E@P9t[E xAE4ED$4$Mt1pMuE @<} [^_]Ã둋EV$ED$ ED$T$F$i t+1[^]ÉatF F$F 1봃F$ED$ ED$ED$4$c[^]ffUWVShTD$D$}Љ|$ D$D$4$AEЉ$lEąD$D$|$ ljD$D$4$A}Љ}9EfEE1Exu7P u%Mftf9HX^p u~9EwEEEuE$虗EE 0Mω}t$D$lj$r}UfEzu4B<<u$Eftf9B]B %Ef9UwEĉ$6MAu9wAE01h[^_]@tfH fMEuh uȍLM9EBu=fE9U#bfE9EbB fEu11  r}}؋BEE΃FEtfEtuDE}ȉ}E<vtft}a}ȍDEr!E9U.mEE$蚝1h[^_]ËEEĉ$|1h[^_]ÍP UE1ɉ֋UtE6փ u11ɋUEuutƒ u؋E9EE؋}GE܉GGBGB E1ɋ}tƃ uE1U/tkHE EtEut_t/ƒu}ȉ~utftExu}ȉ~ utftEȋ}O yBMO7U}G E9U}MuEȉFNjMr1Et1fEt1}}ȸu}ȉ~Eru'u MfmHM뿋Eĉ$褚USxÏNE$}[]ffffUSMdNED$E $[]UWVS$!8NljUM$<ƋMEFWUVGEF G EF$G$F(FF,EE=OF-~MN O(N1utE)NEEȉF99E9}9UEE uuu=ED$D$ 11 +D$$D$?F4F:ON;$[^_]#4$詘1$[^_]Á}w.F,EE=E=wF-F,E~F-EEt uuu=ED$D$ 11 +D$$D$>F0F8ON9Sy`F0F81F4F:1UWVSSjKD$E$IƍxD$4$Dc}и9ED$D$t$D$ D$|$$t4$qItt*'v8NBCDt*|$t$,1Ĝ[^_]ÁxB u$,u뾉4$It&Ƃ1Ĝ[^_]É4$H1UVS2JEU Mu'v8NBCDty1[^]ÁxB uu[^]UE@ ]UWVSIEEU 9P vnH,X<3t;t*9r/9Pr*XˋE)ʋE1[^_]ԋ͋]́ԋ]跁UWVS$1IuF$ED$ F(D$ED$E $M~;N:]f4)ЉMЉ}F$)É]}f4)MMF$)lj}Ef4E)MMF$U)‰UN-FÃthtLÉf0ED$ ED$)N8N9F )É\$4$C$[^_]벋mUVS G]tS T$ST$S$Љ$踓 [^]fUWVSGE]Uu y7y7} vyCS< ) 1))ȉ1))‰ 1))щ 1))ȉ1))‰1))щ1))ȉ 1))‰׉1 wU g}#sC )ى 1))ȉ1))‰ 1))щ 1))ȉ1))‰1))щ1))ȉÉ 1))‹uF1ЉF[^_]Ã} vyCS< ) 1))ȉ1))‰ 1))щ 1))ȉ1))‰1))щ1))ȉ 1)ʉ)lj1 wU v/ t us s sC vTtzftjtws w}#3}#s zrt>t0t<Xsss{sssUS ԾDD$ D$E$q! []ffUWVS蛾òDE,0DFt"ҍDB9D~u.tH 1 ֍V9rl u ʚ;}1 ~  [^_]yDVt6<}yDVuE{뚃jD8EVUWVS蠽ƯCuEU,]|Yo1tX|Yu]@t|Y@u]|Yy1EutX|YuEu؋u@t|Y@u]DY*1E|XDYuE}}.b\AE}@u DA@tDY@u]}EX2wۋE1EE<2wuEBRDQ@u DQ@tDQ@uu؃[^_]EEv+E܉)u؍4)u4)Z)E؍4)EE܍(E=E/EEEB\AuE1BE\AEtGBE|AE󍄀]܍CEB\Au*&EEE}܍DЉEUWVSMd@5r̉EU)‰U)ƋUQ)Ɖt$T$D$ D$ D$<$5v[^_]UWVS裹ú?M -6t M1ɋ`M!t$3D$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,b|DžCxX,`2p,lh\(^qb [  S~ D$ D$D$$ cu_tUatF[o‹|p p ;ut$xD$$u f})D$|$D$ D$D$$ `?|$$$|$$ 訯u8jt&t$%D$0D$$<$VtM+m[^_]}n p9u}m P9u쀽it$T$ D$D$$ss8<$耇=!$9zD$ D$D$$@|$D$ D$D$  $Zq|$D$ D$D$4$.q|$D$ D$D$ $p|$D$ D$D$<$p D$D$ D$D$4$pu艵EЉT$UT$ D$XD$<$}wC%D$D$<$}Dž+ufNffftD$`D$<$)}dFD$D$<$|9uۋd|$ D$D$p$>F DAu.|$$辫9uщ|$ D$D$l$B>|$ D$D$h$>f|$ D$D$\$=DžwaD$$ n{||$ D$D$h$R=dFD$D$<$G{;uۋd|$ D$D$p$<F DAu.|$$;uPoo$螇D$D$$ztqUWVS謰6EĉED$ED$E $[/D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$, ZED$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,YẺEEfEEEfEEEfEEEfEEE`t5 u)K}f 8g1ҍ p9uED$t$ ,MD$ D$E$xE`t fED$$;dE`BED$ D$D$$P:D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,X,D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,WD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,FWD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,VvD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,vVD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,VRD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,UD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,>U.E`}c‹w puED$ t$D$E$tb‹w p8uED$ t$t$E$tbW] PK8uED$ T$t$E$MtObWu W}?uED$ T$t$E$tE`t tED$$ ED$$1ɋ}E+ED$$ EED$$@EED$$EEf Ef EMf Ĉ[^_]Í |$D$ D$D$4$e D$D$ D$D$$UweU D$D$ D$D$4$?e D$D$ D$D$$UeUM D$D$ D$D$4$dHf$~D$D$E$rĈ[^_]ËED$ D$D$$3ED$ D$D$$3ED$ D$D$$i3ED$ D$D$$?3ED$ D$D$$3`ED$ D$D$$2ED$ D$D$$2uMt Ev[^_]Í|$D$ D$D$4$_EtËE[^_]UWVS)uZǹq Pt9uЃ[^_]Ét$D$ D$D$ $_vЃ[^_]Ét$[D$ D$D$  4$^Ѓ[^_]UWVS>U(U} tdUZ~U ~t;u[^_]Í T$D$ D$D$<$L^[^_]ÍUWVS赡'uYǹ(^ Pt9uЃ[^_]Ét$D$ D$D$ $]v Ѓ[^_]Ét$SD$ D$D$~ 4$]Ѓ[^_]UWVS'uXw# wVfK BX v|@vF[^_]Ávf[^_]Á [^_]Á v,낃@t9u~bjtucOsD[9.T# c}1t$D$ D$(D$<$[>)N8]iUWVS%}VYD$t$<$xWx [^_]É|$9 D$ D$(D$4$[[^_]UWVS胞Ú$}jV1ҍ pt9u[^_]Í |$D$ D$D$4$Z[^_]UWVSL$-6E1E <tmD$D$ D$.D$M‰ $M/ZMt#PT$UL$<$(U0E+u4L[^_]D$ .M‰L$ME D$$MUWVS(BQ#EEEE$M[E܍U}`EUSEEU t 1([^_]ÃuuE-xE+u PUXư,uЋDJ_p1ɉ}؍uNLY>vDzu}؍ 4u؀.M\BuuEEE܃@tMDB@9wMDB@9=E؋EЋEDJ@tEDJ@9wEDJ@9ËEЋEDJ@tEDJ@9wEDJ@9&MDB@89wE} U؈W_GEȉGEȉGEȉG E]]EEDJ@9w덃EDJ@B9wkHMX\Z1HMX4X\Zu,uPUXEwEHMX\]@\BUWVS EM HMHMHMp΁HɁ@ =*-E썃E,ENMb׍)ƉuԾE+E)lj}))lj}Љu̅EEMb֍)Mȹ))lj))MUĺQEM)U܍)ME$EE $E$EU܋M\EE_uEeED$DED$@ED$*u|.t B[^]ÉЃ[^]1[^]UWVS(轕MEEEE$fJPlPHH8|$x|$x|$@ D$L$ T$D$4$([^_]UWVS2Iu(^ Gt-D$4$IUu?E tE [^_]Ë?D$#D$4$<…ukN,DHtU)SD$ ED$4$蘄SҋUyE8m1ҁ]1VUWVSBYuq Gt-D$4$YTu?E tE [^_]Ë?D$D$4$;…ukN,DHtU9RD$ ED$4$訃RҋUyE8m1ҁ]1VUWVSRiu D$4$/FFy ;F|/} t)P}D$4$/[^_]Ét$E$b_USےEM QQy ;Q|< tZ[]ÉL$$_[]UWVS艒àEu E$PEEEEED$4$.F0u ǀED$4$D$4$.[^_]ffUWVSIP96uWV@tWufFuFuFf~@tJD$4$lj4$]I[^_]ÉV@ut"Fu띉F룉4$fF@먋FtUVSBY96Fu "t$,XD$ D$ED$4$E[^]UVS96Fu tE D$ D$ED$4$[^]UVS蠐÷96Fu tED$ E D$ED$4$[^]UVS,Sj96Fu 3tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$7,[^]ÉED$4$EUVSď96Fu t2ED$ED$ED$ E D$ED$4$[^]ÉED$4$pEURm96U]U4O96U]US-ED$96$4i[]UVS96Fu t$ED$ED$ E D$ED$4$Jm[^]US蕎ì96$[]UVSnÅ96Fu Nt2ED$ED$ED$ E D$ED$4$[^]ÉED$4$EUVS 96Fu t9ED$ED$ED$ED$ E D$ED$4$ [^]ÉED$4$EUS肍ÙED$ED$ E D$ED$96$豛[]UVS?V96Fu t4$[^]RD$$ USD$   D$ED$96$诗[]UWVS 諌E8th׉ƅt|$4$JHt>u(<.tqAtN<\u~u~t&뺉+E [^_]ËU9Ѓ [^_]1+EUWVS$3]Uϋu U MUL$T$ L$U‰T$$EU;tqu?E8@@P]})ˉ$[^_]ËUt U t.t7Myt.:u)|.tPM;wH.ȋ똍둋]IEEu0UWVSƋE9vtˉЋ9s/u#uE щ )Ћ]1[^_]äftuuBf։HUWVS ZqE։ϋUUU܋U$)' M9ЍTU9qE썃E9utoD$E$tE$ExE$yHE܉E] [^_]ËuE$)'Kx+E [^_]UWVS:M}ˋMu uJZ9vC>}])BvJ {9Cs1[^_]É4$Er[^_]ÉM]*GEEMUWVS+}ÔE}U(E,E M0|-6M1E$t|$$CLƀ?QE4$6DžE4D$D$E$E@ƅ)E4E$kE$T$D$)D$ D$dD$$C‹ $=t$ $ }wvE}Mt#t<. y<7|7.f}B}$+)ʍ1r &ȉ9%9I $fyƸM+.Ę+[^_]ÍE4$ kxD$$1ɺ pE4$H;+M$D$L$T$D$ D$dD$<$%A‹$;,f @)lj~ Dž10D$D$<$p9҉+򋅐${<$-~F|$ $1ɺ0 f; @@1xJɋDOu.9̋+$;)+|}$$Nj$|$bD$t$ljD$:D$ D$2D$@4$g>‹$D$D$$U u+|}$$D$D$ D$dD$4$=‹<$L|$D$G|$D$$U <$r|$L$$D$t$ D$dD$<$<‹$,dP@D$t$ D$dD$<$r<‹$B$D$t$ D$dD$<$<‹$rB:}QxD$D$ D$dD$4$|;$y}$t& $fPPHp $$aL$t$T$D$mD$ D$dD$$:‹$ B<$9 $.$D$t$ D$dD$<$*:‹$$$D$t$ D$dD$<$9‹<$2j$WD$D$ D$dD$4$m9‰<$|$D$$U D$ *@t$)‰T$$,$r1P)/~0> $J09:!$.:‹$y}$t&r$ЋHpH@D$t$T$QD$ D$dD$4$7‹$<tD$ *@t$)‰T$$)+!@!r1P)/~0> $09 $8‹$dy$򋅰q+򍃽/}+}$D$t$ D$dD$<$N6‹$P@D$t$ D$dD$<$5‹$b;Q;D$t$ D$dD$<$z5$yt$|$$U 4$r$D$$qD$D$$4$C6sP8Pp$B= $~t$|$$U x4$rO$K$1D$t$ D$dD$<$G3‹$$$D$t$ D$dD$<$2‹$K$pB$VB$<D$t$|$:D$ D$dD$4$D2‹$) VUUU)ʃ$Gz}$ $]D$D$ D$dD$4$m1‹<$ @t$D$E$$+4$2‹$$+M$L2G}$D$D$ D$dD$4$`0‹$0Q 09(@Dž@DžDDžHDžL@)t 1҉  ;rE4D$ D$t$$苜4$)1)E4ȉ39[4$rt$|$}$Pd e }$t&D$t$ D$dD$<$.‹$*P@D$t$ D$dD$<$8.‹$P@D$t$ D$dD$<$-‹$LH@<G E4D$ D$L$$菚4$-/Ɖ)E4H97)ȉǍ4VUUU)ƒ${D$D$$U u9qiPP@ 19 :t1 tb$D$D$ D$dD$<$+‹$P{HED$D$ D$dD$4$}+4D$D$$U )1qi9t։4$ZD$D$ D$dD$$*‹ $yR|$D$$U <$r|$L$$U o<$n)ƒ [}$U4T$ T$D$$訖4$F+Ɖ)E4P@D$DD$ D$dD$4$<)‹$;Dž1P0Kƀu1$SDž |$D$ D$dD$$^(‹ $Q;'$-p}$n)W}$uU4T$ T$D$$訔4$F)v@t$$4$)‹$0}$t&b$ֲ$輲D$t$=D$ D$2D$@4$&‹<$/g<$A4$r4$dm4$r4$&4$rRt$|$$U X$E$+JRT$D$t${D$ D$(D$4$'%‹$) VUUU)ʃ~$/bf; @9)(n }$$![}3$rB2"t&jуP P@Dž====$;qiPP@k 19H :t1 tb$D$D$ D$dD$<$V"‹${HуP PPуP P҉уP P@ƅ= Љ;2H PPH P҃H PPH @$)`Dž====fDž==уP PPуP @fDž==ƅ=0t$D$ D$dD$4$Q‹$1Q9D$D$ D$dD$4$$yV$r)}u 9D4$YbT$ @t$D$<$5% r1Q)/~0 $N09>$2‹$񋅤yT$ @t$D$<$[r1Q)/~0 $<t09d$X‹$񋅤y6$)ʍ$ƃ<$t$ D$ D$dD$$Ɖ<$‹?w|$$1ɺT<$ 3$/ƃ<$E4D$D$4$U)E4|$4$1ɺ><$ U$艦ƃ<$UE4D$D$4$4)E4|$4$1ɺ <$$ƃ<$wE4D$D$4$ )E4|$4$1ɺd<$ " A$=ƃ<$ E4D$D$4$cƅ)E4<$,|$$1ɺ'<$ /@s<fWD$D$$U 0U4T$ T$D$$$D$ @t$D$$ … $QOUD$D$$U  ;$r'$,}$t&@!)2 $莢D$t$ D$dD$<$‹$=Љ;TF~'$,D$^D$ D$dD$4$$ X$2,d<$ "E4D$ D$L$$V4$Ɖ)E4HT$ @t$|$ $DžZrDž[+/~0 $L097$*‹$y$2$2h $2+c$2&艸m*UWVS8VE  U8u E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]UV'M8E#]UWVSUu}(Q|EtO9M r&Wfҍ<t+E D$<$/y([^_]9} r+E[^_]UWVS\UwEE}M OX9ff_X9@ffG 19wzsfftG u1Dw fu3Du9uEG$G(G,1[^_]ÉD$ t$L$M$x&\ËM믋]([^_]øUWVSdTEu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$uF,F,^(D$ML$ D$FD$$]趘=F,F,H^]9f]fPV,PffN,unǃfǃ ǃF(F(V 9F$F(DF,1[^_]É~$F(DF,1P 9UruHɋ]HN,@ff V,9ErEMF,F(F(T~ 9~~$kF(F,1[^_]Ë](K4]UWVS &RAEu} ]9~$t~$F(DF,u^(D~ 9V(9 F,9~,)щL$ |$VT$$F,F,^(MT$D$L$ D$FD$$]mAF,F,H^]9fҋ]PV,Pf҉N,uoǃ ǃǃF(F(V 9F$F(DF,1 [^_]É~$F(DF,1P 9UrtHɋ] HN,@fV,9ErE]F,F(F(T~ 9~~$lF(F,1 [^_]Ë](L5]~fUWVS OEU} BrJm U0<Ѓ?}E]썛 #]]M}KFm M0ˈ]<NN?M9UM ]L]M\ˈDMD} tE u;UEЃ [^_]} u~Nσ%?};}>qEDP@=T$E$tXU t}9}vI+EM 9ENtSEDP@M=tT$E$MT[^_]É΍NuߋE[^_]Éu} u9uv} l롄t&뒿v1vlο`qXEDP@u=CT$E$,EEEύNt[t] At DB@uE E9E] <NF]BDC@u=uJsύIGeUWVS -JDE80P߀XHp@EU1°,U¨,U<+u6\]tE]\Ftu0 7)YAtZM DADNtF0 Ƀ7) ‹E E ٍq„t;}sXҀO1 [^_]UWVSIu} UEXf0xu~E~j1E ɃT 7  ҃sT 7SEu9E~sC.9EE[^_]à EuE[^_]AH\@ UWV+HFu@ o^_]ø1H UWVS\GϋMM-6uM1t$D$D$ D$2D$M $MƃM;w,ML$$U7M)11}U+u\[^_]ø UWVSEG`EuE E컉))lj))MӺэR)É]%I$)‰)؉)U: 1UEu ]E u"M EÉ$Sr~=Ut3}ư,Ǭ,w\DAtu܋E +E[^_]ÍM E$WE?M E$DxhU#M E$HEx@EM EÉ$MMExM BfUWVSKEbu4$qH;MX} slu^uVM T:.utez\t*:.tU ƒ.} 1[^_]Ãt8z\tפftu:u!xU 믋E Pf} 봋U r(iUWVS.DEE -6E1D$|$E$xFD$T$$rxT$<$M+u [^_]CfffUVS|CÓEuUMx#L$ T$t$$x9s[^]ÉL$T$$T[^]äfffffffUWVS C"utcEt\E $b%ljD$4$'u?|$4$"u%džt$|$E$d [^_]É4$%"fUWVS yBÐutcEt\E $$ljD$4$t&u?|$4$"u%džt$|$E$ [^_]É4$!UWVS Au t\E$G$ljD$4$%u?|$4$z!u%džt$|$E$) [^_]É4$ !UVS aAxuD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVS@u} tHƒt-u3D$4$$tD$4$v$V1[^_]US@ÝEU tttu P1[]UWVS<@S}u  t'@t\ft wvtr fwkd#D$<$.#tLD$<$# v@u271[^_]D$<$"tD$<$d#UWVS|?Ó}u tPD$<$"tƉ׉$q+t/Vk)Ѕ~?D$D$L$e[^_]UWVS>î\$tD$hT$XDŽ$ $D$\$D$Hbd== 6=DD$`ݜ$D$hD$|-wËL$t$D$P0D$DÉ/D$p1|$T1 |HЃT$|É/~994~كۋL$p DHЉD$pʃ|$|bD$`BT$<|$@|$TT$\8gt$T1D$8D$\eED$0D$TD$0+D$8D$Dut$TL$Tȃ~L$@L$hD$ll$hݔ$|$T ~-L$t€&L¸L$pL$hD$ll$hݜ$؃|$TT$D |$D%+T$T;T$D?T$T)T$DT$\|$`D$TT$|T$hBD$|J+-fD$<T$hBD$|JAЃ  0uD$|D$|0tAσAЋL$|L$0QT$|I/nD$0=NyleED$\D$D  \$\(iUINL\$tGD$t$|4$mD$|8(D$tـ%\$`5D$`WߍGXljD$|@X0tD$DD$`D$<D$8D$\D$D  ݄$\$`D$hD$|t$XtD$|D$`e[^_]ÍDAЋL$|QT$|I/~9~+T$0D$0ND$<\$0D$<n݄$\$`nZ\$TT$D$`10)ЍT$| 0tAσ|$|AЉD$0CD$8|$\$tD$t$|4$)݄$\$`6\$`NDŽ$5DŽ$DŽ$DŽ$D$`$t$D$PD$$D$ $D$$D$D$|$\$t蛼ƃ=݄$\$`D$X|$h8 \$0݄$\$ P$$$\$tL$H܄$T$Hݜ$D$L|D$0؋D$$=u D$ CDŽ$DŽ$D$HD$L$D$D$5$<$\$t$$t$ $D$|$$$\$t݄$\$`|$t'4$^D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USâUt/9E t*&D$ 'D$D$p&$GE []US.EE%t/;U t*&D$ 'D$D$p&$M []UEtt]ËE ]1} ]USáE ~>u>EtQ&D$ 'D$D$p&$<[]ËEwǀ[]ËEǀ[]USEU tt 1[]WUWVS Ѡ$ ƅt@@@ D$D$4$u [^_]84$_81 [^_]UWVS(?uF~O9tHNM 1[^_]ÉUtED$|$E$iUMuFUF맸UWVSù}t;t-M tWt1$9ww$x<$p[^_]UWVSD[EPUt8E19ut%E')''T$ t$D$E D$D$|$ <'D$D$$z`u(u~M+8[^_]yL$D$ pZD$D$4$KzD$t$$j`t'H󥋅D$ \D$D$$D`:ǃ`+'$Q…`1ƉtcA<+w(׃ʃ뽃밃룃떉 `vUED$ D$E D$E$]US͚UM˃wP)BtJ[]ËE E @%]3 ؉BtBt븋E E @BtBtUVS<Et{E5EEEEEUT$u܉t$U؉T$ D$E D$E$}=t D$ EԋU؉T$t$U$Eԃ<[^]Íl)UE@%-@~D$$$]؉=?w $D$~$$]øUWVS}7t%KE tP9uu 1ۉ[^_]CffUWVS$˜EU܉Mtȃ"}}GE]\$$uMÀ-M+EUU1uUE1-09M~Ax;EEȻOQЀ vˍQW9Mu؅؋M܅twuu܋}>$[^_]EExUI0EE왙E E ;;MQ"@QW7 U܅o_TExEoE܅u01) [](lUS ×E D$E$[]ffffUWVSK bD$E$٦E@0u ǀE EEEEPEE9UED$D$ $M蝟MUp))‹}W7‹}΃K$}D$E$;E[^_]ÉT$UD$ $MMUuE@uЋ}΃stftU)UEu=u$ȉ$sEPfB볋E)‹}WȉЋ}΃u1u$}}Ef}}ftEfH @D$$Ϥ1[^_]uruYPE;ED$E$芤1KfkPLfExUWVS WnjD$"D$ƀ,<$EtE D$ED$<$-D$$  [^_]UWVSu D$4$oFFy ;F|/} t)P}D$4$c[^_]Ét$E$UVS iÀuD$4$D$D$4$ff D$4$ [^]US'ED$ E D$D$E$2[]fffffBfBfB B UWVShPQ@ $(DDžDž 8^D$$~tmpЉD$D$$*Bu t< u򃽴#wH@+9N4)ЍW9w։)ЉG 1ҍ9tftH<@ lj)9tA;wh΃r2놋D04$@;y$M@ Džh[^_]Ã< t< t򋅘D$4$|1Ҁ8 Hit$${t97 tb t] 9vx0D$4${wpd u뉋@ k‹tft4)‰NDžLtftQ :)9<44$!@;‹hD (T$$]…9+Qf 0Dž1aP$%f  (D$$dB+lj$vDž>f`BUWVS`4EEE-6U1ҋ@E4 D$ .u‰t$L$E$X(})EE4$ڼML$ML$D$ t$ED$4 $Q4t\E$E@ U+u_`[^_]ÉM4 $3MB΍)EfMUEPƋE$u_UWVS(E8P4 tkEUE<$ڻML$ML$D$ |$ED$4$W3Ut/E$E@ ([^_]ÍE듋MEƋE$Ft([^_]ÉU荃4 $v2t4 U9UWVSMxubx u\@@ HtEӋ‰t"ƃ))u)9|[^_]UWVSXhE}E -6M1Ƀt/苺/1M+X[^_]Dž;E~F D$.${,8tGt2fDwu<.tfD$:$htOfu:t .Duـx.0}GPuNWP v@9T$D$$ '@8@lj)Ɖ$W@92‹Љ@ э:E4$虷|$D$t$`D$)D$ QYD$`D$$jDž;ER1D$ D$D$$y.+1hsfcuCu*>X1!fYUWVSd~׉E EuM-62u1} }t*}t$1}+> d[^_]$(8u3Dž$=褵1돋ωAfAffQ 9fED$D$ T$D$$;@ u1$ЅyD 9c}}FPVDžPw9uDž Dž* }}} 9}#GV'M<$RNjE$R$CS|$t$D$ D$D$$%;1Ƀ9)‰T$D$ D$D$$p9DžA@ u$Ѕ48D8 9rQ4$;fF$;ǍF$;Ћщ;wfp1$1+!BGD$t$ D$D$$Z8Džx#@ k4$ЅXCf ft fttD$$R9P u,04$輰t~9)9nv8Ћtft1%dUL}BDžDž O819tl!9hu牕f zOut|J9~ 9~ oti9~aGH0f9~fpfJ2r 9uك9u@ +x+)9~փ $+Q)9nFNjtft4$蒭=2,D$t$ D$D$$3Dž@ 94$x)9}T$t$$1D$ D$D$$%1l$mp)9HEEUSb$D$D$@ D$ D$ ED$E D$E$[]USßbt$D$D$ @ D$ D$E$[]UWVSBUb($tDÉt$ D$@ D$ $ًU EƉ$ [^_]1[^_]UVSa tpǃ ǃ$ ǃ( ǃ, ǃ0 s#D$D$ @ D$ D$ $"Ɖ[^]Í $  t#ΐUWVS "aƉU,8DGtlUU؉U0tr\G0 1 4H\Gu2.utE]9t]srBDGu1[^_]Ã0 vNȃEt0ID$E$~oİ[^_]ËMx1DžlDžpEP:E@ fu%!tXMfA E$dDžiED$ E UD$T$E@$t!Ѓ8E@0tuN@9t$E@0E@MAfa D$ $xnİ[^_]MQf7xD$$oE@ UUuVLfF EE UdhE{@ fbEPPHTE@\lp+lp։ωlpMI0T XZMI<\)ωlplpƉ׋EH8+H1)׉lp\bf uBldh9p|$1lp9dh=ExL߉#dh!D$ |$D$E@$t!ЃyE@@MA0tI@9t$褡E@0Ef` ߋd)lt.$E@l9})ЉGD$E$k1İ[^_]ËE$aE@ D$ D$D$E@$tЉlp!ЃE@ E@)lplpE@0tE@<)׉lplpE UuEEP$FfE@fuxT$$-lE UEUԉdhu~TvPlpNEAu+Flp)@0TXEt"@ fbE@u~<\@\E@ fbE+H1ҋlp)׉lp\DžXD$ D$D$E@$tЉщ!ȃE@ fbdtl)UB+tЉJXt+@9t4$蔞Ex @0TTߋ}fG D$<$i1輊nfffUWVS42REMHM@ED$E$h1EEEUtED$ ED$E$…uuGE$uDžID$E$9h<$w14[^_]À}F|2 EtNML284֋EUDMD$<$ؙ…Mzȋ}׃;tftE׉ED$E$gEED$<$iUuu؉}}}UzMqBtz}u:Euߋ}OMMU8|U88uu}GEE@EUzMqEBu}<$EE ^E ]4[^_]E89 JEܸ)ЉEЉủ}ԉ ;MȃEU8Puut9wE9Eu}ԉ)։u Et)E9rU9|UEEEU؋Eu 0M܍D0D$<$fU M}}ωփ}EEuq}8}xEEE9Eủ}E#E\E\flM}8}fEqM=uU8Uuu8EuMU8mU8aU8OPu8EuÃEU܃9Ufl1맋EXM}܉DfmNm.ffffUVSLuF0t$ UT$T$$g+tM F0[^]ËE F @u18Tu1fffffffUWVS SbLÉσt )Njt;u&CL$T$$P tZu` [^_]à [^_]ËCL$T$$Pt#tɋC|$8 T$$P [^_]1 [^_]ËC|$|*T$$P [^_]U EE D$E$U]øU Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]UUM ttt1]ø]ËBM U]B@]UUM ttt1]ø]ËBM U]B@]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]UVSM] 3t@t+t 1[^]ÈUuAut$ $PUtۈ[^]ËAUT$ $tUUVSM] 3t@t+t 1[^]ÈUuAut$ $PUtۈ[^]ËAUT$ $tUU Utt t:1]ø]ËBML$$t1UM ]ËE 1EBML$$P]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]UEU Mt]n]UWVS趿EuE tbt;t 1[^_]ËEEFUT$4$PtڋU ;MvIuɅ$aE 멋FUT$4$tME;MwuQtbtkEډ>aY}ME$E E1]u[^_]ÉL$M$VËE ۋMup*D$ $ENUE D$ D$D$E$l]UWVSu} EE]EE|$4$t2Cu Ct9 uUU u[^_]Eu1[^_]UWVS谽CuEE 8t utQ<${EED$4$qtM;Mwtmtt(1[^_]É<$ZE [^_]Et>uu}uE<$E E랉ȃttEM밉MD$$莊NjE 8Mud*D$ $CEU D$(#E D$E$]UVS]tZtIt 1[^]ËE M QUECUT$$PtҋCUT$$P[^]ø[^]ËCUT$$tCUT$$tEMu F[^]UVS]tZtIt 1[^]ËE M QUECUT$$PtҋCUT$$P[^]ø[^]ËCUT$$tCUT$$tEMu F[^]J@UVS AuED$t$ ED$E D$E$~>.t[^][^]US蠺÷@ED$ED$ ED$E D$E$$[]UVS`w@uE D$E$tE)[^]UVSEHt9.Q.tFÃ.t,.tDuQCvCv0 w[^]Ã߃AvXЃ wUtމƉ뤍sw3Ƹ.듉ރ߃Av܃0 vԃ-u ӉQ|svŃ0 v1҉[^]UE8*u P.tt E]]ÃE]USUtGÅt91.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]US蘸ï>E D$E$[]USnÅ>E D$E$[]USCZ>E$r[]US 7>E$@[]>96U>E Mx5]UEf]UE]UEfU f]UEȋU ]ffffUWVS$ǒ=E EEEHEËU ,Ej9U 9UXr.Eƒ>@tK9U-@>}A4EHMtTAcI} BEE E1ɍ,E,EЉM[6U|$M $=Ut|UM)ȍ<FD$ $=UUM)ȍ(E,\.u+E܃E%E}9}EM؈v/M؅<.U܃uyUD$]E$<UEE+EP~xF~EЋDx0~ru9}19u(EEEE1+EU}f떋EEtEEvUD$ED$ED$ ED$E D$E$]UWVS0袪0EEEx}܋EZE@}8uEU1i@(HˁLʄűE EEEE̋} EEEȋEE:uE;EEԉ}؋EԋEEtzEutE+uuЁ?aP0t;ME?@ ƋEP0uEE}EuEE9Ed}؋]gEFFEE 9]+E fFEpB'}1f6EpBUWVS$,E-6 M1D$D$|$ ED$E D$E$t8ED$D$<$tE+uЁ$[^_]úUWVS$FU+E UM-6;}1D$ D$|$E$lt-L$T$ ED$D$<$U+u $[^_]ÉTUS]E M9r 9s9vu[][]UWVSfy*EE;E szX0t0ʃ@t:ttSb([^_]ÍX;] wދE1[^_]9] v)Au@u#!E!39E w뾋EEUVS责)E UHu'u#9w5)ItAZ…uމ+E[^]Éa[^]Éa([^]É+E[^]UWVS%@)EEUu Ɖu]Ӊ]8]}N 09Mvy 9Mvq9uczPt$|$$U]JuCU270:ۅtNt% t] a[^_]1[^_]Ë]`([^_]1[^_]UWVS 4K(u}E9E |2&6D$D$$IumtF;Gt1 [^_]ø [^_]UWVS͡'U2E uuZ1[^_]ÉuZ9wBZML$ ML$)D$D2$xC9E~E}ljr[^_]É_(_иɉ_?UWVS 'ME tjX1u%9w8L)ÍF[tA…uۍF[^_]É>_[^_]É'_([^_]ÍF[^_]øUSzÑ&E D$E$j[]UVSOf&uD$D$$YtD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]fffffffUWVS 诟%EU܉Mtȃ"uuFE]\$$\uMÀ-u+EEE}EډU1709M~Kt#E;]])ˋENQЀ vQW9MU܅ttFEE܋}8؃ [^_]EEpEF0E E?}UE<;]PtI]˸YQp7;M3\" ;M~x\"EpEG\E܅to}81u [^_]UЛ!UT$ U T$,D$E$]UED$ ED$E D$E$~]Uo!UT$ U T$,D$E$G]UWVS 9P!E} E0E@0zE@1/tftE@EM)ȋ}GU\}EU2D$ED$4$w0Et)EEEEEUM 9s[=sFt%  Ɖ Ɖ  pt$$h…t_EE 0E0Mȉ׃u_uFE$jKEu[@ CXTEfH @ [^_]fEǀw@ @u}]t6EtE [^_]ËE -WruUWVS,}D$<$5|$ ED$E D$E$D$<$5[^_]US跘D$X $%[]UVS膘Ýd5uH [^]Í&D$$%X $|%ƅu$bƅtD$X $0%FFF US cVU T$UT$$ []UWVS赗JD$"D$ƀ,<$vaE t8ED$E D$<$$|$ D$D$h$ #E$mD$wD$$a[^_]ÐUS $E D$E$5W[]USߖE D$E$W[]UVS谖Ƌ$hFt)VtF D$F$ҋF9t$\[^]UWVSYpE։ϋMt%L$UT$ $r[^_]ÃD$$dƅtM1UWVSu} GD$F$uD$$U[^_]UWVS,袕ù-6M1DžDžDžDžDž$t3D$D$ ,D$D$<$Z=~j$t p 'p T$ D$t T$$1M+,[^_]D$<$Zx,T$$Z…D$D$$҉t6t, L$ D$T$$c;t$+ZDž$ZDžYUWVS蔓ë@l$xD$Mm4$E9` d Ed$hHD$4$r]l;6`Nx h| txhDžptLGtWt1 t $dW9tu$dGt$dpp ;| rhth$udǃ| ǃx p tt t!t1te;t r狅ttt$dǃt ǃp `$zA| u;EU` d d$l$1Ĥ[^_]ÍT$ D$ D$x $ UWVS(Zq}u OW$tRGED$D$ t D$p D$E$R1t([^_]Ë3UWVS ϐ}GFx^L$ D$D$,$WGEqiE썃HE荃[E3E$`WEE9GE4G0D$E$1WGD0t‹E$WGD0u,$VGD0t,$VGD0_-$VGD0J-$V7$ U [^_]ÍUWVS[r| 1u9| vx <D$E$ZOuΉ‹OtAGEt"1Ut $aO9uuUU $`GUUD$ ED$<$UЃ[^_]$ | x Etx 1҉Ѓ[^_]úUWVSl[rE~EsEhd5Eh Ph E$4EEčD$D$ | D$x D$Eĉ$|O*PU@E1GE0EEEM E t~} tpD$4$MuOGUT$L$U$ЋUBuMu#TEM9MEU4ЋM yuED$D$ t D$p D$E$}NtMPtFMMЋMMԋUT$D$ P T$@D$EЉ$>NtH @,1EM9MXE$Eh ul[^_]E\<$l U 9PuMEAl l E<$<l[^_]Í\<$EtUPU<$RE0E1U<…uEEEHh  MEAl l E<$w <$wEtUPU<$]EEf̀rS[[UWVS諊ƉUM}PЀ wK1HЀ w%0P9~HT1[^_];U|E[^_]H1[^_]UVSӍu$1ɉYts‹M)::t Ѓ[^]ÍB$;1ɉ…t4M)::uʍB$<1ɉ…tE1UWVS草ǠhFٻ]t1lFdVىudFډ >-00u[^_]Ë]!؃[^_]UWVS&]ƉӉMudi)\P(\vB;SBLLL);Q= ףvEK My *)R)ǃQ))|gfff)DbQ)))׺$I)))ljC)S}u v u싌-4)֍t09@9| )~`E@E썀-Ƌ}|)9uKEȃ[^_]ËC )KEȃ[^_]ËSBLLL)KEȃ[^_]ÃC)*E B9At DËA+BuA +B uA+Bu A+Bu+UWVS=P |$ D$T$0L$,} \$THx|$\p t$FD$hF;D$@l$<D$L$D\$H|$ډ$$9ȉ8|<u(3lFdV-00tD<<<sĉ|$,,$<\$ <D$ \$T$0D$D$9D$ W D$\$,hF9u͋\$  L$0hF9dFL$,+dF1G D$D$$D$E$T$(щ€|$;;D$D$$D$E$T$(rщ€|$; D$0dFT$,+dF)1W G 9\$ W +\$8T\$8\$UWVST%z<U0xu}ʋ IXXU p x9uU|u}ċUIlX}t`XE.‹EEƉ)Ǎ)})lj})։u;MEU+EUĉEUEEE<ED$QD$ u}4$|$wEUD$QD$ 4$|$E.‹E}:))})+}Ѝ}lj׍))MD$:D$ EU$T$k}|Eиk9)Ѝr)‰)))D$:D$ EU$T$qi"EU}MЍ_uk9)Љ))щMD$dD$ $T$ nD$D$ EU$T$k Ѓn9EpSc} :)șEUEȉỦƉ׃MЉE؉UD$D$ 4$|$OEU܉E؉UD$D$ 4$|$'EU܉E؉U܋MЋE؉EЋEUƉ׃MEUD$D$ 4$|$EUEUD$D$ 4$|$EUEUMɍU)‹E+E)‰UEȋỦEUEUƃBm9Eu؋u}ƔE9EpUbE}x$I)))MEUƉ׃EЉUD$D$ 4$|$EUԉEЉUD$D$ 4$|$}uƋEM荄5ƺ$I)))ƉyEPųE }O)M)ѺW)Ѝ)ЉUM9ЋME؅J-E@]9|u)ӉFT9~]UEP @ ]X$T[^_]؃ډƉD$D$ EU$T$@D$D$ EU$T$׉ЉEЉEMmM؃ډƉD$D$ EЉUԉ$T$D$D$ EЋUԉ$T$׉ЉE؉ЉE܋MqnD$dD$ u}4$|$ u$D$D$ 4$|$ l.g؃ډƉD$D$ EЉUԉ$T$D$D$ EЋUԉ$T$ЉOE<E0T1&EmUVS8rOuE$ E tu t dVP([^]Í\.P([^]ÍX.USJMt50 wsS$m1tX8/t}C []S $ t%8.u S$t8.tH1[]S$mlzSH-t++t>[]S$15CC[;[]UWVS.ED$ ED$ED$E$ƅHE@9EE}G}mș+EU؉9‰F1EԃEt}<$}Ћ 1(ƅEЋ t"dVF(M]؉ș9둋EЍX.UWVSd m|$\T$PL$,fB<: u3|$X5|$Pa )GD$XT$X|$PwGW9|`Y`D$\T$`>|$T9t3T$`3TD$\3D u>L$Tt΋D$P@|$PD T=Y`Ӂ|cD$\T$`7>^t$T OT$`3TD$\3D u>t΋t$TD$P@1T$P9~[>u|$PlFdV-00t:L$P> hF1\$XhFt 91|$PZ1z\$\%8e[^_]ËD$\ bD$D$(9D$@tSD$ 9D$@tAD$P|$$xt$@pt$4p >t$Tu4t$X8>D$8D$D|$LT$HD$<ƉB ʉ։߃9D$Xu|$<yD$T@L$DAQL$P\\$D$$L$H1:t|$P7>9y;|$@|ӿe[^_]ÿ?e[^_]1D$Dgt$H؃  ȃuyƉ;t$<|\$T\$\#8JY&L$HD$PpD$PdF1L$HD$X4 u|$XyA<CA;D$4C;|$@|L$H1L$H\$4t$PdV9|D$4D$HL$4dV|$Pf@?|$$dXD$@D$HD$XD$4D$TD$8>tE1t$PFD$\=E0, [XX\$T ;A Yzl$Ty\$\\$\K\9D}%\$\DTUD$X:>NE9]D$X1ҋ}  T$\L$P]D$XA|$\;|1TF;1XF;1\F;1`FD$\|$\9 |$TT$T4$\$\T$TЉD$T17D$XЉD$u)T$lt$pAT$tD$\멍AT$tD$\t\$t|$hGGD$t؉dFƇhFLJlFfLJpFLJtFƇxFLJ|FfLJFLJZt$Xw dV\$lډNjt$psgtftt$l0e[^_]D$PD$Lxw1 y$/\$`#Å$1ɋT$h|$`9-Ɖ$+D$htoD$PD$L1 @D$\Ru>uT$\)щL$TT$tT$xgD$PD$LD$hxD$tD$Lt$h>>> 9f |uA؉D$`1҉|$Pt$h>hF>qFuL$L+L$`L\dFt؉D$`;T$PuD$L؋t$hdFƆhFdžlFfdžpFD$x؉tFƆxFD$X|FfdžFFdžZD$h\$HX dV\$lډNjt$psgtftt$l 0T0\$T؉׋t$\stftD$T0Ũy{dXt$hdXeXeXfD$`Gf\$hdVeV\$lSf=AyD$Tf.\$hdVeV\$lST$x\$x|$XD$`T$dD$DD$@^i)\P(\wU= ף%Q3D$`T$dp;\$Dp0\$P9؉\$L}"D$`t$d|$Dt3뿸븉|$ |$@t$<D$<\$ D$@|$t$~i)\P(\= ף%Q3D$89t$Dz|$DL$@ D$XD$`T$dD$0T$4D$T$0T$T$4T$D$hT$0TT$TD$u0T$P9T$T$T$L|9t$DD$hL$@>AD$@D$XD$`T$dD$D$T$ T$0D$hT$TT$0Tp+L$T$P9ыT$0T$L|9t$Dt$@0>FD$@;|$D$}QD$:t1ɋU8vUWVSPNj t@U$=EU~)|$ $u[^_]ÅxE } \.dž GXx2>u E [^_]Ë_yUtPىfu$ZÉ ;X.dž 1냍D$|$ $UWVSjNEu] N~61hF9u lFdV9ut [^_]Ë] 1[^_]UWVSNE] H~.hF9udF9ut[^_]É8 [^_]UVSMî4$1h4$[^]USaMxnk$[]/UVS6MM4$]nk$4$B[^]UWVSL $ZÅtUDžu ؃[^_]É$3 81USLöE$[]UED$ D$E D$E$]UWVSOLf<$vnk$ D$ D$ED$ $=Ɖ<$2[^_]UWVSK<$nk$tE D$ D$ED$ $Ɖ<$[^_]UStKËE $ 1ҋE t tdVP([]ÍX.US"K9 $ 1ҋEt tdVP([]ÍX.UVSJu ' $ Ertu t dVP([^]Í\.P([^]ÍX.UVS^Juu E$ Etu t dVP([^]Í\.P([^]ÍX.UWVSI <$nk$ D$ D$ED$ $Ɖ<$t 4$9 Ɖ[^_]UWVS}ƃL $tCƉxtD$<$E FEF e1[^_]ÃUWVS}t3Mˋu Ήt$E$Ut~uu Wׅu1[^_]ÉUWVS =EU΍` <$4t?$tYMHMHp  <$1 [^_]Í 1 #txu8u막<$UMU E]HUWVS5=D` E$|  1 E0E}Uׅt& ϋCtT9S tuߋu}샮| E$| ut?$u[^_]Åt* MK uIUCЋU ;EuO| u;]rF;]sAktڋ MUCK $ЋU ;Et׉E](U11ҋE]UWVS;ME0}U-6E1E (,hEED$E$D$h8$dhǀPǀTǀXDžDE ,(tY8HE @LT$ |$0D$8$8}+>uE[^_]Í78HDž@DžLT&Uc:~UT$UT$ ,D$E D$E$X]U%:@UT$UT$ ,D$E D$E$]UED$ED$ ED$E D$E$]UWVS9οD$ƀ,FX$?F`F`y ;Fp|4} t.FXPVX}D$FX$.[^_]ÍFXD$E$US29IE,Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$c[]US 8E D$ED$,X$n_ []US8úED$ E D$ED$,X$_[]UWVSc8z} Ee E EED$E$E@ E@U~1M19ssE}EtfEtME)‰UE$[U/E@뮁}bE KEE[^_]ÉЋ}tftE)PD$$(EEE[^_]Ëuulj7wWU<$Uu(w+WuދECMAAA듋E)1u EMuouV0(TEfH @EUD$E$FEU)1u EfBfmWMyHM2US 6ED$E D$E$\ []US5ED$ ED$E D$E$\[]UWVS5òED$E $JƅD$ED$E$'xy=_fFf~ vRF$F,XF(ȃF EtED$ D$D$4$_[^_]É$蕹[fF 1[^_]UWVS4ʺ}D$<$Aw fD$<$O[^_]ffffffUWVS[4ru 4$;EU9v 9ru׃s$u8u:Ѓ[^_]Í 9rU9sՉ׃ru$u,tftƤЃ[^_] zfRffffff!̀rS[ð[UWVS{3Òu F0u ǀFFF tBNt;})9F~JnJM 9FtHF t t=[^_]É4$|u:N})9F4$%u뤉4$tD ffffffUWVS2ƲӋ} UU tau! uމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]{ xy1tv҉)Ѓ0CUtʋE9ut ~sECExtE1띺4)0Kщa0C[^_]UWVS P1gUM9 ?p9s΃ttUUED$t$E$MU)UD$D$$E}E01 [^_]ÉUE.ED$t$E$&M u9EU JHJHJ H JHJHJHRPV|U0U$@0VUWVST 0T$L$\$4\$11҉  r\$\$,D$0D$ D$$uHtDP%uD$(\$0\$XPZw /t u\$ 9\$$G|$$ D$D$$6 L$, < l01ҍTPЃCHЃ v$h։YD$(UUU9t$09t$$st$$D$,D$ 3L$(D$(UUUp9t$09t$$st$$D$,D$ L$(D$(bUUU#9t$0 9t$$st$$D$,D$ UUU9t$0*9t$$st$$D$,D$ _L$(1HЃ  1҉t$ \$Ӎ\PЃpЃ vt$ L$\$ \$<$UUUV9t$0wT$,L$9t$$st$$D$,D$ D$(UUU9t$0x9t$$st$$D$,D$ sL$(ED$(@s࿀ D$((D$(UUU9t$09t$$st$$D$,D$ S*j HЉӃ CPЃ vL$(UUU9t$09t$$st$$D$,D$ L$(]D$(-UUU9t$0wL$0T$,cm9t$$st$$D$,D$  D$(; D$(L$( \$ \$34L$,st$ 9D$$;L$U $C1e[^_]Ët$t$L$,^\$붋t$t$vtL$,t$^\$돋\$ \$stL$,\$st$eD$(ttUUU9t$09t$$st$$D$,D$ UUUN9t$09t$$st$$D$,D$ D$(D$( UUU9t$09t$$D$, D$ qD$(UUU9t$09t$$st$$D$, D$ )UUUy9t$019t$$st$$D$, D$ L$0T$,e[^_]D$(uD$( UUU9t$099t$$st$$D$,D$ {UUU9t$09t$$st$$D$,D$ AD$(UUU9t$0wL$0T$,(29t$$.D$, D$ L$(@L$(L$0T$,L$0T$,L$0T$,L$0T$,}u+$t]T$x.$$ C$$$$@$T$x_$8\$HtD$H$$l$@ @ftD$x$t$9t$$,D$0$<++ED$xe[^_]Ë$<$$XCG f 4$fx"$$DŽ$DŽ$D$$$$襨D$$8$q$ǁPǁTǁXy 1??tft$B f$f$Bf$B$B,$BD$$<$$DŽ$DŽ$DŽ$D$DD$ D$4D$D$`DŽ$$"T$`sl$`뚋$$$$$у~B8@$Q$vDžuP1DŽ$$8p$$$:t$d$D$$$$DŽ$DŽ$DŽ$11ۋ$(ukDŽ$D$d$1$D$$$$wDŽ$DŽ$H1ۋ$$$D$$$$#DŽ$DŽ$D$d1ۋ$$DŽ$$t$dn$$$Ƅ$-$$L$\$ׁ|$hу$D$l$$ljօR DŽ$$@D$pD$dD$`8D$ D$ <$t$$tlj։ O$AL$|$D$ D$ <$t$$s0L$|A$$D$hrD$`<c9[ 9GA$D$\AD$`xtD$`D$ D$ <$t$$sljDŽ$t?$D$$$$DŽ$DŽ$$|$D$(É$$DŽ$$2$$$D$pOxDŽ$$$DŽ$)t$h$$$D$$$$DŽ$DŽ$1ۋ$|$d}$$$$|$p$Jƒ$G$B$vÅu1ҹ$뷋D$pD$$$$+DŽ$DŽ$11ۋ$fDŽ$$$K$D$l$$@$D$$$$荀DŽ$DŽ$^1ɋ$D$W$|D$P+$} 6D$Wttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVSé]}ED$E D$EE$h2E܋(3\$D$D$D$D$%-MM0U$T$ 4ƅGT$ DV 9ЉT$ v")HFL$D$$辉T$ ЍN99T$9Ӄ9uT$9Ѓ9uU'} ];E tE C9wwN9ue[^_]ËD$%-uMEED$E D$2$3Ɖe[^_]ËED$E D$2$m3Ɖe[^_]ËED$E D$iH$;3Ɖe[^_]ú+]~ t$^L$E$UE|tET$r@dUWVS Z}m|$D$U <$~3e3m܋(3|$D$%-BuM"U$T$ 1ƅ9T$ DV9ЉT$ v")HFL$D$$T$ ЍV99L$9˃9uL$9ȃ9uU%}];E$tE$C9wuN9u [^_]D$%-@uMEED$E$D$2$0Ɖ [^_]ËED$E$D$2$0Ɖ [^_]ËED$E$D$iH$0Ɖ [^_]ú9]~t(^L$ɋE$UE|tEL$vPhUWVS`XE(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$Wb¿03D$DÿED$ED$ED$E D$D$DD$ D$HD$|$D3$U:ue[^_]D$DD$DD$DD$DfffffffUWVSĀV}== =DD$pEU D$PT$Tu %=D$PT$hq D$p~D$pD$xD$ D$|D$D$h${D$HD$xD$LCD$hD$`D$l% ?D$dD$(D$`أX3܋h3܃p3݃x3L$`L$`|$vD$v fD$tl$tT$Xl$vt ؋T$L)ʍzt$X&\$hD$,D$DD$8D$D$H$sD$HD$`D$`e[^_]D$pUt$T%=dE'E  D$E D$2$,D$`D$`e[^_]D$,D$DD$XD$XljD$ D$xD$$؃\3\$LD$LT$PD$-@D$D$$أ`3D$ ؋D$$T$(D$LT$P|$DD$<L$8|$h+|$HGD$xuVt$D)9D }D }: )ЃD$x}~T$\~ ;D$\ D$TT$,L$0ȉD$0T$h$UD$DT$h~t$T~9~D$x)D$0))D$TD$,t D$8eD$,)U$HUD$hYt$X} D$Lt$X+t$Tt$xD$0D$TL$ D$\D$8Fr |$DD$L D$xt$l|$X|$Dt$Lt$d$QL$TJ Mu M9 ~ |$< D$LD$LD$dAD$\9D$x D$D$ 4$Rƅ%;|$XD$D$ <$lRDžD$D$ D$X$FRD$XD$xD$hD$4$TD$H0L$d|$4$XD$TL$XL$D$h$X…@ T$T$84$[XD$DT$8$PD$DM(M L$Dʃ T$<L$dt$d|$D|$Xt$L9 |$Tz L$H1E VD$DD$X|$DED$`T$\D$h$&P|$DT$\_D$Xt9tT$h$OT$hT$hD$D$OT$h*L$TD$ )D$0|$X|$T|$4D$,T$lD$D$d$MD$x} lj|$D)D$HT$l8D$<=D$E݃3D$hD$lL$ll$t\$ll$vD$lD$xED$8D$D$\r|$<t +D$0tD$8}rD$\D$D$D$h$KD$hD$D$d$RRD$lP1D$4D$` T$\D$h$LJt$DT$\=}D$\|$,9~)ljD$\D$xD$TL$0ȉD$0D$x?T$T$hD$D$ND$Dbt$dt$$\LD$dF4$IT$h|$HE@D$L;E D$0D$TD$Lt$\:M؋`3\$LD$hD$DEЉD$4T$lD$`؋D$<؃D$`(|$HE@9E Ut$D$D$)OD$Dr?+T$,T$X1҉D$,q|$0+|$\D$xBG$6GWx q dtftD$$NDžD$<wz4u2D$hvt(؋t$lD$4D$l1D$` D$`?0tD$41L$dt$d|$D|$Xt$LT$<*L$`D$D$d$MD$dL$hL$$NL$`9oL$H1D$< L$dt$d|$Xt$LD$X|$DnD$hD$DxT$dz|$<hL$`|$dAD$D$ <$GDžD$hD$<$0D$`L$\t$dL$dt$D$h$ML$dQT$\~L$\D$`AD$D$ 4$GD$d9t$D^D$DUL$dt$d|$D|$Xt$L9VD$DD$X|$DD$` vD$\o|$؋bT$8XVH؄tJuU tu ؃[^_]11US膡Ý'EHP$A[]UWVSDKf'EȋE @E]9C] {ETU]sučDEEH1EԉE9EEEE}EgEU܉Ӊ1ۉM؉]܋1ۉEEEUEU)Ӊ؃EEN9}s}]3uAC9Es0uV+E)‰؍M9ttMЋE]ЉXE D$E$]HEԃE̋uEE1ۋG1EU)Ӊ؃EEN9}sЋMċ]Ѝ2u4B9s$C+U)Љ9t\tUЋE}ЉxẼD[^_]1D[^_]UWVS`]t%-68}13HDžDžDžDžD$D$$!T$ \D$D$$9v11 rD$T$$4$3$3Up$4UXs$4UfffffUWVS+B$uM 1Ҹt B<uDU$gtNjUruu [^_]äftf9t뫍J‰UWVS訝ÿ#u4$[P$UxgtNjUruu[^_]ä[^_]ftfff̀ffff̀rS[@#[US $#D$D$ED$ ED$E D$E$[]UVSĜ"MtNCUE)Љ)ƍ)ED$E$` 1[^]Wr" `+US$AX"EE E ED$D$ED$ ED$D$E$M؃$[]USٛ!ED$ ED$E D$E$c[]ffUWVS蛛ò!UBJt@9vtЃ[^_]ËJ;J}ABDЃ[^_]ËBU$h:tËUJ<}x r s$EtfEtE$^;EHuuMx r mfmUWVS0螚õ ׉T$$L$T$(T$ T$,T$$EƋ?D$()D$(D$,5}}<T$D$4$/7D$ЃD$ D$(D$4$7T$D$,L$$Q9L$$Q9T$,EEX"FD$,D$ {M 014$9e[^_]ËU t:D$,D$D$ L$$Q9p)L$T$,9}iFEPD$ L$t$|$E$5EL$ fBU NVL$$AuL$CT$?E #DD$$D$D$4$y6ED$$RD$,@D$$@ D$ T#9D$ D$(1؉D$4$?ƅ4$mƉu|T$ FD$:T$ 9D$u FD$D$4$5D$,D$,D$ NT$ L$ #TY )ЉvD$tr#DD$$D$D$4$E5ED$$u"D$,D$ PD$,D$ 4$sƋD$,D$ `L$L$$4$4D$L$$&UUBJL@9v t]UWVS豖u} G9FVt]F9v w $G $D$<$2T$T $D$<$N&ك% ؋$8 T$HD$8\$0D$$ DŽ$D$\$$Ɖt$Hp\]؉]1EEډ> 'M9Mv9uv 9uHؿXHt4U tE ‰؍XHủu;]s A;]}ދEإ9v}؍GS9)߉} T9E)D$D$ $]2$Eԋ@u%E9EE؋U9tt<[^_]ÍF}<[^_]Íx}ԉE19usoF1FEF}}܉1S؀ w P v0P߀Xxx nf_)E )Nj]̉uȋuuZމ MB;Ur]̋u]c 5މӃ)u!Uu,)u}ԋG]ą )ٺ!ЉGlE؋E<[^_]ú} T9)E )Njډ]Zމ MB;Ur]|H pfUWVS0n ]E$]AE.6Ex0?EE0V0wF)<ƃP0tEÈE‹M<?t2M1U܉}} 8tU܋}߉]؀PEEE1ɅF}]܅E @ U4;wE E6}1tu$] ƋE0EFt!D$D$F$f }9}~ +M}DE @}uE1ۃЋM<u:E)]}!T}Ju:Ћ]΀<GЋ]<u)]OEԉE1EUE 0BE]޿L$ME؉$]ƋME ;Et."L$E؉$]}#"fUWVSke Ep98)} 19$btWUP@u} K}|> 9u~2U)49t$W0T$D$ $Hu1[^_]Í~ u u ;}t$O0L$D$ $u}1KUWVS0mdÄ }u D$(D$<$\$ D$ T$$D$T$D$,D$4$f\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVShc UME DEqAD9sץ9w)ȃTE9v#)D$D$$[^_]UVSEPXM 9} u#9w1[^]Í~M t09tݸ[^]UVSb´ C0)ˉ u鍊H6a)ˉ u鍊A)ˉ u[^]UWVS} Eu^]9~kVU\ttt )EV9u]M ؉FB9UwU+U}Tt83E@E@[^_]É9vޥ9wE+E}Ћ})MA9tÃ[^_]Ë}GtUUVSa2 UBJL19r $ 9vt9vUE$Ɖ[^]fffffUWVS` d5} vTMU$n*ƋUEFVu3FF [^_]Í M4tt ,$뽺ME )ȉ= @N ,$%V ,$CUWVS_á ut"F w"d5u& 4[^_]É4$a1[^_] ,$UN? 4tU${[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɋEDEEdUƉ׉1D9MӉu} t"E9C~$E}|C؃[^_]É؃[^_]ËC$&tMSx s stftE$&Eu2uȉE$Efx s UEuAuuux @t]1ú ]U$7t UP@]UWVS<\ u EP~9|׉‰uEF M9N}U$EЅ5HM̋UԍD9Us-U+EЃD$D$Ẻ$KUFEȍDEEE]\]9F]9)EċẺE E]9]vnEE@Etu܋}11ۉ}uEENjEgu61ډӉ1ۃEuF}9}wȋE܋}ĉ 8E]9]w]ԅ~ŰEtLtEԋEЋ]ԉXEЃ<[^_]E?UWVS 8[O Mu  Md5E ,EEut?tDt|$E$EE$EEuE [^_]ËEu?|$<$‰EtUE$UvE$u뫉ME [^_]D$\6D$ $EE [^_]d5ubUM$DžMU@q@ M ,$M~UM ,$ MUurEG ,$Eǃ UWVS$Y% u EPNj@EHMG9~ 9$ Extt$D$<$ Ep@]T] ]t{ )؉1}܉M>M CFM9w}܋]K9rG)ڃtEEE]XE$E$[^_]å9vܥ9wպUWVS}u F_)u)ODT9s290tۃ[^_]UWVS,]E @s)KD} T9w:98tJC$ljE؅'p CEԍsu̍DE܋E EE @M DEGEЉEu11E]EEK1)@1)Ӊڃ1EEʉHE9EwËE HE+E 9ME9M ]ˉ]MЉM9]v9]A1)EU1US9MwًE܃+EEu}ԉڍ tUԋE؋}ԉxE؃,[^_]É؋] E x1$2E؅tNjE@@E؃,[^_]ù-1UWVSEpt$PtFD$^$+ )NjM 9 ~T |$9|$s%~?\$|$ D$ e[^_]ÅD$ ?\$1ι )D$ ?T$T$9T$r1ҍH Ӊ\$ D$ e[^_]ËV)‰\$ ً\$ D$ ?\$F9D$LF >1-UWVS $ÅE %tT$ED$tpD$$8T$ )L$ KT$SɃKuP-2uD$)E؍e[^_]ÍD$$T$SC tu5)‹E؍e[^_]ËT$ST$lUEM Q tJu]UWVSLSc } tD$E $ƅD$D$E$VDžtt ʃ9t-xD$E$t|E%=t`fp ttu ffp MfH@RP$°P,XP(ȃP Č[^_]1Č[^_]1Č[^_]O1USQ E UD$T$ D$E$[]UWVSQ uD$4$Onx$P8D$4$X[^_]É4$mUSfQ} UjxH []É$6[]UVS/QF UƋUu 1[^_]ËOD$M$…1]~ˉ߃Mt~tctQt>t,tt<<<<<<<<<<<<9EC<댉t$UT$}<$٣n(H9 ]U9 ~(}Љ}u胮$dž dž(UWVS;ǿ M ]EUrt!u8tP][^_]Dt4][^_](dž,[^_]Édž,UVS;% M UEpEuU1҉[^]cdž,[^]UVS: M Ep}w=tE[^]`dž,[^]dž,UWVS@:[ } D$$ƅǀMtzL8xD$ UT$|$M $!84$ 81[^_]É\$E$m T$ ML$|$}<$ É{X TUMQ D$t$$SF~^^VN~^F^V f F N F ^ nNNVFnN^NV~^F^NfFFV^fFN F V!n"N#^$N$F%~&^'^(V(N)~*^+F,^,V-f.F/N0F0^1n2N3N4V4F5n6N7^8N8V9~:^;F<^<N=f>F?F@V@^AfBFCFDXhH ݈JHXXhHJ݈ZJHXX h H J݈ZJH X X hHJ݈ZJ;Nx>alF]D$ 7$ ;F@7~F(dž‰DžN V DDTNꉖD$ T$D$8$R]tEP {D$4$0MM4dž$$$Džp8X!?G1W >O 6>_0.G%7w[^_]ÿO$X,mr8E8F8FF F FFFF4X, ~D1 󫍾][U]StV4EHt }Gu]Stt V1v4s$^≕@DDDHN F$D$ D$ IL$4$~BF0F(LN,NV<~$;~v~,)F8FF F FFFF4X, ^D1 󫍾󫍕xT$]$vfE=~F $ F1T$4$1!$F~ 8118oxF8FF F FFFF4X,9 ^DlUWVS$~0Õ uF(F(NjN0!MNU9IF9MD$V$UMF($AV 9} LDLDF F,9r|$}|$4$2$[^_]ÉF0 F,ۍUE$Et]ED$L$M܋U$ǑME)EL$D$$XU܉$lMEFjUS]ED$U $ #C,9C(}#C0[]fUVS . EpFtD$D$$ѸF u  [^]3UWVS.ê E8TumpXtwRuMP PDžPPH4xLxt[tS1ɉȁ[^_]DžXDžPDžT 8a8DžLDHD$$$_ƅ0ǀDHǀ$$ }wFtD$D$$FD$<$~tx$tiFt$t$t$E4$<$E$3؃[^_]øfffffUVSEU Mw:v,290t49t)XJ8t)[^]1ۅuԉ[^]1ۉ[^]US  E;EwD$E D$E$ []WUEtu]11ɍT9w]1]fffffUVS UE X71rVȉ ȉȃ rȉVȉrȉVȉ ȃu[^]11ɍv1É11f1놉1_UWVS0ó UEEpt E 9F EEEEEFEFA~ MM܋FfMft LHfME}tC~ JB! 0Eu ~u܉CG GWPWPWxG8GFAW0O ME9Oft DAfEzD$D$ ED$L$4$趇O1EEtB#E ljEJE 苲E<΃}uH10EFAFF00[^_]E뿉UD$$ƅU=B UD$$FUQt } ~ F}t\}wF~N1D$}|$D$ } |$D$$虃0[^_]F~N1D$}|$D$ } |$D$$CJU E]#u܋FD$M܉L$ |$D$$U訅FEM܋U F4$1EEEU uE9tx}FFt"O L$D$$F$FA4$;ut+F uFtUt NuM u6;uu1[^_]D$L$ D$FD$<$Kt¸USUE @@ @XYX YXBP[]fffffUWVS " }ED$E @D$E$軛ƃtt|$$t [^_];84$f,8UWVSDç uE -6U1M{t$D$ 7D$D$<$=7DžDžDžDžD$D$$莙<$ƃtI<$D$D$4$tntD$4$諴tSD$D$$M+u{D[^_]Í)$v8D$D$$軘4$賚y8k?xwfffffUWVSxқ E EċEE-6E0u1ExGtD$D$$tG }t5EQE}+8x[^_]G(<u͋EċPuN9Eu9rYt$ED$<$teEEEEȉEE@EME؉EEċ@E9v]t$EĉD$<$Mt EEEEȉEEċ@EME@Eă9ЍEЉEJ}u[D$GD$$軛GfEEEċPuN9ED$D$$Oƅ'GfO @EV)‰UE@UB 9Er[tGFuKfuFGED$EĉD$<$p)fLJO fMEYF?LJD$t$$ẺD$EĉD$<$AƉE`ENfMu}3EEEċ@EUB ƉEAfEQfU)ЉE9Ef9UUfQEf+EfAufDqȉMMMQPMHp UċBD$D$4$KtMAD$D$Ur4$-tG( <Myt.D$L$$貛}  1]QA;EuLJEfҋu)҉T$DqD$DqM$sMAfEAfEEċ@E  ]EED$ L$MEĉD$<$ƃM5D$L$$ĚED$ED$ED$ED$ EĉD$L$<$-ƅID$L$$c9G|Gf;EnfGbEuFD$D$<$>`A5f}*LJfLJ E9GED$T$<$mO t4fMfO MfTLJ}'fM pffffffUWVS,+B E@(ƒ 'EEEuTpF~> EHE)ʉT$D$$qEfx]\X}Wft*}M|y f9sf 9u}Dx}WMуft"ҍ PPf9sf9uExEfxE@(E <t 1,[^_]ËEu69puP;UvރufF1ҋu}?9~V;UF(  EEEfEED$D$D$D$ D$ED$E$hIUD D$E$8nUXЉUF D$E$nUtF(M 1EUu^@f_E@E@9EEEEfEEH(EEfEut$E D$E$iE@9EsEEEfEt$E D$E$iNEH(EuFEfFE@t$<$ut$<$Biȃ([^_]ÉU܉M D$<$iMUuED$t$$螒MfME EF )‰T$L$M $jEfEfFEDFfENUBft;ЉUTVȉM܉щuuf9sfUf9uM܋u؋ELAFƒEEfEt3Auu}}Af9sf9uu}VBfFD$t$$蠑E8tQED$<$4t#fFfFF 묋ED$<$1ɅfD$D$$11IUWVS45 uExGtD$D$$G Et>tMЃ4[^_]G(tިЃ4[^_]EEEED$E D$<$_5ƅ4EUuFE@  Vf9"t$E D$<$cFD$ ED$E D$<$tD$ED$$ۏЃ4[^_]D$GD$$Tƅt@fGD$ t$D$<$GF$UED$t$$JU 1҉Ѓ4[^_]fU}6fUfEUBfFft$E D$<$RbFD$ ED$E D$<$FHfu9fFMAUEfNpFfEE@fE?1EE@ftD$ED$$ Mf9MtED$ED$$UD$t$$čGEЍMML$D$<$20G9fEA‰EԋuD$L$M$`F,EE9Mu2 D$L$M$*E;}܋MGD$GD$$蓊 GNjEA9Etf}ڋ98}fxVLH|9fAD$D$$lD$|$$1Ʌqm}ufMډD$L$$"D$EԉD$$誉$F9kD$t$$ڋD$GD$$bƅD$L$$蜋D$ED$$~:)M D$D$$?UMIEt&薿DD$L$$ED$EЉD$4$/0G,EO9NM܅D$t$$藊E;M2D$T$U4$fE9uU#EFD$FD$$ʇ…DF7ftփfEڋfPEHUڅt{MDFDED$t$$載D$ED$$Dƅ@PMfPMsfUD$t$$SD$E܉D$$ۆƅjP֋MU9fff1̀ffff ̀rS[ [US D$D$ D$ED$E$t E[]øUWVSß ElE `-6h M1Ʌt}u]uxVE%GpuFl8Z+Edpl9wD$/$݈tDrDžphM+pİ[^_]Ã8\΀>X$>N;\u؋\D$ d)D$t$X$`l9r9?/utD$l$1/|%=@tWiDžpl8u+l-?URT`D$E  D$l$6Ѻ8fTd9RƋX8\)@u08p9d D$\$识uQEt8D$l$n0JDžptD$l$t08pl\fffffffUWVS.E Eu U;Uwz9v 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xf7\fUSä `$[]UVS f} `4$轄D$$D$F $/ [^]UWVS "9 }$DH$6H#1$HD$$D$<$G/t$<$f. [^_]UVS0 EE tm E싃 E EuD$D$ED$ ED$D$4$lt}u E0[^]ø0[^]EED$ut$?8$Ft̃}uƋE쉃 E E􉃬 ƃ \US~ `$[]UWVS|x]y}AEq uy}y}Y]IM]Z]Z]R |MUĉu]]UUẺ}u}}ȋE]]ME te kE2-byEnd 3Eexpa}Ћu]ˋ}11 ˉ]1}E1MM}1]1߉ <}1}]1M؋U1}1 щM1u1Ű}ЋuU1M1 }11u11 Ɖu1uĉU1Eȋ]UӋE11 Ӊ]1EM1ŰU؍ :U1E1 M11}}ЋMϋu1]1 ω}1]1m~u֋UexpaxUnd 3SU؁2-bySte k߉S MKMMȉK]]̉_MMOU‰W ]]_$EEG(EEG,UUW0EG4UUW8|]ĉ_<|[^_]UWVSl{ Ɖ׉M-6UE1EEEEUEEEEFEFEF EFEĉFEȉFẺFEuЃs8tftD$@D$E$*E}+8uBl[^_]uuuуfqVUWVSz ƉPH-6LM1Dž`DždQDž\ TEX$)h rD$ |$X$1D$D$\D$ |$D$`$@g\ D$ |$X$a1PtHL$T$X$;1XD$<$E1D$hD$X$(hlFpFtF xF|FEFEFD$ D$<$(TF LM+u [^_]TUWVSx t2|$ƅ^ 9E[^_]Í`4$|uN D$PD$v$JD$F$~ƃ4$|\$N@$@@#1$'@D$D$D$D$ D$|$$&ƃtuD$|$$&tPt$|$~`4${ ^ 911҉[^_]É|$4$%D$|$>~UVS+w %ÍU59t E[^]ÍC$D{E[^]UWVSv x}u -6t]1ۃ w@Éx9$tM+lĤ[^_]lÍEp ‰rx9EEEEG`|)l9l)މd?hdt>`]|pډEuE@9|uhlqD$ D$p$x$lD]Epډ\jElڋ\ƃtf"UEpl EluE|ƋhrhtfhtD$@D$$x# C$xx*C$xxuu"+ulPf͋xOE[UWVS s E1uUƍ]ډM;Mrꍗ9t1uЃ [^_]ÍF$wMUVSn}s w119t[^]ÍC$w[^]UVS&5s /ËM UI9t[^]ÍC$Sw[^]ffffUWVSDr }EUMȋ} ?f}EEffEBEfEfE1fE1EԉωEuTF2 Z]f9};E/MfEMA)fAfDYt$T$Uȉ$]7NM؋U܍L1f9MwE}E]f9]f9}E@ Eƃw*/EuTFr2EuTF2Ef9}\E9s1E;Et(f9}-uE\E9rωD }fGE@(#f;ME }f)8EEE}f9}E1ҋEYTPt2fBD$D$ $UD$t$$9S1҅muuÈrS[ÀQ [ÌrS[`Q [Ḉ̀rS[@Q [̀rS[ Q [ḹ̀rS[Q [US P EU D$T$D$ED$ED$ ED$E D$E$A, []{P fffffUWS[vP Ut}; ;J;J;J ;J;J;J;Bz(@1uCu4uuB B$[_]êftfŪ?UWVS4O EM(M؋uvuuvuuv ][]܋][]][]ԋ][]M썀(8w>8)|>)1ɃtftȪF V$EUD:@t@L>))t 19r\$4$ߺ81tftf뎪gf u`uO7ЃE1 ;Er7MfOfm7Vf먉ȪUWVSӉMp x$?tp@)։u|(;uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$xG W$@9ue?Mt)ʍx(3tftM1H X$[^_]Ã}?"x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8SPpp)|>Q1tftFHVLEUF@VDEU3ߺp1uDuQ1s^tft\$4$Mߺ~1uou` t䪃ުo)f+u?u0rуM1ɉ;Mrqf뙪}fɪUWVS É։T$L$@@SDtv)|P9T$ID$+D$- 1s@{Ds@{DsCHSL|$D8D$T$CPD$$D$|$CPD$D$T$D$؃D$ |$ָL$ B"tftT$D$D$$s@{Ds@{D9T$rCHSL;T$yd$T$t>Ѝ{Pt$4tftL$1C@SDC@SDsCHSLe[^_]ËD$vL$D$1L$L$$C@SDC@SD9ƉыL$rCHSL;L$uBfrT$Ћt$%ubfD$u_uDL$D$tCP{QD$ffl$JL$D$GUMt U E]UWVS蔴ë: } Et.1T$T$*MTuۺ1u)u/tft[^_]êtfUWS: U9 9J9J 9J 9J9J9J9J 9J $9J$(9J(,9J,09J049J489J8<9BE3h[]ø1D$D$D$D$ ED$ẺD$o=$["U>ẺD$$=EED$D$D$D$ ED$ẺD$0=$!t5D$D$D$D$ ED$ẺD$=$!zD$D$D$D$ ED$ẺD$=$I!1EED$D$D$D$ ED$ẺD$!=$ BEEGEEFEEEEEDnEECVEEB>EE& MEE ED$D$ED$ ED$D$Ẻ$D tE EE<D$D$D$D$ ED$ẺD$=$xEEE D$D$ED$ ED$D$Ẻ$,D$D$ EU$T$$EE*EE)EE(EEEEpiD$$B EE&3EE%EEREEEE EEEEEEEE}EE eEE MEE 5EE EE EEEEEEEEEEEEuEE]EEEEE-EED$D$D$D$ ED$ẺD$W=$@D$D$D$D$ ED$ẺD$?=$dEEaD$D$D$D$ ED$ẺD$=$2D$D$D$D$ ED$ẺD$=$CUS- []UWVS4ħ- EEEEEEЉD$EԉD$$54$1U+ $Aq…nEBE   U$ qDžUHE GE U$pUMHMtغ غM tԺ:ԺUto̺̺14$0D$EЉD$$34[^_]Í 1ҋE 1E+1R1룍  2t 9t$xt 9t<$w Wܺt獃 9t݉$w ,UWVS 藥î+ <$/غt V6uwc$uEt+wкt V6u<$/E [^_]wȺt V6uD$<$5/E [^_]US$+ t$[]EEED$D$ED$ D$D$E$t $[]UWVSoÆ* E }0@DFƅtDFU U 9BMD$F D$ $aGEMtwFFU tmHU};O#D$D D$$FMAE1[^_]ËM!@dGF Mu1[^_]ËU!@uMAD 1[^_]ËED$ED$ GD$F D$E$oED$ED$ ED$D D$E$u‹]}[^_]ÉD$ $qtEUBL$$q…vEFH}OUWVS肢Ù( uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9wt% 9t 8t)؃[^_]ËE)[^_]UWVSUE x}z9v=0t# P9tT8Tt[^_];}[^_]ÉUWVS2' }E pE0EEE90EuKEU9vщL$MFD$E$D$t$$*M)Mt/MVD$T$$(ƅu[^_]1[^_]ÉUt$E$&oEtЋME0UFUWVS,*A& E MMM@E1EEԉ}4UHD$D$E$)U)U}}uEԉD$E$YƅM@@@ @E‹}9vM؉T$U܋ED$F$EU܋MTE)UqD$t$E$%)1,[^_]ø,[^_]UWVS% }E pD$D$$z&tU@ u\M D$UT$$I&t$+uPUD$<$9ur1[^_]ø[^_]D$D$$](1[^_]ffffff̀rS[P$ [ḿ̀rS[0$ [̀rS[$ [S[# [፴&v̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVS1# tMƋuA~8t:F4@9s3`V8F4@9r$nF8[^_]ÉUWVS覜ý" EEu-6E8}1s[F8t1EM+YĔ[^_]ËF4A@E$ fF8*E} F4F0}}U1EM Q|D$`}|$}x|$ F8D$T$E$ NjUN8UV4V0D$ D$`T$ $F4E~81u @urP2uB8}8BX;EuF8$mF8U ȉȍB=6Y8 CU YUF8$l YUF8$_dF8tmD$`}|$x|$ D$|D$E$ DžuUN8X]XUWVS@ EE E-6U1҅|%;EK=@9RƅDƅdO%D$$%BƅC8DžD BD$4$#)< D$ |$t$$Ƅ=DVD$D$$QƉ׉V 8;D$BD$d4$[D$D$4$Ap @utU}u⍃8n44@ Džh1Dždd 4$l`D$`D$D$ |$D$$  9ȉ։D$ D$`T$<$G489Ƌ_P((1ɋx9z11tpvu@8R<L9H"99wǍvuB8`9wtswtD$D$ $It%SmuDžP8d@41`;t 9N@FD$$9 udt;G%D$GD$4$iG& tD$dD$$GtQt9HVtftt81D$ t$$G DtD$t$$FtP?.D$BD$d4$ GDžP8D$D$$1PP8f}tD$D$$EtPRtD$D$$Et O"M+Ё@[^_]Éd..D$BD$d<$ AdDd$N,N8 6!$N<$IbO(9H(th89:]``;<$ad$MpuW4P4O0H0O8H8txyPRTP`9uO7t'D$DD$ $CD$=M_R1;s$4`9u닅408$`H돋t3D$D$$B$^L$`X*Nj@8@P1f,$K‹tEt&D$D$ $Atቅ$WKUWVS <$WE D$ ED$ED$E$MU EƉ<$$[^_]fffUWVS蘌ï EM$u,U-6(7u18uu,t.>} u0ptvDž} tоJ0(U+E[^_]Ë}|$T$,T$ L$U T$$뺅t%=v}`u$ Dž0< D$D$4$?4$mI@8ȃ  υtAtft `9?01 t 9Auˉ0B$4BT Dž861%=}`$`_vLljDž `hD  tf t```9tu`;uDž,t$,$t 91RMd1'`9u@t p0x@$Y9v$σtft@@,G f  xrDž _~ -f:1H-p0t]uu fbUS 袇ù EU BJ  D$T$$_ []UVS Ne utu#[^_]ÉL$$'ԉЋUWVS=H }MtP49t8u))t7} ttu+U [^_]1E $BƉ[^_]ffffffUWVS8E uuЋuMΉủމuU U 1Ƀ}Muux}]t<(&]EEt$E$UED$4$UEUMẺE}}}9ẺEEEދ}}ED$<$U?9su];]ED$$Ux;uUtω؃}M< ]XJ9u]륋EMEE]}}}E9F+E؉‰)ߋE)+E9vӋE+E9~Ѕt0E)}U։] ZH9u]9f9}9]E)E1uuMΉűU UEM̉MEEEu9(E9Es]339}sJ+}\$<$U~7Mt׉}MىMKP;]u9}rMME;Er8[^_]ËMЉ]܋8Xzu]؃}tUU]} ZH9u]Cu!MM؋}EM؋EEUЋM]9Yxu]E~8[^_]tủu111U)ƒ}EEu]XJ9uu]E)E؃}MU]XJ9u](}]MXV9u][ML$4$U-ML$u4$Uu EEM AMEED$U$UED$M $UE MىM܉)t$M $UED$4$UEE܍ ȉML$E$U\$E$U*\$E$U] 9] 9}rZ1uMЋU]8Xzu]E؋Mut$E$UuED$ ED$1uD$E)${ED$ ED$1uD$E$UЉ]XNu]pEu]0Xruu]E)U] ZHuVML$E$UML$E$UEEU/ED$u4$UuM $U]\$E$U3EE=UЉu 0sHuu%ut$E$UuED$M $U>EE:U+UUfffffffUVS | EU M;Mw/9w 4 9r$9fu49rL$T$$ [^]0fffffUWVS${|Ò lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$m3E ‹Mu`EUD$ T$L$FD$$;uCtVT$VT$$$Ѐf1$[^_]/:UWVS{¢ Ƌ; rHu @[t9CuugCtwBCSC t^B C ؃[^_]ËD$$HÅt@C؃[^_]Éډau1F룋KD UWVSz u xD$4$E%=D$($:HDžts@@@9uE ED$D$ EЋUԉ$T$uEČ[^_]81Č[^_]UEU U U$]UVSy ]tvtWJ}u tFP@Lt4ADTP@SP PS@[^]ËP븉D ,D$ D$%D$8F$ U D$E D$E$]UWVSx E puPHt,JHPt9Q P E$J1[^_]ËxuL HPuNjEPUWVS0Oxj E}u 9FE NjAX‹9QuMrEMM䋏M1҉E؉U܉L$D$ $T$]1 ‹MkME؋U܉D$ T$ED$E@D$$]9‹Mt1`VME@T$D$$]E*MEpE@EUBAP]YEDCCGC CGtST$t$$$ЋE@0[^_]ËZt]XZAtZPQEDBJB tTA B _BZ BGEuJB0[^_]ÉY AuQ 41։뱉41EA 1먋]4O1UE PMt ʈP1]UVSu ut PtH J H $Gu4$G1[^]UWVSuǝ uu $[tCtډu[^_]Ë$x؃[^_]fffVSD$ L$t 8trtl@͉ э&t&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^UWVS tǨ uU Et6t.ZYutD$D$ $?' [^_]UWVS0tG u e}tdEE}}EEED$E$ED$E$ht +E1ED$E$u}[^_]Á}{h1[^_]1TEfH @1UWVS$Nsi E܋E XE@ }Otzu :}ruU]u}tqvD$t$E@$EP,)NjM IM)E Hu1$[^_]ËE$] 1E@ d3{끨E1E‹u9vEX;H@9 ‰ÉϋutftUu4$]9U)ULU)UE @E)Ћ} GEYEPtEMUED$D$ }<$]\)E] M{}]UtMqu9fBfB$tpEu9qɋurtft})_UEUE @E)ЋM A-E@ UXnE9xsN]ڋE9sB؋utftUE}8$]|)}UyEHE91ȁvL$ED$E@$EP,… )E M9EPp)6p9rD$$]>…]+CCECSs׉;C zE‹urRjMȋus+tftuE)FEX1^>9]\$ED$E@$EP,… EfH @$[^_]Q1"Љϋus;tftE)P)UUE$]u1ɋUuguo믋EEfP{BffvEXcf[fE]+]+ UWVS }G tPwtI)7tI1Gu-)t'\$t$G$W,fO @ [^_]ËGDu1 [^_]ËG봋WU [^_]UWVSl utLD$4$> F t$4$ED$4$G [^_]* ,4$ $Dlj4$p[^_]UVS<l5 uE EEEEEEN>wK t$ED$EȉD$4$CxE<[^]EӸ<[^]*UVS<kÖ uE EEEEEEN>w@ D̍ED$EȉD$4$x E<[^]ø<[^])USj (UT$$9[]f̀ffff7̀rS[ [>̀rS[à [USmjÄ D$wD$ ED$E D$E$C[]ffffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVS{iÒ u5tdF tgF$qUWVSe Ɖ׋@0$F0PEz9EED$$F0Pt$T$8$ F0PuD$E$~V0UU쉂PF0ǀTu Xt$R[^_]ǀX\D$$F0NjF0TXtXUd Md5u]1҉]UWVSfd} ud58u [^_]ËF0$F0PV09t'Pt($p[^_]ÃT1݉UUPV0ǂT1UVSc ud5u[^]ËF0$F0Tt$[^]ǀP8$%F0UMch MU d5u]É]sUVS#c: ud5u[^]ËF0$bF0U t XtTt/$9[^]D$\$ F0ǀP8$\F0UVS8bÚ -6E1EȉD$E$U+u 8[^]ffff&&$D$4̀D$̀fffffffT̀rS[ [Ḹ̀rS[ [US a E D$D$t,@E$d []UWVS4yaÐ D$(΋ED$$M ED$ED$׋UL$D$ ED$ t$|$D$($ƉT$UvL$ MT$L$uBD$(9t1;t$$|Y9t$D$}{E"t$T$4[^_]ËEW;t$$|(E9t$L$|Vt84[^_]ËE"t$$ʉ4[^_]ÍD$0E |$,8tEV4[^_]Åct$T$4[^_]UWVS` EU uM] $\$M] Ǡ,}}$}M] $\$M] [^_])UWVS EU ]\$u}M] $\$](]M$M $\$M]u} L$ [^_]fffffffUWVS;_R }D$<$dt(tt$<$&[^_]1[^_]UWVS ^ uD$4$trXt`|$4$~t>UT$D$E $;Es1 [^_]";UE9E r]ø]UE9E r]ø]UWVS]  t ;6E1 D$<$ t  PEu׉uD$D$<$l tGƉ}D$t$E$J  8Gt|$E$ <$M/uE 9t$$2/ǃ ǃ [^_]ËM TD$D$$[^_]E (UWVS\ u} t%4D$4$tt=t1[^_]À=t[^_]UWVSV\m ED$ <$ tƉD$<${ 4$7.[^_]UWVS \" }G$%ƅtx @D$ $[^_]US[ ED$ $vtU 9P []1[]UWVS {[Ò EE;6E8o7e1}ƋE D$ED$<$j u E <=+EF fF FfuUT$U T$$[^]ø(8u F 본UVSVÛ uFft<ȋED$ E UD$T$ $H!уtfN FPVT[^]ùff [^]USV, E@fu$[]UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu"B[^_]ÃHtJ ȃB[^_]UWVSӋt B΃KQ |$,D$T$L$0tȃ"s|$FD$}1Hȉ`Dž0Dž<ϋ\<%t09 <;`s\\<%uЋ\P@ƅXDžhDždDžlHZw X扅8\p1DžHDžLDžhDžTplhƅXdыh9}Hw } LPu atT,pXt$ D$D$LZ$ft$ ED$D$<$oWw 1}`f%9w1~t 8tbDžL$L$$xu~ut Љt=9x KPf)Dž`<$z6fLJWp ~r1fDŽBDŽ|:t&t:1t:qt:q|:y ;uf@@ GDž8<DžDžP[0,lX,[$Y[\E[D5[do[[[[![]fZ< [ Y@(ZZZZ4ZZZZxZ[Zw GtDžxtHxXxtf@<j< DžT$x ЉkGE|t@`XF<<DžxG>D$ |t$D$$~9n&0Gk 0<$2xxt9G iPP9G5${2`<Dž*uL$ML$pL$ L$L$4$Ѓw<$1foLu+7e[^_]ËtF<5Dž87P担xt ƍ$RD$ t$t$$=T$T$T$T$T$T$ $ lXhpD$D$D$D$D$D$ $C)ʍ‹fDž@D$D$$^DžD$T$D$ ED$|$$蠛ƅ"@ lf9ua t\lPXT$ D$D$d$舣T$ E9D$|$$fDž$!uT$$6G<ED$ |$|ȉD$ $ @u a ShD$ D$D$\ $舢hD$ E9'8 0G$%D$ D$ D$D$$.@<$3-DžhD$D$$xxGD$t$D$ |D$T$$<;|t$$@<$d,ua hlPXT$ D$D$DD$ D$D$D$ t$TD$$_t$ xD$0D$,$Pt@<DžT80@=0$>+DžtЋGDž`Dž,x t 󥋽GGGGfy׉Nj|Nx99 ȋ|99‰ !ȋL 99‰ R Dx9;& Ћt x 9u㋕|1t tt$tt(tt,tAAf9ut 󥋽GPPP f~DžTz0Gh$D$ D$uG ;DžDžED$D$ED$ED$ D$D$<$Mxu1@<t 1G D$<$=eDž1GDGDDž^GDGDDžD$<$==VUWVS{ u }MME@ uuM[^_]1[^_]ffffUWVSpz u} U(Ft~}, ~xBBU(4$ fF@fU(fv  Bf% fJUEt[p[^_]ËE$PEE$'RML$D$ ED$,D$\$׺U(#},~r EML$ED$ M,AD$t$M $8jƉt$E$;UFD$U$;uU(fBMM,щ) ML$}|$ D$t$E$N8Ɖt$$ ,;FD$U$;FD$$;FD$$:F EU(fB E)Ѓp[^_]ËE H E, 9hB B U(D$E$:U(BD$E$:U(BD$$:U(BD$E $h:U(BÉEE tE ߋus!tft} }fBE)HuuBzE fUWVS êw U }E@4E)Ѓ FD$$)9FD$E=b$9VfFE@ uH1T$$_9F D$$L9G fffG F ) [^_]ø뗨u믍\$U >U\$U{UWVSÜv U u} E@EЉEMM}E)9UB9E;M}|$4$g8GD$}<$S8V׋u$s?u3u,}׋ED$+E$8+E[^_]äftu.u=뫍]$U "MAyEffUWVS,Kbu EU܉M؋M@EU܍]M썋]M荋]M< t< t֋}֋} ֋}O]E@U䍃]$Uu< tt< uJ,[^_]ÍBU$I/U~ƃ}dM dGtUD$]$UtBU$.U~uFJUD$]$贴U- ]t }uWEHB U$e.U~uFFUD$]$-Uts]ujEH@gUE؉D$E܉D$8]$dzEHU%E؉D$T$]$蟳WEH ]t' ]uE`EHuEH@uEHp]u^MԅMD$$Uƃ>Uv?t$T$U}ԍ$vƄ7U]u^EԅD$$Ukƃ>Uv?t$T$U}ԍ($ZvƄ7(U ^h D$^D$$UUuEH2D$!D$$U豜U E`UVS4Sjp $@ftL|xEEE%EEEEd^D$D$D$ D$E܉D$t$st4[^]UVSo Et4D$E$^EEFEF%LfF [^]Í UWVSxMdo -6EEtbUD$E$@^Ef3EfF}<$D$t$<$|$4$F FUM+ ux[^_]Í tJUWVSn }x$NmLJft/1t$mDŽ9Ӄ[^_]UWVS7Nn u4$`t&tuOxu:<$džt$džf[^_]É$}l뼋|EmJ9Eut$ZlU°m Et]Í)]U{†m Et(]Í^]UWVSu] }4$sfdž1~t1҉u뀃9t`t[{uMt31sqsqs q M31sqsqs q 뀃9uuF [^_]UWVSël ED-61u1D$Ɖ$m.F u uD@@$D4$^4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$?. WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$^$蟅 w`D$D$4$*pƇ_WHwDG` \Dž01'< t4t 201Ƀt+9< x< t&uuDž(HD$$聮8Dž4DžLT,, 8D$ D$D$L$s<;t<#tL8domaL8searL8nameL8sortL8optigfxon[xsQ< t< >D" << ufxinE< t< D(< t< t< Dw`D$T$4$mƇ_8^D$4$\bDž0]t DA 4DdLʃ Јd8$zD$D$ $/fx8$k,D$x$Dt6hlp   Dx`0DHHp`pD@H@`tX<.ǃu~=D$.4$kDNLFHtD$.$kNPFLD@W^$Y…tD2DHu+1V[^_]Áxservfxer< t< 9< t< t6^D$4$@< X11rDž\DžTD$59 D$ D$ D$<$PD$ ,D$|$4$}PB=iDt/Rωփ]tftPB@Dω f fu$0P@~N <9V)<9V)1҉=tftH4@ Ɖ);;,h΃r낋$@ $LDž褏@ D4$#@;c‹ytft‰)‰DžHtftR<lj);44$E@9‹yUff PD$l uKu2kfM/f릋$~@ Dž}UVST 5t$&[^]ÍHD$$Ԙ[^]UVSg~T 5t$}[^]U4OT U]UVS2T ut$[^]ÍHD$$<[^]UVSS ut$_}[^]UEPM¸t]ËE@ ]UWVSjÁS }E0upq @AHD$$芗ƅu!yH L$UT$@$跭tEG D$GD$ GD$D$4$u4$|G [^_]É4$f|[^_]ËG [^_]UWVS åR E`;68 ˆ,:)lj}싓\ u2EL L D$T $: [^_]Í"-t$E$Zt$X $>t{\ t1=T 9txED$D$uًED$s^D$ED$ MmD$^D$$ [^_]Í^D$ED$ MmD$^D$$諢 [^_]ËED$^UWVS %ЉD>T>UT>gHL>@MAD>( A, e_E։‹, xyt, =w ]; `et, =w ]; 0 tG~j, LJ, , yU U;, gU썇u$ 0 ULJ0 < 8 M싗H 1ɍ_]MEUtwM<9ErMt< E艇H ,[^_]LJ( 54 LJ( D>ED>ЉD>UT>g e`f9D> wU0UD>HL>PD>HL>( Hf;Ë< ;@ m`bH< PH HH $ HLJ, 0 f0 MULJP D>UMD>ЉD>T>g eف9_`bLJ, (LJ( D>ELJP D>ЉD>T>guMUD>@ND>EUM7MUEEE܋E䍇T $F6UM^D$1ۀ} ËE)؉D$ MmD$^D$$ÜUMLJ0 D>EP ]X2 E쉇P zLJ( D>EdLJ( D>EN$ T LJX LJ\ LJ( D>E`bp< zW8 XUUx~, Mt < H 9@ w t^`b< H< PH HH $ Hf #E쉇P FLJ, ^$1ffffffUWVS,I Eԋ| ` u苸 }9x uЋt }Enu܍`l`j k]؍m]ȍlENjE]]Ef[^]б7 迱7 l 讱7 h 蝱7 p 茱7 ` Ux7 U]U`{7 Ul ]UHc7 Uh ]3N7 d U:7 Ud ]UWVS 7 u"$  uމ4$݂LJ LJLJ LJ LJ LJ LJ| LJl LJh 1[^_]USWn6 E$5z[]US4K6 E D$E$~[]US !6 E$[]øUS5 ` D$ED$D$ MmD$iD$$[]UVS药ä5 uD$4$Lff D$4$/L[^]fffffffUVS <S5 EpFtD$D$$9F!u  [^]smUWVSӮ4 uMD$ ED$E D$E$腖TDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$^DžH t VV€ʀ UTPlD$ D$D$T$d_M L!ЃP Lkk0<$EtT$1k01[^_]qkfk0DžTGED$D$ D$D$$}DžtHƁ   PxD$T$J*E EЋP. <GH9GG B1G gGe/G:GD$D$L$|3PP LLЃHD$PD$L$5H{r  bD$ $Hi8PL  PhkD$T$WP ƒ@ uD31 lPP D${2UWVSvÍ0 }EpFtD$D$$H4F xn  D$4$D$BUD$4$N(UV$ED$E D$ T$L$M4$3 !@MF[^_]út9y  u+T$U4$Džut U9B[^_]ËE ug[^_]ËtF(V$^F(MF$PGD$D$$2[^_]UWVS蝨ǰ. EpFtD$D$$l2FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$h !@MuFЃ[^_]úЃ[^_]ÉED$D$$1UЃ[^_]Éf뫺UWVS$`w- }9UEEEEE;E E苷}u mtnG$Uuu}EtD$D$4$YD$ ED$ED$<$0t|$[^_]Éu}D$ ED$ED$<$P0uǃEE;E 71$[^_]ÉD$$u…tE9E v $[^_]UWVS( , UE䋂Euu܉;E E苏EHMU$SƃUtS9Etxű})lj}苊U|$$(tUE눋E})lj}uf ([^_]É׋EU)‰UD$ E܉D$ED$<$.uFEE9E 1([^_]D$ ED$ED$$U.Un([^_]UWVS$rÉ* M9}E U䋑U;U ;uUUUt/9wt#UD$MD$<$VUMUD$ ED$}|$ $M-uv}9} MUt9v낉1$[^_]Á $[^_]ÉD$<$f}~)ʉL$D$‰U$EUfFMA)‰D$D$‰U$EUf>fL)fD>fT>[^_]UWVS5L E xfEEETf}tU)ƋUJ;MLW)ȉD$ЉT$ΉMȉ$ E9EU|HDU+UU\Wff@9tPHftffP9uEftWf4T]TfTEfEh8E H1[^_]ËUƉE봋uv E D$E$[^_]UWVS$֖ E}EW u}EGE9G ED$E@GD$M $3E$[^_]dž(Efufdž $D$ |$UDBD$4$d…tMME$EREyD$ |$UDBD$4$d tʋ@f8$dž @UWVS( EE} w8}܋PUEE؋E@E|F5U9vTF)ʉU|$E܉D$M$])}CUfFfۍD\M)f fTNfDE D$E$] E M5|>fd‹M9vfU;E@L>f+MT$UE؉D$M$]UU)UMfL>fD>}f)|FfLFE pH|FU0M9vʉ;}|F)ωT$UE؉D$M$]CfUfE D$E$]VE tUU؋pH|F([^_]1TUWVS8O E @u E1SfUDPND$ t$D$E$Caƅt|$E$FfUUPMuJfwfu Uf|Pu E|U RME @EfE@ =fEMML )ȋMfDJMfLBE Ht$E$t9t|$E$Eh81[^_]DHfBfBFM Ac[^_]fEhUWVS} U EzMq uf+4GMM9U t$ED$DM$]u)uD$ U T$MDD$E$r_…tzxEp uf+w;ubLf|Go;uu-t$ED$WUlj<$c]Uu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVSx|Ï E 'D$ D$DJD$E$^tDP2fzuft,΍< f}ED$E D$<$]@fEfEEE܉D$t$<$]EEEE܉EFEEuẺD$ED$ED$t$ D$L$<$]蹐…D$E D$<$]QtX@fE҉ED$L$Mԉ<$]MED$L$$]Uj`]UWVS(r uExGtD$D$$GF!9t~rd;4D$D$$F)L$L$$!%E䋇E} v&0([^_]ËME} wڋUnE 0t9  ut$<$tH9s`!EEUU,D$ UT$D$<$EOH9r!<ED$ ED$FD$<$u@}} uw$ D$E D$ t$D$<$f([^_]G(w$E 0EE 09뤋$U]:E\UUT$L$$=#H(L$$>…FE$ Bfff]]fffff]USo ff{vqle$Y$Mffff@;61,fff]&&t&UVSo EEEEjuVj uǃ H+6tjjjyjVjQjj UWVSEE] }3t>uOj/V?3ZYtp t0MPVZYMu}] EEAe[^_]Vh4 hu h0,7UWVS ]u 6ְYhz VS" tful5D,ۋ= ,)]uo=D,u h} PZtD, D, hj5D,H@, @u5D,h j hZ1Xu4&h j MWRUjZYMtCUk uVEHPW P-Rh j UWVS] 3ïh3"j Ch3"Sup!@t h  ,DP$d,Yu d,R$h,t, 5t, jjP1h, y 5d,@,'@,&=P`+v`,u h j $,u#(,$, 4, 4, ,%H%hPR(, yT4,P,%H%hP5$,ң(, , y5$,h\#j ,&,%,u-,uX,H8&@,uj,H X,,9ʡ,\,s%@,tá,,%,t@,D,,,p, l,t-0, ,,t-,%h=`u= 0,, , ,,,%,,RP5(,4,P ,t h  jh,=h:jh?jd,h,l,`,h-P`+PP`+_,,, t5,=,5,=,9ss X,D, u15X,5D,5h,t,P$ uP,T,Vd, rPPh\#u(XZ`,u5j5\,5X,5h,t,P  t5d,h\#2_X,X,\,P,T,H,L,B5X,=\,u}5H,=L,9Uu/9Eu*P,T,H,L,,,T,t#EUP,T,׉5H,=L,P,T,H,L,,,,t7H,L,, ,j#H,L,^s/5P,t,,D,VRRO& P,D,,,=wu!=Bu!=^u!,t=, ,9ȋ ,,s")1=,,,, , , ,t j"[\,5, tJ ,1=,,,, , , ,)։,5, u=(,uj4,PY@u$8th 5(,4,PZ@u h& jj&UWVSX ] 3h3"jE< h Su G-$ ,,,,,,,@,t,,,Q,B,,),,,,,,,=,thE =l5tu hj j21nuou,j,PEZYFt@jV&2,Y^u hz I8pj,W_Zt x>Ph h0,-j$,,=,t t$h @ ,th &, ,jW,ZYu hp ~;T=,u6=,u-=,t$=,jW[^ 1Dž=,u ^=,t ]\1i =,\t 1Z01C PUvjZP0P Ct 1B 9,h u)V/ZYu h j,RP]^_y/u$`u /ui, RP\uZYuh=,i =,t& rh#3h V ?Ƥ/uh#V3h VG=,3h\#^_=,t4011Dž8hhj$P( ,5,8i, Dž;2t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t/=,t&,,=,tV0%$C19,vi $Cޅ(=,hI -1e[^_]USEEE EE0Z1҃vU|r҉T#,UEh RP- tvpt.Et?SuFH#,Ƀstxu0B9l#,볡l5",L#,P#,Ph h0,' jE ,EE)ЉEEt9E8-u/L#,EH~ ,)EEEHEjJ$[uYhjPXZjjEY[h j7XZh#,͘Yt1h0,h XZh rqY$hj[Xu2@#,EteE8t[E0:]YtLEj0AYZyjFZrE8!Eh0h@", Eh0,h YXE8tjZugh" pX`#,MÅL<vh0,h XZjYy =h#,th$,h"h0,% ",u CyPh\#"[Xh,Xua=\#,=L#,h0,h XZh o$Yf%,\#,Ox#,| h xo[f%,&V]Å1$",SPP:Ià j\#,h0,h AXZh  o$0YQ=h#,ujOj[uh$,5",h' h0,p$h$,h"h0,W$ 븃=h#,ujo/h$,5",h' h0,($UWVSXu} 7h؅!YZu{  ful5h WV utt ,)NvE8}WZE1  tAB;EvEUPQMW UuMt6QWh j փ빅u Wh AE@t1j URPE ;F|E8tEph jE1~PS?YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmWB UWEffEERhm+fEEERhmW 1!EPhm8@W x E 6Sh!jf9tfuPh EPsh KUy!}K U } }uuuuuh $uuuuuh2 uhP  uhi XZQURPW x%uSh ] ,URPW ySh\#jPh jjUWVShu EE1ۃ}~F8-tEh _th PZYu X%,h \_th PZYu h& K_jh h !EPuhB z0蚸EYt/tj@uY[t}u U9sUPUxt}uEE1ۋtPZ\tSoX\Et'U)RPSSÃ~t C}u"hY hs$HMEZYu h 5}uEEuhT%,WuuEpEPzv  DGu΍EPEPj =X%,t}t.D1}tEܮjEP4 " GuEy h!j>Vh~f5T%,>Vh~fS2SMUEy}u j uPXZjUE 05j鴕UVSEU zJ `:,ueE1ۋ4P!Vh^"uU(,H,Y^yh,j XZ,P, Cu 1e[^]ÍL$qUWVSQpq_,_,_,_,_,_,_,_,_,_,DžDžDžDžh*!Vm @0J9$!a+a+a+a+_,jP5l5N@a+ :u]5l5hB*!H_,>_,/_, _,_,_,_,14$!4 !h^*!C u_,_,_,=l5j/W#Y[ÅtC?t tD@tNj/S_ZDžtG;t t@st j/WZYtA?t,t@,t9_,Ph_,h_,h_,hg*!5l5#ul5<t hr*!=_,H_,9Ph_,Ph_,h*!5l5~!l5<u_,_,9v h*!<_,=l5j/WaY[t4PW_Zu!%=@ul5a+l51>,_,ha+a+l5_,O5l5x[@XZLa+:,!jPRa+ @u 5a+h"ǡ_,t+P_u 5a+h+!@ b,ea+=_,tRPdZY@u-5a+h+!袩^_5a+a+[E̋UЉthRP5a+h+!X?M1EU \b,1`,Tb,_,Pb,Hb,_,Lb,Qh b,hrdAPU @u;5a+h+!h b,hedA5a+*@u5a+h,!5\b,15`,= `, Tb, `,Pb,`,Hb,a+Lb,`,?w `,_,_, 5_,=_,_,tJthSPa+ @u=5_,h\#5a+Ca+ a+a+ja+~SE>,Yu Sh,!j `,11t l @_,1%`, `,^,%_,t#_,`,_,_,_,_,DžDžjjVjjSTo>,Zu ha!j0jjVPjS賺y5>,`>,Xa+j/S ^_ޅtp}, 1ۍt;}fWQݿZYtuMtGkT ƋF `,F_,F_,VF u_,_,eCT뒁=`,w=_,w =_,?DžDž>,tx8 1ƅƅ;}-p9wƅ9rƅG ˀtt_,? _,k?\b,1`,9v`,1PP/GY[y u&)PP^Z+Ӌ)ӉӋ)Ӌ tA t;PSQË u@ =_,u h*,!M9[=_,_,_,Љ_,_,=a,t4a,a,uK_,=w:Pu3_,,;`, `,}_,_,a,Fƒt<tb,~ދN1ۉ :,:,F 1ڣ:,:,a,5:,DžDžh:,@Ph:,X C5:, 5:,:,:,.@u$h(!7:,:,Yȃ<t̀t<t <uuut71Ӌ19 :,:,[:,t.192DžDžf=a,a,a,t B1#DžDžBŃw 1҃.1a,t. a,t"Jua,1҉q@u :,:,19}Ct1t(ru1Ӊ@DžDž_,=_,t u$a+9:,"Phv,!_, _,tO_,5a+=_,1RP1RP h,!Zt=>,>,;8u h,!fX5>,FV=a+RPSQ3Pvvv Wh,!QG ]j bX`,1jhjjjщ¸.-!b`,_,1jhjjjщ¸H-!;_,(_,1jj?jjjщ¸^-!_,hv-!qQ=a+Vjjjjj1ɉu=a+1tj a+_hc,kƀc,Džtc,$A"hc,bZYc,tc,1ۀEu @tj tPt-thA"VaƉt>tFhc,h-![^h-!h-!h,jdhc,3)hj !ۋuw1ۉ_, _,ua+=_,=_,a+uÃ=_,uMh-!Ytpjh.!XZؙjjjjjщڸF.!hv-!tt ShW.!^_1a,@u a,_, _, _,1?=_,>,Džt~ Džht.!>ca,Y=tk jhjjjщ¸.!+ƒti¶ fa,j:,DP_ XZh.!bGjh.!a, 1DžDža,tK>tFVh4 =a,1ҋωT u9u @ua,1;5:, :,؀tet\Ph4 a :,1ڋ߉T 9u9uFtDžDž19~JCVSh/!7߉D 9u9uF뮋y1RPjjjʉٸ /! TljW f=a,Qa, !t!u 9rGD8yGa, `,1ƅt6a,t-u9uu1@ƅ $uta,u a,q:,:,Dž9}ɀ~.t/>t*1N219u9ta,믡_, _, _, _,=_,uYh4/!,_^=_,tiL_, ^,t h}/!_[h/!YtM@_,^,2@_,~ h0! -Z^,g~ h/0!,Xrj hP0!j1ƃu hO,!e\b,11;\b,ǍPP ZYx+=w;uv=`,_,5_,jStP 1eY[^_]aUWVS}] DžDžDžDžhB!SW rfq1ǃstwDž`j P5l5%l5 8uPh|B!1:u8"ZM5l5hB!j Dž,Dž ,)OtljhQP2#Ãy2h@d,hedAP y hB!=d,Z9 Q@fd,V1ɋXtxjh@d,h,Rb  u hB!t oB!u3"PhB!lZYDžfd,h@d,Pfd,h@d,-k~PSyhC! ju"PhwdS h$C![XS脸1e[^_]US] 3vSuUS] 3vSun US] 3yvSuf%UWVS}u DžHj/6@Y[$f,t@$f,~ Phw^!XXZDž(Dž,DžDDž@Dž<Dž4Dž0Dž8h_!VWà A6$@S!Dž= f,j/WDYZu]Wh_!h_!hh@f,xPh@f,c@u"5 f,h_!hZ$hh@f, f,@f,=tj,hj5 f,à 0tPyphh5 f,蚲à x29=pj,~hPSG jjjS!y 07P5 f,h!Sj5 f,2XZy 0P5 f,h!SxPWMZYy 0P5 f,h!S%= tn=t5 f,h_!XSY^h$PXZDu DžDD1RP=Dj,uFDj,PLP5Dj,W5 f,@u5 f,h T!j u6h_!RYX4u2h$RHYZtRh$6h_!dRDu TDDa+Htpj,1Dpj,5pj,4t(h$P\XZt4#t;s @u%9ы@Dž@ s Dž@@1ɾ9։s+@ u"9s h `!j}h6`!L!^u t/u !<1󫉕<Ĝ}j2~~W~~2 ;~}|Ņu4u Dž(@6Ew Dž( Dž(Dž(Dž,Dž0Dž4Dž8Dž<C0@hhTi!APƅAECr rl5}CrWl5ZtWu$"[u jjXFDžHwstduPh!. R$Yk-HRPRXZu-FFDžGXt =^@Cu+K x{,h!VS P5v${!|{,j P5l5dvX{, :t5l5h!h !W5l5,Yu5l5h+!h{,Qt{,Bl52 b+#`{,tRPhH!j蕱`{,b+d{,h!5l5 {,_Z5l5hq!jgj P5l5Kub+ :t5l5h!jph!;{,Zp{,Kl{,<`{,u hԀ!j貰= ,=d{,ujEP5 -蚇 f=+t!} t3"PQ!cut8l+u߃EE5<+PLZYf=+tCۡ,t ,fEjEP5 - f=+EPڿX%hH1"jNUWVS E 0d< -W10--hA"_Zt A"L-A"hA"љ^tTL-MBugl58tpjRP :uS1ҋ -buV4-8- -hB"u udà uC$@="5l5hA"@-D-먃 -륃 -뜃 -듺A"l5낃 -v5l5u#hA"h="hW -hA"VY[ƀ>1hA"V(_Zÿ>"SRVg u<̋5l5uhB"h="hKhA"1k$-t!VPpYZuÀ-(-GhB"VhB"jҷl5ԕ -a= ,u) - ue~Ѓ=$-u,P3Z@u hB"j苕B"} -$-Z!Ãt~>"t%Ft!á$-0RhB"  s$-0hC"_X s$-0h$C"Y^t ShEC"XZj uhrC"tthC"jj臶E ~C<-3hRǃ u R3h!xPhP責 tlj=,- -u %"1H-hPW.y0- uR5,-hC"jh4-PMY_@u5,-hC"(-t&h -PZui(-05,-hD"j}=<-tG(--(-8u5,-h+D"jNh -P_(-u $(-ȃ8t̓=$-uhRD"h="h0hjs4x- u shjD"h-P_ZY@u shD"-%=tE$-Bt,=@t shD";5-x-_ shD"C- -5,-hD"ź(-ZYtpp 0h E"診 -uB-%YA"=@t3"mA"u-ufA"RPh?E"[ <-t PhZE"D_X -$-th -P [}A"8th -PYA"#Nu@u hsE"jyh -PZG!u RhE"<-%=u50-v_@u5,-hE"@t50-;w^@u 5,-hE"-tPw[@u5-hE"jj޲h4c%V肥ZYVPhF" & - G -Ou8=RhA" 8=tRhB"\[^뺉th4c%VZYËtt ug(Vٯ[VSYwhԡ!jPV‹  9w(<,tuxG -=QRh2B"NVS7hbB"UWVS}u 1ۃ~^;-t ,1Dž8Dž<Dž4hQ"VW腥 t]it Dž4@+m:;B uBul5B믃PrSht#hQ" 독u9dx1jSV{CtjjjRǃuhBL&VhiP @u hQ"j辎WtY@+7tvFtjNt^HuTgItBQ0-Z.0QXɋ0u hQ"j謢돃넃<t34t8tzjѯiul5IouDž<5DDž8=US] 31h3"j hV"Sux Btb$V"jj5l5JQ-------q-b-S--:jh,$YX'-QPhV"h0,辷  ,=-tBEEEEEEPj jq @u h j6- - - - - -tSSɧXh,ٜZu-]UWVSE 0/h3"jE 1DžtDždDžp11jh+hW"u uPt!HLHl5뵃xe~P$V"Džd눃RtiX ,lM lL9-uQQ9uIyuClJ ,413'DžtDžp ,U)tuJu蘧pt.tt hW"jJDžl@bt1)ttDžl`Džl@bM 4u0Vh6V0XDž`ۋhu4VhX"xPSZY@u Sh+X"jډE`1jWR!Ph 1uh^ZSP@xJ9|uW;uSEJ9MuH;B uCsh+hY"CP@% =@jStQGB%=@t4M1@u#sh+hZ" 1Jl΁@tjw p,`bu|u|t{DuPS迠ZYi PS[sH (- -u)fNush8Z"Y^jStP fuX58-V8-@-hXZ"hX"h6nU@pfug=-u*8-P8-@-y+hZ"hX"h?jRaZYu5hkZ"tiCPph+i^X1SshZ"ZY8=(-PR4=(-PR褥= -h+shM! q8t hEX"jtIWeDžp=(-t,- 0-1P6,(- -:DžpUWVS|]u >j/WDYZtxh&WY_Zu^h3"VS @ui ,)Ãu]p0fY[@u jj~je;LtEPtLFu'|$.ht]"VS蒔 w~Nfw$\"p$.p$.$.t$.d$.x$.t$.$.rl$.ch$.Td$.E ,4)Ël$.-`$.u |$.&=|$.u=t$.u$.d$.ttu# %V1ɋTP|=x$.xt)SWYZuE%=u SWXZt Wh\#j}E%=@p9tѣ ÃS豞UWVSu 6 h3"j6jЉÁtDžlh$Vuy tVmtDžlptc5l5C#Yu5l5hX"jD|hP!tW} 딡 ,p8th1lh7%V'YZh7%VXYZh7%V YZtthdPSYZdx0tupplcdxPSYZcyd=E%=@t Ԛ!t/tSd^Z@lSh\#;Y[lTtS^Zx,t2tp03dY[@p0h\#;;XZWGUWVSu] 3h3"jα ha"SV4 tZit)ft8huY8%.σvuH0%.<%.4%.4%.<%.뒡 ,)ƉlN4jjx,%.hjn =8%.tluˋVPelTtP2p-Y[u|%=@puh2pQɎà =pv2h a"jxȉhtx/t>hƄ/C-@PRh]zu8Quth"Xt@.؋Ht ʉA?jo£0.[y<. 8.u u1=(.t =$.t@jPW"7ǃ uh"C =<.t.u)W+;XCHHf $4"PDs bPsh!j2p=<.tC ?uts !Psh!@.k=<.^KPSCdlHjSW?C C )C  Cu>=<.tCHSft.wRfuIKPSCkuszR"VY+=<.8_=4.usqZuC1lt=<.͎8g迎8?Y豎8F螎8t hEX"jnW68Y_xVSYZu8=(.tCj藦PSh!D@._u=(.EE%=@u"=D.uSh "@.XZ묃=<.u=uE%=uST2ډvjuq=@uS~=4.u S ^tXkt:=<.uSh\#c.ga8S8?E8u=,.SY5@.-sh\#.@.XZ,.  . .sXs1e[^_]UVS@jjbXZEEEEjEPjP {{Y¸9u 9E`.j jR[^h.H h.jd.$3"jܣXZh"Cn+E$.Y4.tt6Hu=P.1/...E .P.4.t.U=+y=.lcȚ=4.tEP X0.,.tA:P+HyPyXP+H J hl+yXqEHm8../..JυEPXu u*XZu u҅Y[}um=+t,Eh#"^E=`.u PEuE=+u}rEj^=+'7=`.uh 6[u<"jh0"PjÃPc$Y|=+uL=`.uCEP$:"݆Zu EPkX8tEPR[$XE.1ۀ=+t$=.uEPX.+u'j4"l^XC̈́RPZY=+=.ԟ+.5P.cvh4!x$l+iwXUWVSpE 08 h3"j~E , 1 ,] ;E9h"W ZYEW/_9Euph"Su~ tZftatDeuI렃gu=j5l5MEZYz5l5h\#jRh^ ,E ]SugZYy h"EPhBt @u!{ y h"(X}Whht@uz y h"(XEPht@uz y h"m(Xt$FvE 8uVEPuWSŰS;YEEE 8URu VȭYZURVYZuURV轮^ZuoE 0,DPt"Vw PS>XVSGXE9jh"Vez uVSEZYVh"{kE E}tSju y h;!jf}t Whgtuy y h"*'Xj@UWVSE 0 h3"jʝ!+0. xo4.1Džl1DžhDžt11ۉpjh+h"u ugtpt}RtF!LtNt0Hux1봃Pthht7vtj j5l5Uƃ u跀8"u 5l5h"D5/j j5l5ƃ t 5/q8"u5l5h2"j`j j5l5ڱƃ u<8"t5D.5l5hK"뺸o5l5`^@jfS/R/C/4/%/t9躶 D.v jh"uh" |/tt h"jV_@.p/ƃ;5/u;;/u.t/;/uq/9wu ++//5/tPu=/ۃ ,M)L„t =/<1jhh`/P7rPy h`/=/u>xPP]ZYu&%=u//w.$"L1/P`L Ph݉!_^u{ h"Phy$hS貄SǃuSh\#EY[hB!P\kXZthW=Fh`/h/V5H.h/V V#nXDž\Dž`DždDžXhVXPj@ Džy0|8#tjVj@h!j_jVj@kPCkPalh"^ƃu"SVh*%TPTu hR jjPh"h*p$h*p$ZÃuVg^SM9tTPYyjVj@TH  hh!PxXZuPh\#_X/e׋H虽Vl^t+PVuP赽[DžLh"较h,O,H,ZYyh,vmX,P,0t- t( ,y h,Bm_ᡀ,P,΃߃NPYLLP=L/u L/ =P/u P/ Ph/XZL//P1=/q=/t /ɲ,h`/h/h,\5H.h/h,h/7_pdL hh!wn[^uwh\#j%谻Dž DžLPhmdP& h"j`YLq_WZYu Wh"D/eȺ/t jSRE h/'Z4PVzUWVSjj]Sjjh4"N-@u h<"jXũYtjjSPjh4"-@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQ MQh\#聀U1G맅u) ,yh,j 赅XZ,P, 1e[^_]UWVS uƅ]-ƅ_h/l/h/p/t/p/`/d/`/1h-"u Vom ycPtJTtgP$`" P /뭃 P / P /  P /x P /l5l5VX /Ygl5:Xj:RXB[ZXuh"]Hp/t5TRX31ZYXTu C[Ǹp/=h/t hE j2Vl5tuhj ݀nuxou|+ |+h4c%P@[_t3"h/֋=l5X P /L3"l5`/2h"Ph "h0,ʀjmw^]T /P /tP /P /t X / ,M T)tPDžXhq h 5X /R=XRrRh"RLv/ZYTLS4jjLRPV9X}XTPT0VhPHà uj/SzZYuSh_!hZ$hSX{V?Xu"V>Xu9S>^ty2LhVGà LVh\#juh!LRZ.ZYh"LR?.ZYSh>"jjhVjSgǃu Vh_"jpSh/hzd@Pqf uWD9X0 /`PhedAWGf @uVhp"W9VrH__9~Vh"(xuhCl#S_XuzkhdX$SrZYuhg#h`N#hqPƍH_v󤍅PhiSa @uh}n#YS;{j fVCZ thn#hPN#hihg#KVF󥍅Phui S@uhn#vUjm Zt hX#jCh h /Hh /裆 Uh+h$ /h$ /+h- h4 /h h, /h4 /= h, /MXUh`+h@ /詅h@ /ׅh@ hP /謅hw hH /諅hP / hH /XUh`+h /Uh+h /Fh /th /jh h /? h h /h h /,h /jh /Ch /sUVS8GRy h|# Yh?$-%Zy h|#Xjh{#o[^]u[jj Uh }# U u=jh|#}oXY|#t|#jh#h}#Ph& h*p$j 7jSP @t-Et Ph}#J^Xjh{#oZYtj 7h,}#%j 7 += jj h* 2jjjj j jjjh 0jjjjh jjh EEEE jjjjjjjj j j jjjuV8jVj$EEEEEEjSjS7jSjI7$jo&jh&ja&EE EjjEPEPjEPƒ$Bu_8 / +te[^]UWVS}] DžhDžTDžPDžXDžL1DžH h#SWU ufFt4RnDžLgV$D}#DžL5l5HYu5l5h~#Ful58#t5l53>Zu[ j dR@P d:u5l5 PYp5l5hX"j dR@Ph d88ODžX$ ,)Ǎ\X= /u= /p1\;= /}Vt VP[Zu?Vh\#eFZYt Ph"#eY[Ft Ph6#eXZj d[G 뚅\\8rGv \jfLP`ZL`%\QYYzu?ctptbu.` `*`DžXthF#hf#jc4hWSIj/SEZtXSSZPP1ɉrQ19wPR9wS)PYrjPÃh /hzd@SF uSXp!/=p!/^\PhedASF @u S`[?SWWRDZYax%9}(@uh(/ht#7='/u'/u hU#j tT uh(/hl#u.hT$P^_(/thC!Vh#j(/t('/1RP5'/5'/Q'/'/'/'/1;|i<@ t" '/1SQRP '/'/19| h#t0 '/'/9sSQVRPh#jtSp'/ '/ '/%'/RP( @u&5'/5'/Vh#j0P襎Y[@uVh # XZ D61DTZY~93<616 4utlPSh#l1 +TXDTpp@;T40pf@flX40Hff9lu `+30 403030 30u30P40P@P40<61Dž`Dždh sCp@`p@ h`ȉEEhiE'%Utpp U30.ݕ`(40(40݅` 40 40h+ܝ`v ݅`h+݅`040040<$ #jXp:[(p@<$L#h#Dh,#:hI#0hj#&pf@fPh#h#h#hؿ#h#h #h!#h8#hH#hY#hr#h#Ph#jXp9Y6h#.Xp 0jXp9Zp@<t%w uh#<uh#h#.Xh#Ph7# .^_p-PhN#0jXpA9[~pf@fp@fRPhc#- jXp8Y+h~#jXp8Zh#jXp8_p@t <uh#h#-^ Ph#-Y[Xp.%jXp=8Zzp@Ph#,XpE._XjXp7^1h##jXp7[ h-#jXp7Yh=#gjXp7ZhF%DjXpb7_hQ#!jXp?7^|hf#+[Dž`DždDžlqjXp6Y5pPhy#u+XZDž`DždDžl<61htXp+DžhDXT<wY<Tp{CP_=Glh#*XP +P\kT1 p-ōCPCTw{@9~@@Xl;30uSSh30PC u;lt h#)X@H)ƉTP.3030NjP󤃽lu!,h#)XDžl h#)_P).@P\kTDT 0,뵃lh#)^wluRDppf@fucd`VhX4DžlPh#(ZY DžTTNCPTP[lt i+h,X.P40;`40]%=61C؋lflf`61!htH61PP40Džh%lflf`6140@Džl9Dxpf@flfufbd`WhXu340P)؃t0(u\461Džlub<61t@461h*#)461Džl u7<61 t 461hU#&XRSh#& Džlhuipf@fPffX+f~8<61t1KQ@PRh#d&<61t 1]*ufX+<61u[luRDppf@fuad`VhX2Džl551F9X<6151)P50PpDP#? a9~p508DuC烽luODppf@flfu<`d`VhXK1pDP50P+51Shھ#$51;51}+u h$$XpDPhy #$C^_Džl)Ѓ EMQMQMQMQMQMQMQMQMQMQMQMQMQMQMQPh#R-Ƌ5151H19}L50@91B<61h߼#$X95150Ph !#CY_UWVS} ^À8-uCh!S^Zu&d>1EEE+h!SY[1ۅu`>1Eh#Wu tWdwA$#փEʃ=d>1t 빁뱁멁0E듡 ,1;Et`E1WtUPZU<R%XEtPVh$VED>7tj&2Ph\#j}tVSh!j }DžuP_w#t8=d>1tj jh!1Wh#=`>1t j jh!1Wh#j728j jh!1 tVWh#j2Wh#j1 h3"h!h"2jjh3"h!h"2 }uvjj+jj"jjjj jjjj jj4@u h#jjjZY@uz8th#=j走X}uj袰_j jZY@u;8t+h#$Y2 u h)# OZ W_XVShP# 0$0jjuƒ #Bt3"SPhZ$jUWVSDu]  'tA1h$#SV v~jq cStITtbLuA1뼃dw$#A1A1A1A1zpA1kA1\A1MA1> ,)ƍA1=A1tjjh$A1 >Ejjj"ܺA1jURh@hP @u h9!%dY=A1y hBL&j;u=A1% 2 W:Z) (    u /  =A1t1ɉڸ.3Ehj %E؉Ehj$E܉Ehj$EȉEhj$EĉE hj$EEhj$ljEhj$EMU ʃ} ʃ} у} хuu hd"EA18gtj5A1!Y_EE3"E3"FEȅ-CEċS:-8BRUR9ZH3U$H#A1"0+A10+A10+A10+ A1u|A1fxA1WA1LD<1&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸouCEċSEP1ukCEċSEPM̸2ECE u7CEċSEP1ɸ2XA1uCEċCUO(EuKMċ[] t\uc0A1hwO$#(A1M@A1AHA1 5PA1@)XA1`A1u1 8A1 A1|A1 xA1t  A1 $A1t |A1jjuCF RmA1u#EPM̉UK1EXUUuEPM̉UR̓^uChi&sZY=A1uh#h#h;%G A1FHw,=A1uh5#hP#h;%G A1SEP1ɸ0^]ċuA1Muhl#5];au uh#"A1EġA1}t]ȉ]th#j\Mu}t }EEă=A1uMEȉE E>11atctgu<E>1E>1>1A1@A1>1A1>1>1 A1A1>1U9sHxt)ЈA1t`E؊HwuF:T80D019w)19w)1ELE؃9vIJ >1A1tIutHXSVh>1w>1 =A1t=pA1u #3&A1tAutHxWVS) =A1t=pA1u #%A1tAutHxWVS߱ =A1t=pA1u #%A1tAutHxWVS蕱 =A1t=pA1u #U%A1tAutHxWVSK =A1t=pA1u # %A1 tAutHxWVS =A1t=pA1u #$>1f>1=A1t!=pA1u=A1t%>1'=tA1Sh>15A1ƃ  87t $Phs#CXZ 83u =A1tHt 8tupE1t&hv#S^_th_#SZYt2=E1u)U E1;ujOuShD#h0,PSha#h0,@j =$E1u.$E1hw#u W t@9A3w$#z=$E1u$E1먃=$E1u$E1듃=$E1u$E1{=$E1u$E1c=$E1z$E1 G E18 E1)E1 E1 =$E1"$E1@ E1E1E1E15l5E1X=$E1$E1=$E1$E1j=E1l5E1h$PY^>E1/=$E1F$E15$E1) ,E+EtH:u =E1= E1t =E1=E1tEt hv#WYZt&h_#WYZth$W_ZE U @-87@tCƀ5E1jj5E15 E15E1?xag5E1jj5E15 E15E1?>5E1Sj &Sh\#jjE17z8=E1jEPj @u h#ǦEUuuh#]n[h`RPXh#-t S2nYxE  1SQ%RPh# G1=E1t=5 8ph[$V_Zt#h #VZYtqujSh# j Sh# jUWVS u] Dždh!#SV t"Rtfu0HI1Dždʡ ,`19eDdmPW3ZYxPPBzY^%=`=@uyhDuyPh$#:XZ``PhW :Wh\#jWhCt hsCƅ_hh>#hW l=HI1u Džp#lPWKQYZ8t WhH#XZ5HI1VY_@Vh\#ң؍e[^_]UWVS`h3"jp[^E 0i1t2$p2$l2$4#_u,#l2222P2L2\22,2x2i1d2`2 2$22 2 2 2 2 2 2 2 2Dži1x2m1hB#Yt/hPhm1 =vj?^$ShH#:"1h݉!8Z 2u  2{ hX#Xh#S^_u P2h %SZYuP2L2Qh#S^_u x24h$SeZYuP2L2 Sh`#97_X^h#PY^uP2L2h#SѺ_Zu x2h#'^t2t8u t23"=x2tt28uh#6[x2hE%Yth7/"PW_Z1ۅf,ftP^^202,f,ftP5Yt!2ut ,2i111Bh5l5hm1 =v#j?$$5l5h!jx2U Eh#RP hP̃DQ$#x2L2P2 2jP5l5蛢 +t8u5l5h# 12S 2D25jX5l5ZGi1=i1 225l5d2$!"PcZY020,l5t2P2L2j P5l5腡 2~8_5l5h#j5`2>j P5l55 2~85l5h#뮋5l5j h"W 5l5_h4c%P+ZYt"8u5l5h#GujPW l @02VDž25l5Y/2,22,25l5_Z15l5h+#1t5?u,f1PhA#i2^_0,Hn5t5hU#Phk#&jjj502 E ,)ЉEE E 12T22tq1x2DžDžhh2RjVE5t& u0P4[PVh#q1q1h Yt8t P>Zq1:udP9Xt= PXt߃=q1uF t8t P_q16Yq1=m1uyq1uh7%Zq1ghPhm1 =v&j?$5q1h#0 m1hh#hm1輵 =w=q1tj $ h#P) j h#V~ h#gX#!h#NX3"#h#2X3"#h#Y3"#h#_3"#h#X v#h#XW#("yh#X3"#]h#X3"!#AV j XZhjY^hj_XhjXZhjY^h1j_XEt7U ESRPà i1uSjj_Xj,XE j:0[^t*E 0QYuU ERP|XZEjh2`s^_uh#jY[hrj ^_E 0j@VZYÅt @1hPW E @Dž=2t 22ER@PXZ=2=2uu 2ujSV =2t  291Ph#502 5 2菎X=2W뻃jh2rXZh#jY[hrj ^_xe[^_]UWVS}u h P菰ZYtdh S~ZYth SmZYut#269=0~u0+hd $VW ctD~σdu,p#2ЃVu8h $h"h0,jJlul#2t#2h $h"h0,oSh1 $h0,_j ,9u!=p#2tE-#M1)-;u5h#2UWVS] 3yh3"jK <62 1h$Su uc`Gt+It2EtJa>$ $ 52먁%52뜡l5u3"<62@>2z52k525l5$QP5l5P h4!W@Hl51+H 52l5u3"<62@>2jjjh, h($/52jjjh,hL$Xz PPhm$h0,Jj , 552ut WGF;ttpG1dGnSj5#2/ch, t h j5D>2oUWVSTuE11h]$u Vk t4gt$utGu3l5E8 l5;u=l5? ,E)ƅct3SOYt@E'UcMM@uShd$jEEt PcEE}tvh\#jh/"Xu*p$jh$SSSh\#jUWVSĀu] P222@2*$2h£2a1Y$Gt&W =(2uRh(2XZ RwP ?u<22222hE%Y1u"h0,h $tjEDuE2h$SV tsmtW~փptXrth0,h<$-jUft$Cuh2h2h6$5l5{뜡l5藠됋=l5T2yU7xVh$d[ZuUu;EE|Zh$Y1ۅt3Rt込Ztt@ <uCuRXtjh3#h#7 Åtڄ5[5ͱt5[5豱jjtRP12uh0,h$ht5252'YX舃52轗hIRhLj hLjhIj 5[5whh 2cEEj@xtj@|t tu1jXxtPt|XZt }u %}u ѭ$j@}^~jWƋxZYoV tJXK;tujjjjjjjjj jWVjtǃ4tj芘|W΃WNVXx;]}4|4C_XP|j(à tPjjSh"KP2j2j"Ě2[^=T2t jeY jjXZ[?21e[^_]UWVS(}E 0o333XDž1DžDž1h $u WJ @p&ab$`$zFjhjj5l5hս#nBul5jhjjj5l5h$/336l53' ,)Džt&jjSyǃ y Sh\#jRt d11PW[X%=LP33USh$PQhh!|Ãuh"$TShVx uj PVj j33S~y hA$jNY13330,u,3@ftPhht@ƒ PBt3Zu h$PP[y h$5y h$u@U jPV;0S3+63h$j)Phj &j#W̬à y8tjh$j赭Y11PeȃZ…tuʼnu8,9uDž 9u1 [j&jj OuSDžSP^ y {8tjSh$j1ș 33)uyPZy he$ƅy ho$t*WI.#jjWjh.f"h$h$:(h}$|UWVSDžDž }~]E ph %V ZYÅuh %M_h %V[^Åu!h$h %h %M (1Dž` %+DžDž$Dž DžDž(,Dž\EEEEEjj6Y[@Sjj#^_@TjjZY@ÈUK DžDžDžƅT %kuU % Rh$Pu u}VSMh 6??4uƅ뙃Nw$`$Džo%Džqfe$$DžW%DžEl5`5l5l5lXZDžÀt ˀDžE%DžhDžDžDžh %KX ƅeDž_%DžLEH; ,t dSlE tEp ,U)‰u (W]jjjWSƃu$k^ ; ,u uPjWPt kuɅ! h %Jph %JX; ,u;VWvQjj ,u 4W:Sƃ u uPjWdPmt ,h %I`\(PX h %cIhd(S/h%AIplS]z  d h ȃHtd @Iu 俀dhd t @SXd@RfustS_v8Sh!W "t"t3"h %PSh%j+(P,h3"h3"h3"h%j+(Pdkt(PG[ h7%Y@uh$h,%$XZ uh$h9% jj Q(Shzjh$I Pt $@uh$hH%E .S?xÍxXwà t=&Sh^%+SuHV8t hz%ZXv<8t h.")(P Y   Sh%DžDž Dž$DžXZjP+(PCw @5 @c~Sh% tt Fdhdуhu,PP ,} 4 dhu3 Pj ,} 4A xdhPjj @Hs8th$h%\Y[g@tO8h%78)8 hfhh5%BR_Z@u!8th5%h$hD% hhR% RY[@u!8thR%h$hD% (SvZt&uSh$hb%~SPhw%rh%_St&h,hB!h$ u h%[e@Pjh0j@uhK& YUtPjh0j@tv(\נShy\UtTj _Z@u h L&` [Ttj ZY@to d[_/Tt&h,hB!h$S u h% Y@uh$h%quth\h!h%$^h\ǟShy\UX 艟Sh#X[e}Ph% XZh@(P6t_tPh$h% {d%h t =u貝dr=1r ,} QP(P @uh$h%dh % u3" %u3" %r ,} QRPhO&\(W@uh$h.%1҉hSP xZY@u hA% XWh>udr dRP(Pduh$hM%Dž9~T4P ZYu4h]%x u4hu%$ _X떋t x tU@h% h%P(Pr fuh% 8t t M U䍅P(W f@tWYt4z t)ЉCR" ZtRȋdhs%tz tRu;uW1s-r' h%PWD "t@tWhRjVWE0[_~ tVhޭjjxvg@u h%Xu u(S sh%h_g@tzhShљjj@@Sh @PZYy+h$h%l[_Dž 1Džfu!(PY@uh$h%(XZtPMXh t=t HXtYZP P_R`Dž[V(SC ZYtPX*ScPtjP舙SNS ;+tP_h@tu h%^;lzY[h@t1\t&jRP薖 @uh$h%XZhu t$SAh$h% h$h%؍e[^_]ÍL$qUWVSQ@YDžPT31L3Dž,Dž0Dž4Dž8Dž<hsI%S@ +H00$>%@(5%@(55l5fp31Ɋat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @fp3FDžLj LP5l5ƉP 8u!l58tL8u ;PhG%pj LP5l5t ~l5:t L:t5l5hG%3 @(5@wtQhG%jX @(5jh,,,,Y^l54 @(5j LP5l5t,l5 :t L9t RhG%j¯@=RhH%l58 @(5 0LP5l5l5_Z8tL:t Pv)ݝ Q݅ tjRPh8H%6#v5l5h\H%AٽFfF fD٭D߽ ٭F $,,߭ #٭D۝ ٭F ,xy5l5hH% uhrH%E,^ @(5T\t.hH%j LP5l5Fr< xl58tL85l5hH%$,%@(5 @(5 @(5 @(5 l55,tDFu hH%)B卅(R$R RRRRR RRRRRRRRPh#QQƃH1Ʌ~ )1@(5h߼#^Y13@9u919~3Ph !&GXZj ; @(5t1DžtDžxDž|Dž:h(5Vj5l5tPCPhH%/(55rJB5R< @(5@Yj LP5l5o, xl5:t L:t5l5hI%=hh.I%@(5% - @(5l@(5%@(5% @(5DLP5l53XZL8u5l5hd#6LP5l5x3_XL8u5l5hUI% ,@)Ht{fp3B(5j.S贖Y^u SZ)؉@?wPSP@Ƅ t@ ,t ,fBۍ1V*@KjKPV**@SV*VdP+$TVhI%jF1 Hd`hSVjz4S(mX@(5t=, hI%+Xt1DžtDžxDž|Dž:h(5VjStPPh\#j(5BtÉ3ru hI%e 5Jr rrl5 y hBL&LA(5@t"55h5Pf t h%!41DžDžDž:PtPj4tPP4hI%jxtA(5t hJ%Xppj0j)55t h9J%^_A(5tVDžjSj'j)55{t hRJ%jSj(j)55Xt hoJ%BP7P@(5؃Y^u hJ% u0,1҃‰3Dž@0 r+0@3,Dž@0 @4Zu hJ%Ktd33133Džd@(5@t6jdPjh55;;@s3@Dž@=5u(jPj j)55@u hJ%5,t/҉jRj*j)P@u7hJ%TDžjRj+j)P@u hJ%'@(5%u) t DžDž j Sjj:55y hK%A(5t-DžjSj&j)55t h,K%0փ =,t1ۅt#VXu hGK%/d35h31҃0t9S 1 C)C.K,h3d3 9v1ۃ8t/08J-0B_u8hdK%=,tC)C/C A(5@"8Džjjjgà 8y hK%\555f5'u$55tjRj.j)Srt hK% =,tMjh,jj)SGt hK%=,t"jh,j j)St hK%h5S y hK%Ph5S( yhK%uSӈ^P,tf9} hL%r[jPShh55yh0L%$jShh55`yIhFL%jl= ~ hL% YDždjdPhh55DžjSj$j)55y h\L%bZjSj%j)55y hyL%bX@(5  r)r  rr,PR(PhL%5!xPhL% 5 xP)< ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6 ks~$m &sW&({' K&ނe$,K!҇ ׇ v t & = T k  ' ' e!} T$#}(" T4" a   `" sB#  :!  H" m#; y`"z &  %  {# ) A / A $ 5  g$ r$& a$5* ; . #<6 D 8 $.? J E $E W E 7#E c F o CF u CF N$W G%a !} !} #   $ $ $      ƣ   $ ! =%   4 OH%      m~$ x& x<" ƈa 3"h 3"^r | ei`"  3"  ̇k   7!usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportal"ߐ   ?$@@ #Ǐ @@ #  )%ԏ * 0 a@@!6"a@@6 unblock and -DNO_CONV?]^@^x ^]@\oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputhtwtuuuuutuuuuuuuuuuuuuuuuuut$t:tuuFtRtttuttttuuuuu&u 0100prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s(5ER_ly_ly@ NNN"NNNN"??????????N"NNN jX/\ODw oUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undo29!   md[P& m m mӁ"m/ m3/"m m d$m m m m m@ m@  m m m% m,  m7 m? mi`"m8@G mL mE>!m P m usage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocacheɄڃ [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dUaiulfs_cleaner_mainbrelsegetblkincorelfs_dino_setiblfs_dino_setdbcheck_summarytry_verifylfs_dino_getib]pL@^p^cbbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALL%s: clean_fs returned %dincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free list?B?8!!!Usage: %s device %s device command [arg [...]] Available commands: forcerw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgekeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]^jv׉1xQ"@Ռkzƌ; a18$!0!0!0!0!0!0!"1!I1! 1! 1! 1! 2! +2!;2!R2!1!g2!2!2!2!2! 3!!3!73!O3!k3! 3!!G##G#$3!&G#1G#23!3G#4G#53!6G#83!93!93!:3!;4!<$4!=<4!@K4!A_4!B4!C4!D4!E5!F5!G5!H5!J/5!LL5!M]5!Nd5!Ot5!P5!Q5!R5!S5!T5!U5!V5!W6!\6!a-6!c76!dr6!e6!f6!g6!h6!i6!p6!qG#sG#tG#u6!vG#w6!x6!7!7!I7!h7!u7!7!7!7!7!7!8!(8!@8!]8!u8!8!8!8!8!8! 9!'9!79!S9!m9!s9!9!9!9!9!9!9!9!9!9!:!!:!0:!C:!N:!G#G#G#G#X:!p:!:!:!=!=!G#=!>!G#(>!K>!^>!q>!}>!>!>!/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionreallocarrExtended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.bad disktabInvalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table4#}:!=C!GC!QC!ZC!aC!pC!wC!}C!^o&C!C!4!C!T:!C!C!C!5$C!C!9!F#C!C!C!C!z$C!C!C!C!D!||||4#}:!=C!GC!QC!ZC!aC!pC!wC!}C!^o&C!C!4!C!T:!C!C!C!5$C!C!9!F#C!C!C!C!z$C!C!C!C!D!^o&*F!.F!3F!29!;F!@F!FF!LF!RF!YF!C!`F!dF!5$8"C!z$F#jF!z$pF!>1$   usage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdH!H!"!$3#Ү$Zf"a$H!H! H!H! H!H!d$@e$$H%!H!@q$@H!H!usage: %s [-o options] special node getmntoptsspecified device does not match mounted devicemount table fullincorrect super block%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimeWarning: realpath %s"%s" is a relative path.using "%s" instead.*BtH!H!"!$3#Ү$Zf"a$H!H! H!H! H!H!$H!@H!H!usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidgbcaseinsballnamesH!H!"!$3#Ү$Zf"a$H!H! H!H! H!H!H!@usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %slfs_copydirnamelfs_dir_setnamlenlfs_dir_settypemake_dirlfs_dino_setib %!9E##m##y## ǧҧ##$r##################ը########G##s%s: can't read disk label; disk type must be specifiedbrelsegetblkincorelfs_dino_setiblfs_dino_setdbcheck_summarytry_verifylfs_dino_getiblfs_writesuperlfs_ss_setocreatelfs_writeseglfs_newseglfs_dino_setiblfs_dino_getiblfs_dino_getdblfs_update_singlelfs_updatemetalfs_gatherlfs_fi_setblocklfs_writeinode]pL@^p^cbzero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s50rf_ReadSpareTableT~m!Hr{,Dm!Hra+Qm!Hr{,Rm!qCm!qIm!q0n!q1"n!q4/n!q58wbr֡֡rT:T.7M"!fa\!WRM!HC>usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / quitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl23Ldf/a!!.!O!`!!!!Ա!!!F!h!!!!!ֲ!!0!h!!ȳ!!!4!W!z! ! ! ϴ! ! ! ! ! E!j!~!!!Ƶ!۵! !$!;!X! o! |! ! !!!=!W!h!!!!ʷ!!!4!d!!!Ҹ!!*!]!!!!$!K!d!|!!Ǻ!ٺ!!!5!Q!!q!!!λ! !!!!&!">!$o!%!&!&!&׼!&!'!("!(Z!)|!*!*!*½!+ٽ!, !,!!,!?!?!?4!?Q!@j!A!B!Cn!D!E!F!G*!H current disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. failed to clean Unit Attention: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %sresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identifyreassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %1@O^mr5PFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslipE HH5IIGHEOOOOOOOQO]OOOOOOiOuOOOOOOO9OOWPQ@RR'QsYY[Y\Y #.%!!!!bitmask_printbitmask_scan>!2N!U3Z!d!U3p!v!U3Gl#!U3p!!U3!!U35 !4!Z5!(6!U3 !!U3&!+!58A!--[!&%i!U3y!!U3y!!U3y!!U3y!!U3!!7:!U3!!U3! !U3!!(!U3G!K!U3g!r!U3 !U3!!U3!!U3!!U3!!U3!4!U3L!Q!";";w!U3!!U3!!Z5!&!K,K,!U3!U3!U3!U3%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorcccccccd!G|xߎi"J2~~'''o܁+++2bbbbBbbRbbb$yў!ը?0Dm8+֥vRV¤zOwkǧ&/ǫ3RS- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. C^r"# !*!#####!###!"###"] g q #!##G!##o!!##!##"P ###"--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)Waiting for dataHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t3"h!x"- Cannot allocate memoryLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESCOLUMNSkrklkukdkPkNkh@7kDhcxndaticmso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadshifttildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundYZYZQZXZBZZZZYZZ_ZYZZYeZyvvvvvv disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Eno_editbootno_clearbootno_setbootgetmachinegetubootpathsgetfstypeparseoptionsmainF"b%# 0y$4F"<F"HFz$@F"@"8F"(!Dcf$ F"@F"LF"Pq$Tset_sunsumcompute_sunsum$+i386_setbooti386_editboot*$$$$Ѝ$K"K"K"K"$, Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'Unknown option `-o %.*s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallconsole %d console %s invalid console name, valid names are:/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbd=]M~ݏR"R"*R"pQ"pQ"2R"9R"HR"[R"usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: dz%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv{;WwwUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readPiApopdnepushdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory M!my!!!!m!!!!!!usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvwʹʹʹʹʹʹʹʹʹʹʹʹʹʹʹ,;ʹʹʹʹʹʹʹسʹʹWuʹʹŴʹʹʹʹʹʹʹʹ)TIJwʹʹ6w-<Hfݲʹ %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longC    J 9 1 (     r      - b. * b. - b. b. b. b. b. . b. .. - -  . b. b. b. b. =. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. s- - b. b. - - b. - - b. b. b. b. b. b. b. b. b. * , b. b. b. b. , , - b. b. b. b. g. ,- b. b. * , b. E- b. T- b. d- b. b. b. b. b. b. b. * $+ b. .+ :+ b. j+ b. y+ + + + b. + + , &, 5, N, &, R, a, p, b. , 7 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 7 7 *8 *8 7 8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 A3 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 5 5 *8 N6 c6 *8 6 6 *8 *8 *8 6 6 6 7 !7 *8 *8 *8 67 U7 t7 *8 7 7 7 *8 *8 *8 *8 *8 *8 M3 R3 x3 3 *8 3 *8 *8 3 3 3 3 *8 3 4 %4 *8 4 4 4  5  5 55 @5 *8 5 abcdfiklnoprstuvwxABDEGHLMPTUVXYZI @I H @I H @I H @I vH @I H $c 2c Bc c rc Rc bc rc rc l l l n m n ~m m m n m ././@LongLink-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./      :   R usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directory                        h    ~ P  X Ȃ N     ΁    ǁ Ձ     ҄    u  = W ; f -        Z e o  i m        q    u  y  } " "!!"-":"-#-":"-#$"P"d"x"E"Z""̩""#" "_"^"F"<">"?&"9"   3 f O ؞   ݟ ݟ   Ѡ Ѡ ' Ѡ Ѡ Ѡ Ѡ Ѡ Ѡ Ѡ Ѡ Ѡ Ѡ R q PATH=' V  0 4           = F M  V _ ~  t `      0         7 7 7 7   F    F `     !   = H Q V  K      Z s  f m     L a  <   l x       v&$%tq Pg"fF#"d""s3#Pg"c""m""l "%r %ծ"p""n""v ""zI"b    ]E _G _G  F _G _G F _G F F X P U V  W nX W W X  X X }X uU MP O Q T T T T T T T T T T T T P WQ T T Q T T T T T T T  Q T T T Q T Q Q )Q T P f f f f f f f f f f f g g f b g g g g dc dc c g g f g  e }-+?=EOF reading here (<<) document#߷""""""&" ˴$K"".""$$ $""" """"" "%"*"!"?"."3":"A"H"M"U"]"c"h"o"s"w"~"" o o vn n o o o Pp Pp ;3$j"S"^"a"d"g"R"R"b%d$@e$U"^"d"j"p"F%v""@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'|.0"h.1"T.1".8ż"@.0Ӽ" .0".0 ".0"S; .0"   &  - ? Q c r           ϟ ٟ L   ^ ^ ^ ^ b r        1 k k      #  7#Xd# 9"#1"b!"p y ! $$C& h!x" B" :l&B!Ve#!u#"#9i%" "!"S$-"D"S"4#";3$                4" Dž!  %׺ " Zf"9 %% U"` "` `%X z$: -"0: C#Ż LZ&} y"» "F #ę "m u&` "` " " " " " " $ # þ"= J{& ȯ" U"+ " ˾"I m# ") Ҿ"u ھ"  %» }&A ""- "J~ " "z "W/ 0$ I4$ ." "  i z             © ©             i       Ѫ     ˪ ˪   ( ( ( ( (   ( ( H H  M M M M o  M M # * M M M M M M M 1 M M M 8 M ? M F M s  4 4 4 4 4 4 4 4 H    H H H 4  4 4 4 4 4  4 4 4  4  4 4  < @  ڳ  ֳ ޳              ҳ Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${(...)$(...)"((<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:20241216130811Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedpBC"b!""" 3/"z;""d$.".""&!! "i$ i`"$ " v&":v$f "3 Jd&  " " s0! " "ɼ " " (% "ݻ $ "ͽ "о 8"  %h " " #2# " z! """"g"n"u"|"" "@"C$"C "C$ "C!""""%"""+"""""@3"@" ;" "z"""@"" "E"D"@"H"W"_"P"" "@""#"(<")";"0"7" M"Q"U"Y"mv!#]"3f"#e"3m"2l"3s"3r"#"""" "@ @""""option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZ d d  d d > d d > d Y  owner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.     w             E    -   9                            P W   l   s      !      -     O   ""/"`"q""""""""$"/" #O"u"}""""""""""K""""""""""""" """("1"<"E"P"U"\"a"h"q"v"~""""""@}"@"@"@"@"@"@"@"@"@" @"@"@"@"@""""""""P""")"/"6"@"H"O"V"\"h"@o"@t"y""""""q""""""""K"""""""K"""4#}:!=C!GC!QC!ZC!aC!pC!wC!}C!^o&C!C!4!C!T:!C!C!C!5$C!C!9!F#C!C!C!C!z$C!C!C!C!D!^o&*F!.F!3F!29!;F!@F!FF!LF!RF!YF!C!`F!dF!5$8"C!z$F#jF!z$pF!>1$+ o o o  o o o W o  o o o o o   4#}:!=C!GC!QC!ZC!aC!pC!wC!}C!^o&C!C!4!C!T:!C!C!C!5$C!C!9!F#C!C!C!C!z$C!C!C!C!D!^o&*F!.F!3F!29!;F!@F!FF!LF!RF!YF!C!`F!dF!5$8"C!z$F#jF!z$pF!>1$ Y  Y Y O Y  Y Y 3 Y Y Y Y  4#}:!=C!GC!QC!ZC!aC!pC!wC!}C!^o&C!C!4!C!T:!C!C!C!5$C!C!9!F#C!C!C!C!z$C!C!C!C!D!^o&*F!.F!3F!29!;F!@F!FF!LF!RF!YF!C!`F!dF!5$8"C!z$F#jF!z$pF!>1$changing %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tableD5can't get msgbufo! " x! " " " " " ! " ! " ! # " " =" " " " " # [-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]P$w$*$$T$w$4#}:!=C!GC!QC!ZC!aC!pC!wC!}C!^o&C!C!4!C!T:!C!C!C!5$C!C!9!F#C!C!C!C!z$C!C!C!C!D!returning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %d]( ( ( ( ( w( ( ( ( ( ( ( ( ( ( ( ( & (' ^' ' ( ' ( ( ( ( ( ( ' @( ( R( l( ( ( ( ( ( ( ( ( (  !   ܊ !   ˛  ԛ  returning to single-user after filesystem check  ffs_setblockffs_clrblockffs_isfreeblockffs_isblock""""        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~? L     wapbl_replay_readwapbl_replay_can_readwapbl_replay_writewapbl_replay_freewapbl_blkhash_freewapbl_blkhash_clearwapbl_circ_advancewapbl_blkhash_remwapbl_blkhash_inswapbl_circ_readwapbl_blkhash_initwapbl_space_useduntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d/#6#6#6#7#7#H7#Q7#z7#7#&7#0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-4#};#;#;#);#>;#P;#d;#r;# + s+ * * + {+ + * * x, ܢ++++(+@+X+t++++أ++++(+H+h+"#qc  c Oc Oc Oc Oc Oc c Oc c Oc Oc Oc Oc Oc b Oc c Oc  c 'c g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g 4#}:!=C!GC!QC!ZC!aC!pC!wC!}C!^o&C!C!4!C!T:!C!C!C!5$C!C!9!F#C!C!C!C!z$C!C!C!C!D!8$!0!0!0!0!0!0!"1!I1! 1! 1! 1! 2! +2!;2!R2!1!g2!2!2!2!2! 3!!3!73!O3!k3! 3!!G##G#$3!&G#1G#23!3G#4G#53!6G#83!93!93!:3!;4!<$4!=<4!@K4!A_4!B4!C4!D4!E5!F5!G5!H5!J/5!LL5!M]5!Nd5!Ot5!P5!Q5!R5!S5!T5!U5!V5!W6!\6!a-6!c76!dr6!e6!f6!g6!h6!i6!p6!qG#sG#tG#u6!vG#w6!x6!7!7!I7!h7!u7!7!7!7!7!7!8!(8!@8!]8!u8!8!8!8!8!8! 9!'9!79!S9!m9!s9!9!9!9!9!9!9!9!9!9!:!!:!0:!C:!N:!G#G#G#G#X:!p:!:!:!=!=!G#=!>!G#(>!K>!^>!q>!}>!>!>!#w /w w Tw `w lw xw x x <~ T~ s~ s~ s~ s~ B~ s~ H~ s~ s~ e~ SFH0eCE#N:!SFU0eCF#9!Hah!IdontNeedEFI F#F#(s*K>;]$F#|nQn- q+$F#0F#|nQn- q+?F#IF#|nQn- q+VF#_F#|nQn- q+pF#{F#|nQn- q+F#D!=rGy=iG}F#F#;Mt?F#F#mWC 3KOOF#F#yD<#*=(F#F#3Dh&Ǫ"F#\ M}-F#G#-чHC!G#-чHz$-G#ZIчHw$GG#IчH$ZG#IчHF#eG#2IчH}:!G#S'@ )ѸG#G#*1@ )ѸG#C!1x )ѸG#G#store_tblstore_gptbackupa:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedgpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in6_statusin6_addr_flagsin6_constructord#+t2%+ d# d#+e#n#in_statusin_addr_flagscommit_addressdo_setethercapssetethercapsf#f# g#p1 +0 1 40 1 1 1 @0 1 1 1 L0 1 1 1 1 1 1 d0 1 p0 |0 0 1 1  1 1 1 / / / / / 1 / / / 1 / / 1 ^o&1$%do_setifcapsdo_setifpreferenceusagemainclone_commandsetifflagssetifcapssetifdstormasksetifaddrstatusprintallsetifbroadaddrsetifnetmasksetifprefixlensetifmtusetifmetricm#zi+!yi"""+e#+y#""+%@+6"%+e#@+rn#dX$+?#+o# +-m#x+o#ط +o#ԫ+o#ԫ+o# +o# +o#o#o#o#p# p#p#)p#@5p#Ap#Mp#Up# ^p#0gp#@pp#yp#~p#<%˽&p# p#p# p#@1$%media_constructormedia_statussetmediainstsetmediasetmediaoptinit_current_mediasetmediamodeLr#Ur#q$\q#@+aq#Ur#q$\q#@+q$Ur#q$Ur#+_r#Ur#_r#Lr#+^r#Ur#Iq#q$$+,"Ur#,"l+hr#Gsr#hr#zI#~r# %^o&1$sr# % hr# %`r#r#@r#r#sr# %zI#~r#$      paddr_match (   q    N    x settunnels# +s#+print_link_addressessetvlanifsetvlant#+t#t#+t#t# 3"   B I          P                W ^ e l s z     setifbssidsetifnwkeysetifpowersavesleepsetifssidsethidessidsetapbridgesetifpowersavesetifchansetiffragz#z#z#z#setifrtsz#+z# +z# +z#z#5 +hw#+gw#hw# * +H$+z#l+z#+z# +@%+Xw#@%* * ++%l+u#@+F!m y#y#N ;w#;w# -u#-u#  [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %sinet6 address lifetime not allowed for the AFpltimeia6flagcould not determine link local addressinet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sclonecmd[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s%/ ]1 ]1 ]1 ]1 ]1 ?/ ]/ / ]1 ]1 ]1 / ]1 *1 $H!H!"!$3#Ү$Zf"a$H!H! H!H! H!H!H!@H!H!usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o > ?> ?> ?> *> ?> #> ?> ?> ?> ?> ?> > > 2G L L L L kG L &G L L L L G G L L L G :H L IH L L L L L L L L L L pH H L H H I -I I I L L L I !J HJ $K J L TK L K K %s partition type is not `%s'####T#####G#d######)#P#x####$#K#k###%s: can't read disk label; disk type must be specifiedWTWTbSS usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock>X Z Z Z Z X Z Z Z Z X Y Z Z Z 9Y Z Z ~Y Z Z Z Z Y Z Z Z Y Z Z Y Z Z Z Z ;Z Z Z Z Z _Z Z Z Z %s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk labelwtfsiputallocinit_resizeinofsinitrdfsSSSWTWTbilog2usage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir e b 3g 3g 3g 3g 5e 3g 3g d 3g 3g 3g d (d d 3g d 3g 3g 3g 3g 3g 3g 3g 3g 3g 3g 3g 3g b 3g b c 3g c Ue c (c 3g 3g c 3g c c c d 4d @d d 3g d |e kq ]r r ^u ^u s hs s s t bt t t t t u q q q q q q q q r  r r  r *r 4r >r Hr usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%x(knNzDK A-C6??333333?{Gz?`RMb@A} } } } } } } } } } } } } } } } } } } } } } } usage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()U U U U U  U               K K K   dz ճ ܳ γ    y p               *   6  Q o  ~    Ƅ  v   V 1  t  @ @     '  V e    Ѕ  K ۅ       ܃    ܄      ф      B         f r  N  Z DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR%#8#Q#~#####1#Q#q#####?#i##dfLnqSsTtv0123456789abcdefUGHRBD M@dmCLS1@2plbatalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s InternetInternet6AppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspec Վ Վ  Վ Վ Վ Վ Վ Վ Վ Վ Վ Վ Վ Վ Վ Վ Վ Վ  Վ Վ Վ Վ Վ Վ Վ Վ Վ Վ Վ  Վ 6 N Վ j y  Վ Վ    я    Վ + G hw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Y@Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlrecvrequestsendrequest(#S#u#  ͙         Μ  ֙       g      Z    O    m              7  I X           ^  7 F    ***************************************************************************************************************************************************************************************************************************************3"u#y#}####TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sNLSTMLSDMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)_?n>ZyNetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gzaSfk>puzZ{=w w w w  Ӥ  w  w w  w = w w w @ w w L Tg@?|@n\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i]iuo{E&2)`lxKW~`47}07f47+87!8777774777773466635Ǯ$W$$K"D2$$`2$3"2 $3"2$$2¯$.$2=$E$~2\$g$2y$$`2$$}2$3"2$3"2$3" 2$®$`2Ϯ$(2֮$ݮ$2$3"X2$w$2$Ǯ$`2$$ 2!$1$ģ2.$1$`2?$$2H$.$2V$^$2y$$2$$2$3"2$3"2$$ 2$.$2̯$3"2ׯ$$2$$2$3";2$3":2collect$$+$F$1$J$]$OOOlOOOOOOO!ӭmount_disksT$$*$c#P$NAME=4#}:!=C!GC!QC!ZC!aC!pC!wC!}C!^o&C!C!4!C!T:!C!C!C!5$C!C!9!F#C!C!C!C!z$C!C!C!C!D!str_arg_subst> get_available_cds    !"#$%&'()   !"   !"   edit_and_check_labeledit_fs_type_ext1L_Lo56f  q'/ 4#}:!=C!GC!QC!ZC!aC!pC!wC!}C!^o&C!C!4!C!T:!C!C!C!5$C!C!9!F#C!C!C!C!z$C!C!C!C!D!*$$$$Ѝ$K"K"K"K"J$a$disklabel_set_part_infodisklabel_write_to_diskdisklabel_change_geomdisklabel_freecdtUaOacA_c2\XfbZP\XFX*ph_l][SZdugHjSkYY4YS]Y4#}:!=C!GC!QC!ZC!aC!pC!wC!}C!^o&C!C!4!C!T:!C!C!C!5$C!C!9!F#C!C!C!C!z$C!C!C!C!D!C($ /$@2uuuu7vselect_part_schemeouter_fill_part_menu_optsedit_outer_partsz$$&!$$$B!$~;#$"$ $ $:&$"$ g#$ "($i;"0$!@$E$S$]$ m$q$F7!$ c%$t!$%$"$5$$ !$ x&$L&$$$ q!$ $$ $8 $."$1D#$%$0$;$E$normalize_clones   !"replace_by_default----------------------------------- - --------------------//tmp/usr/var,;E[eo3Qy;]/?al#-7J#A2?LY3Sfs)7Uer`2W?`5422p2 P2T-]Z h  CVi~pm_from_pepm_whole_disk./01234564#}:! %"$$$w$*$$$$P 4!U#$Z#T$ z$C!$- #F#c#<$g#k#z$$C!G#$F#gpt_get_uuid_part_typegpt_get_part_alignment$gpt_get_part_deviceDetails for index GPT part - gpt_read_from_diskgpt_create_newgpt_free@($Z%/%e111l0B0b,y&#',+-8I"$"'g!!*p9;9=y<25= $"0#!##"w$}:!""]$]$ F#$ F#E#C!z$F#G#G#G# F#!/#6#H7#7#z7#& SFH0eCE#N:!SFU0eCF#9!Hah!IdontNeedEFI F#F#(s*K>;]$F#|nQn- q+$F#0F#|nQn- q+?F#IF#|nQn- q+VF#_F#|nQn- q+pF#{F#|nQn- q+F#D!=rGy=iG}F#F#;Mt?F#F#mWC 3KOOF#F#yD<#*=(F#F#3Dh&Ǫ"F#\ M}-F#G#-чHC!G#-чHz$-G#ZIчHw$GG#IчH$ZG#IчHF#eG#2IчH}:!G#S'@ )ѸG#G#*1@ )ѸG#C!1x )ѸG#G#PIIIPIIPIIIIIPIPIIPIWWWWWWWWWWWWWWZZZZZZZZZZZZZZZZZZZZZZZZZZZZZmbr_get_generic_part_typembr_get_part_deviceadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_read_from_diskmbr_create_newmbr_init_default_alignmentsmbr_free `$/$.$WbZ%W]cb'SJX^JJQSRRR[c_O"P*pmrO`Kzi`LQOC_UkTYT\9! $$$9!h7!F#$C!A$`7!;!$$#$ 6$D$/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 10.1 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.1 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.1 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.1 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.1 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.1 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.1 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the first serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogxfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgcdn.NetBSD.orgftp dirpub/NetBSD/NetBSD-10.1ftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/10.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:iwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr/usr/mdec/mbr_ext/usr/mdec/mbr_bootselCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)Ukrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal errorparts->geo_sec != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition 4 4 ʭ խ 4 4 4 4 4  4 4 4  ***************************************************************************************************************************************************************************************************************************************3"u#y#}####usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_writeonecontrol_handle1control_recvdatacontrol_free q  q q q  ȵ ׵ , _ q q <  q q  q _ n q q q q q q  a#>#P#dhcpcd_readdumptimeoutdhcpcd_readdump2dhcpcd_readdump1dhcpcd_readdump0dhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_stderr_cbdhcpcd_handlelinkmaindhcpcd_handlehwaddrdhcpcd_linkoverflowdhcpcd_handleinterfacedhcpcd_prestartinterfacedhcpcd_initstate2dhcpcd_reportssiddhcpcd_handlecarrierconfigure_interface1dhcpcd_selectprofile Copyright (c) 2006-2021 Roy Marplesduid_geteloop_starteloop_signal_maskeloop_signal_set_cbeloop_exiteloop_q_timeout_deleteeloop_q_timeout_addeloop_event_delete_writeeloop_event_add_rwif_discover=Qe2FZn,[l!5n^JXar%Kiv?a+p.P{VggOcwsplitvadd_environparse_optionread_configdefault_configB%b;"c˽&d%eD%f%g%h"%i;"jǮ$k%l%m%n."o %pv."q0#r%s%(!t%u!v#%w%x*%z!y:%A@%BM%C%DT%EF%F^%Gh%HE%Ie#Jr%Ky%Lrt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSfwefwipvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigreading standard input%s: reading lease: %s%s: %s: truncated leasebootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s not foundNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: %s: became stale%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 router solicitation for %0.1f secondsreachable again%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.c%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completedelayingbroadcastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to decline duplicated DHCPv6 addresses%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%s: failed to request DHCPv6 information%s: failed to request DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %s%s: redirecting DHCP6 message to %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6`??cccccccddd#fdebbbbb\ddddeeeeet               &           O     d     /            ? <%L%pQ"L%F%_X$-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limit%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s failed to get receiving packet informationinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 addressrssssssssssssssssss.......1..K.b..ڇ. ."......ʆ....... ..C.Vn..·..gfVU%I@843.*c'$#" rbFCV{J_%e}"{؎%_%f#_%լ_%~&_%mG$/`%E_%]BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~_%,_%S%[%`%W%[%_%}"؎%_%f#_%_%~&_% mG$@`%_%&`&@&3;;;wwwww-wwwwwwVfn_%%}"f؎%_%f#-_%n_%~&_%5mG$v`%_%/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d %ju%s%0*jusnaparchivedsappendschangesimmutableuappenduchangeuimmutable ,O޷޷Ÿ޷޷޷޷޷޷޷޷޷~޷޷޷0޷N/Alink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x+]aBBBBBBBBBBBBB.BBBBBBlllllllllllllllllllllllllllll4llollllllllllllllllllllllllGllllllllQ H             }      pqrstuwxyzPQRST/dev/ptm0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pidjanuarygmtmidnightyeartomorrowa.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturday<*+%^O0# ^4lrNbb_,.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c !"#$'+: ,2/ +0-*1. )#'"%56!    full-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT.sysctl hw.disknames failed/rdkno match for `%s'sysctl kern.root_device failedkern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot allocate %zu blocks of size %zuCannot re-allocate %zu * %zu bytesCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]Cannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format stringphh`XPH@80( xp%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakech5MS7) ;уrL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb n    #$ ! acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$^G^M^Ikbskcub1kcud1^M^J-ÔÔ-ÔÔÔÔÔÔÔÔÔoÔÔÔÔÔÔÔÔÔÔÔ^****4**44*4*4************444**4*************4ݚ************4****g**E**u4********4*^ɕÔÔÔÔÔÔÔÔÔÔɕÔÔÔÔÔÔÔÔÔÔɕÔÔÔÔÔÔÔɕ,,,*,,,,,,,,,,,,,,w,,N,,,,,,,,,,,,,A,,,,,,,,,,,,,,8,,,,,,,,,,,,,,$,,,,,,,,,,,,,,999(99999999999999u99e9999999999999?99999999999999699999999999999"99999999999999unknown error%s: generic terminal%s: hardcopy terminalTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo database%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe    # "  !""$acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerombitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswslbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon2Kn,X` %K/usr/bin/rshRCMD_CMDCannnot exec %sR%zu W%zu L%lld %d *0*12aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz   !"#$1234%&'(5678)*+,9:;<-./0=>?@                                                                                                                                   #& +6 )4%/7(3-!0,1'8"5.*2$ 91)! :2*" ;3+# <4,$?7/'>6.&=5-%      :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'argon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzArgon2idArgon2iArgon2dUnknown error codeOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureOutput pointer is NULLPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0The free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Some of encoded parameters are too long or too shortThe password does not match the supplied hash&##&$$$N#F#>#6###~#v#n#f#^#V#$$##############.###                                         ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[acosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error neg**non-integral: DOMAIN error E`lć@:ك=['߅zn"[gG!֊\,܆@E`lć@:ك=['߅zn"[gG!֊\,܆@n"-DT! @incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checktoo many length or distance symbolsinvalid code -- missing end-of-block(EE':Qۧjs ϶`jϭRخhA@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler @  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N60w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-need dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version  0@`  0@`  (08@P`p        L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c      str != ((void *)0)fmt != ((void *)0)src != ((void *)0)ps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)prop_string_append_cstringprop_string_create_nocopy_prop_string_rb_compare_nodes_prop_string_rb_compare_keyprop_string_create_formatprop_string_create_cstringctx->poec_capacity != 0ctx->poec_buf != ((void *)0)<>&plist version="1.0"!((*cp) == '\0')?xml !DOCTYPE plist